Advanced Search (OLGA)

Gene: Or11i1 (olfactory receptor family 11 subfamily I member 1) Rattus norvegicus

Analyze

No known orthologs.

Symbol:

Or11i1

Name:

olfactory receptor family 11 subfamily I member 1

RGD ID:

1333023

Description:

Predicted to enable olfactory receptor activity. Predicted to be involved in detection of chemical stimulus involved in sensory perception of smell. Predicted to be located in membrane. Predicted to be active in plasma membrane; INTERACTS WITH 2,4-dinitrotoluene; bisphenol A.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

olfactory receptor 392; olfactory receptor gene Olr392; olfactory receptor Olfr226; olfactory receptor Olr392; Olr392

RGD Orthologs

Alliance Orthologs

More Info

homologs ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Other homologs ²				less info ...
Homo sapiens (human):	OR11A1 (olfactory receptor family 11 subfamily A member 1)	HGNC	OrthoDB
Alliance orthologs ³
Mus musculus (house mouse):	Or11i1 (olfactory receptor family 11 subfamily I member 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Or11i1 (olfactory receptor family 11 subfamily I member 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	srsx-37	Alliance	DIOPT (Hieranoid\|SonicParanoid)
Caenorhabditis elegans (roundworm):	srsx-36	Alliance	DIOPT (Hieranoid\|SonicParanoid)
Caenorhabditis elegans (roundworm):	srsx-38	Alliance	DIOPT (Hieranoid\|SonicParanoid)
Caenorhabditis elegans (roundworm):	srsx-35	Alliance	DIOPT (Hieranoid\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	XB5765047 [provisional:or11l1]	Alliance	DIOPT (InParanoid\|OMA)
Caenorhabditis elegans (roundworm):	srsx-39	Alliance	DIOPT (Hieranoid\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	or16u1	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	or16p1	Alliance	DIOPT (OMA\|OrthoFinder\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	197,131,912 - 197,132,862 (-)	NCBI	GRCr8	GRCr8		GRCr8
mRatBN7.2	2	194,443,685 - 194,444,635 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	194,443,685 - 194,444,635 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	202,075,688 - 202,076,638 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	199,957,313 - 199,958,263 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	194,774,275 - 194,775,225 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	209,581,677 - 209,582,627 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	209,581,677 - 209,582,627 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	229,049,044 - 229,049,994 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	202,281,083 - 202,282,033 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	187,111,645 - 187,112,595 (-)	NCBI		Celera
RGSC_v3.1	2	202,243,836 - 202,244,787 (-)	NCBI
Cytogenetic Map	2	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,4-dinitrotoluene (EXP)

bisphenol A (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

detection of chemical stimulus involved in sensory perception of smell (IEA)

G protein-coupled receptor signaling pathway (IEA)

Molecular Function

olfactory receptor activity (IEA)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

taste/olfaction phenotype (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Genome sequence of the Brown Norway rat yields insights into mammalian evolution.	Gibbs RA, etal., Nature 2004 Apr 1;428(6982):493-521.
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:17486045

Genomics

Variants

Variants in Or11i1
7 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	115
Count of miRNA genes:	97
Interacting mature miRNAs:	106
Transcripts:	ENSRNOT00000024351
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358356	Srcrt1	Stress Responsive Cort QTL1	3.66		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	2	163997722	225110681	Rat
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	169358774	214358774	Rat
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	170656145	239614549	Rat
631566	Bp90	Blood pressure QTL 90		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	149957381	221199885	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845370	229470703	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	83465462	229820014	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	20695736	231474293	Rat
1298076	Bp166	Blood pressure QTL 166		0.0009	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	138595962	205135428	Rat
1581576	Pur7	Proteinuria QTL 7		0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	80396178	220931218	Rat
152025245	Scl81	Serum cholesterol level QTL 81	3.49		blood cholesterol amount (VT:0000180)		2	124537199	209621565	Rat
1581578	Cm49	Cardiac mass QTL 49	4.9	0.01	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	145807215	220931416	Rat
61458	Bp10	Blood pressure QTL 10	3.42		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	191709311	217961898	Rat
631198	Cm22	Cardiac mass QTL 22	4.3	0.0008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	78269809	208420281	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	122597372	215234002	Rat
12879836	Kidm61	Kidney mass QTL 61		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	154723085	199723085	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	80396178	220931218	Rat
12879837	Am2	Aortic mass QTL 2		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	2	154723085	199723085	Rat
12879838	Cm86	Cardiac mass QTL 86		0.002	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	154723085	199723085	Rat
1302793	Bw16	Body weight QTL 16	5	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	2	159440891	205135267	Rat
12879839	Cm85	Cardiac mass QTL 85		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	2	154723085	199723085	Rat
2317752	Glom23	Glomerulus QTL 23	3.6		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	2	196140964	251540988	Rat
1549833	Bp257	Blood pressure QTL 257		0.003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	170652929	215652929	Rat
1358900	Bw48	Body weight QTL 48	4.88		body mass (VT:0001259)	body weight (CMO:0000012)	2	159440891	220931218	Rat
4889834	Pur24	Proteinuria QTL 24	5.8	0.014	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	171994826	205135428	Rat
1359031	Bp275	Blood pressure QTL 275			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	188565047	233565047	Rat
1581499	Esta2	Estrogen-induced thymic atrophy QTL 2			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	192287802	229609668	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	4265106	205135428	Rat
12879840	Bw179	Body weight QTL 179		0.005	body mass (VT:0001259)	body weight (CMO:0000012)	2	154723085	199723085	Rat
9589044	Scfw1	Subcutaneous fat weight QTL 1	5.8	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	2	184856304	229856304	Rat
8694435	Bw166	Body weight QTL 166	14.08	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	2	184856304	229856304	Rat
2301966	Bp322	Blood pressure QTL 322	3.58		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	144882354	205135428	Rat
1298083	Bp158	Blood pressure QTL 158	2.62		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	191709311	217961898	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845182	205135428	Rat
1357991	Ael2	Aortic elastin QTL 2	4.2	0.000071	aorta elastin amount (VT:0003905)	aortic elastin	2	169227906	214227906	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	83400752	223709938	Rat
1331745	Bp203	Blood pressure QTL 203	4.377		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	192287802	221089121	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
8694194	Abfw1	Abdominal fat weight QTL 1	11.7	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	2	184856304	229856304	Rat
61366	Iddm3	Insulin dependent diabetes mellitus QTL 3	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	192287802	237287802	Rat
1578671	Bmd10	Bone mineral density QTL 10	5.4		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	2	175931416	220931416	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	151869660	251712708	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	80396034	220931416	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	78269809	205135428	Rat
2300189	Bmd48	Bone mineral density QTL 48	5.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	2	182024327	227024327	Rat
8662843	Vetf9	Vascular elastic tissue fragility QTL 9	2.05		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	159440760	228950743	Rat
2301408	Kidm36	Kidney mass QTL 36		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	184482291	229482291	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	143344967	251712708	Rat
71113	Cari2	Carrageenan-induced inflammation QTL 2	2.7	0.009	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	2	143746578	205135428	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	143344967	251712708	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	114384617	215381366	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	145306936	212705578	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	113746222	205135428	Rat
738013	Alc15	Alcohol consumption QTL 15	4.1	0.00022	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	2	186850607	231850607	Rat
61398	Bp50	Blood pressure QTL 50	4.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	192287802	237287802	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	114384617	215381366	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	151869660	223841096	Rat
1354609	Niddm62	Non-insulin dependent diabetes mellitus QTL 62	4.72	0.000006	insulin secretion trait (VT:0003564)	plasma insulin level (CMO:0000342)	2	117415288	205135428	Rat
61417	Cia10	Collagen induced arthritis QTL 10	3.4		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	2	182635347	227635347	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	83465462	225110681	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	47856345	205135428	Rat
631522	Bp74	Blood pressure QTL 74		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	175008837	220008837	Rat
8694383	Bw158	Body weight QTL 158	7.69	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	2	184856304	229856304	Rat
7488927	Bp365	Blood pressure QTL 365		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	165453811	210453811	Rat
7488925	Bp364	Blood pressure QTL 364		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	163253030	208253030	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	166372086	229820014	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	76328396	209350714	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

circulatory system	ectoderm	endocrine system	endoderm	hemolymphoid system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
1	16	9	2	3	18	12	8	6	5	2	2	2

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001000914	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF061115	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000024351 ⟹ ENSRNOP00000024351

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	194,443,685 - 194,444,635 (-)	Ensembl
Rnor_6.0 Ensembl	2	209,581,677 - 209,582,627 (-)	Ensembl

RefSeq Acc Id:

NM_001000914 ⟹ NP_001000914

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	197,131,912 - 197,132,862 (-)	NCBI
mRatBN7.2	2	194,443,685 - 194,444,635 (-)	NCBI
Rnor_6.0	2	209,581,677 - 209,582,627 (-)	NCBI
Rnor_5.0	2	229,049,044 - 229,049,994 (-)	NCBI
RGSC_v3.4	2	202,281,083 - 202,282,033 (-)	RGD
Celera	2	187,111,645 - 187,112,595 (-)	RGD

Sequence:

show sequence

ATGATGACCTTATCCTGGGAAAATCAAACAGTGATAGTGGAGTTTGTTCTTCGAGGATTCTCTT
CTATCCTACAGCTAAATATTTCCCTCTTTATAATGTTTTGCATCTTCTATATCCTAACCATTTC
TGGAAACATCCTTATTGTTCTCCTAGTTCTGTGCAACCATGCTCTCCACACTCCCATGTACTTC
TTCCTAGTGAACCTGTCCTTTCTGGAGGTCTGCTACACCTCTAACATTGTCCCCAAGATGTTGC
TGATTATTATAGCTGATCTGAAGACTATCTCAGTGGTTGGTTGCTTGGCACAATTCTACTTTTT
TGGATCCCTTGCTGCAACAGAGTGCCTCTTGCTTGCTGTGATGTCCTATGACCGGTACCTTGCT
ATCTGCCAGCCTCTCCGATACCCCATCTTGATGACTGGTTCTCTCTGCTTTAGGTTGGCTACTG
GATCTTGGTTCTGCTGCTTCTTCCTCACAGCCATCACTATGGTCCTGCTGTGTAGACAAAACTT
CTGTGGCCCTAATGAAATTGATCACTTCTTTTGTGACTTTGCTCCTTTGATCCATCTCTCCTGC
ATGGATACTTCGCTGACTGAGACCATTGCTTTTGCCACCTCTTCTGCAGTCACACTGGTCCCAT
TTTTCCTCATCACAGTTTCTTACTCTTGCATCCTCACTGCCATCCTAAGAATTCCATCTGGCAC
AGGCAGGAGAAAGGCTTTCTCTACCTGTTCTTCACATCTCACTGTCGTCACAGTATTTTATGGA
ACACTGATTGCCACATATCTTGTGCCCTCATCCAACTCTTCCCAATATTTACACAAAGGATTCT
CTCTGCTCTATACTATCCTGACACCTATGTTCAACCCCATTATATATAGCCTGAGAAACAGAGA
CATTCATGGAGCTTTGAAGAAATGCTTGAGTAAGAAGTCAGGCTTTATCATATGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001000914	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	ABJ91578	(Get FASTA)	NCBI Sequence Viewer
	EDL81853	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001000914 ⟸ NM_001000914

- UniProtKB:

D3ZB67 (UniProtKB/TrEMBL), A6HUR7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MMTLSWENQTVIVEFVLRGFSSILQLNISLFIMFCIFYILTISGNILIVLLVLCNHALHTPMYF
FLVNLSFLEVCYTSNIVPKMLLIIIADLKTISVVGCLAQFYFFGSLAATECLLLAVMSYDRYLA
ICQPLRYPILMTGSLCFRLATGSWFCCFFLTAITMVLLCRQNFCGPNEIDHFFCDFAPLIHLSC
MDTSLTETIAFATSSAVTLVPFFLITVSYSCILTAILRIPSGTGRRKAFSTCSSHLTVVTVFYG
TLIATYLVPSSNSSQYLHKGFSLLYTILTPMFNPIIYSLRNRDIHGALKKCLSKKSGFII

hide sequence

Ensembl Acc Id:

ENSRNOP00000024351 ⟸ ENSRNOT00000024351

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZB67-F1-model_v2	AlphaFold	D3ZB67	1-316	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1333023	AgrOrtholog
BioCyc Gene	G2FUF-51695	BioCyc
Ensembl Genes	ENSRNOG00000018112	Ensembl
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/TrEMBL
InterPro	7TM_GPCR_Rhodpsn	UniProtKB/TrEMBL
	GPCR_Rhodpsn_supfam	UniProtKB/TrEMBL
	Olfact_rcpt	UniProtKB/TrEMBL
	Olfactory_GPCR1	UniProtKB/TrEMBL
KEGG Report	rno:405227	UniProtKB/TrEMBL
NCBI Gene	405227	ENTREZGENE
PANTHER	G-PROTEIN COUPLED RECEPTOR	UniProtKB/TrEMBL
	OLFACTORY RECEPTOR	UniProtKB/TrEMBL
Pfam	7tm_4	UniProtKB/TrEMBL
PhenoGen	Or11i1	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/TrEMBL
	OLFACTORYR	UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000018112	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/TrEMBL
UniProt	A6HUR7	ENTREZGENE, UniProtKB/TrEMBL
	D3ZB67	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-08-16	Or11i1	olfactory receptor family 11 subfamily I member 1	Olr392	olfactory receptor 392	Symbol and Name Changed	1299863	APPROVED
2008-04-30	Olr392	olfactory receptor 392	Olr392_predicted	olfactory receptor 392 (predicted)	'predicted' is removed	2292626	APPROVED
2005-02-04	Olr392_predicted	olfactory receptor 392 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Mammalian Phenotype