Advanced Search (OLGA)

Gene: Peli1 (pellino E3 ubiquitin protein ligase 1) Rattus norvegicus

Analyze

Symbol:

Peli1

Name:

pellino E3 ubiquitin protein ligase 1

RGD ID:

1311199

Description:

Predicted to enable ubiquitin-ubiquitin ligase activity. Predicted to be involved in several processes, including negative regulation of necroptotic process; positive regulation of double-strand break repair via homologous recombination; and protein polyubiquitination. Predicted to act upstream of or within several processes, including positive regulation of macromolecule metabolic process; regulation of lymphocyte proliferation; and regulation of signal transduction. Predicted to be located in nucleus. Predicted to be active in site of double-strand break. Human ortholog(s) of this gene implicated in colorectal cancer. Orthologous to human PELI1 (pellino E3 ubiquitin protein ligase 1); PARTICIPATES IN interleukin-1 signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

E3 ubiquitin-protein ligase pellino homolog 1; LOC305549; pellino 1; pellino homolog 1; pellino homolog 1 (Drosophila)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PELI1 (pellino E3 ubiquitin protein ligase 1)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Peli1 (pellino 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Peli1 (pellino E3 ubiquitin protein ligase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PELI1 (pellino E3 ubiquitin protein ligase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PELI1 (pellino E3 ubiquitin protein ligase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Peli1 (pellino E3 ubiquitin protein ligase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PELI1 (pellino E3 ubiquitin protein ligase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PELI1 (pellino E3 ubiquitin protein ligase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Peli1 (pellino E3 ubiquitin protein ligase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Peli1 (pellino E3 ubiquitin protein ligase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	PELI2 (pellino E3 ubiquitin protein ligase family member 2)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	PELI1 (pellino E3 ubiquitin protein ligase 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Peli1 (pellino 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	peli1b (pellino E3 ubiquitin protein ligase 1b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	peli1a (pellino E3 ubiquitin protein ligase 1a)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	peli1a (pellino E3 ubiquitin protein ligase 1a)	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	peli-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Pli	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	peli1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	peli1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Related Pseudogenes:

Peli1-ps1

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	99,455,970 - 99,510,474 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	14	99,455,811 - 99,510,466 (+)	Ensembl				GRCr8
mRatBN7.2	14	95,254,274 - 95,309,168 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	74,299,142 - 74,300,543 (-)	Ensembl				mRatBN7.2
mRatBN7.2 Ensembl	14	95,254,589 - 95,308,285 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	14	99,600,859 - 99,654,628 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	100,841,202 - 100,894,967 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	97,314,719 - 97,368,484 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	106,008,086 - 106,062,566 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	106,008,086 - 106,061,641 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	14	106,075,061 - 106,128,271 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	14	101,870,272 - 101,924,228 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	14	94,267,696 - 94,321,536 (+)	NCBI		Celera
RGSC_v3.1	14	101,920,929 - 101,943,454 (+)	NCBI
Cytogenetic Map	14	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Arsenic Poisoning (ISO)

colorectal cancer (ISO)

skin disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-butoxyethanol (ISO)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-sulfonyldiphenol (EXP)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

all-trans-retinoic acid (ISO)

amitrole (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

benzene (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

butanal (ISO)

Butylbenzyl phthalate (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

calciol (ISO)

CGP 52608 (ISO)

choline (ISO)

cisplatin (ISO)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (ISO)

cyclophosphamide (ISO)

cyclosporin A (ISO)

cytarabine (ISO)

DDE (ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

dichloromethane (ISO)

diuron (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

epoxiconazole (ISO)

ethanol (ISO)

ethylbenzene (ISO)

flutamide (EXP)

folic acid (ISO)

gamma-hexachlorocyclohexane (ISO)

genistein (EXP)

gentamycin (EXP)

GSK-J4 (ISO)

L-methionine (ISO)

leflunomide (ISO)

lipopolysaccharide (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methamphetamine (ISO)

methapyrilene (ISO)

methylisothiazolinone (ISO)

methylmercury chloride (ISO)

monosodium L-glutamate (ISO)

nickel atom (ISO)

nickel sulfate (ISO)

o-xylene (ISO)

okadaic acid (ISO)

paracetamol (EXP,ISO)

phenobarbital (ISO)

phenol (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

poly(I:C) (ISO)

potassium chromate (ISO)

propiconazole (ISO)

pyrogallol (ISO)

rotenone (EXP,ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

Soman (EXP)

sulfadimethoxine (EXP)

sulforaphane (ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

toluene (ISO)

trichloroethene (EXP,ISO)

trichostatin A (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

urethane (ISO)

valproic acid (ISO)

vincristine (ISO)

vitamin E (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

negative regulation of necroptotic process (IEA,ISO)

negative regulation of T cell activation (ISO)

negative regulation of T cell proliferation (ISO)

negative regulation of TORC1 signaling (IEA,ISO)

obsolete negative regulation of NF-kappaB transcription factor activity (ISO)

positive regulation of B cell activation (ISO)

positive regulation of B cell proliferation (ISO)

positive regulation of canonical NF-kappaB signal transduction (ISO)

positive regulation of cytokine production (ISO)

positive regulation of double-strand break repair via homologous recombination (IEA,ISO)

positive regulation of protein ubiquitination (ISO)

positive regulation of toll-like receptor 3 signaling pathway (ISO)

positive regulation of toll-like receptor 4 signaling pathway (ISO)

proteasome-mediated ubiquitin-dependent protein catabolic process (IEA,ISO)

protein K48-linked ubiquitination (IEA,ISO)

protein K63-linked ubiquitination (IEA,ISO)

protein polyubiquitination (IEA,ISO)

protein ubiquitination (IEA)

regulation of Toll signaling pathway (IEA)

response to dsRNA (ISO)

response to lipopolysaccharide (IEA,ISO)

Cellular Component

nucleolus (IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IEA,ISO)

site of double-strand break (IEA,ISO)

Molecular Function

protein binding (ISO)

transferase activity (IEA)

ubiquitin protein ligase activity (IEA,ISO)

ubiquitin-protein transferase activity (IEA,ISO)

ubiquitin-ubiquitin ligase activity (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

interleukin-1 signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
3.	Comprehensive gene review and curation	RGD comprehensive gene curation
4.	Interleukin-1 (IL-1) pathway.	Weber A, etal., Sci Signal. 2010 Jan 19;3(105):cm1. doi: 10.1126/scisignal.3105cm1.
5.	Immune-related genes STIM1, ITPKC and PELI1 polymorphisms are associated with risk of colorectal cancer.	Zhu L, etal., Eur J Cancer Prev. 2021 Sep 1;30(5):357-363. doi: 10.1097/CEJ.0000000000000641.

Additional References at PubMed

PMID:12477932	PMID:19193853	PMID:19734906	PMID:21874024	PMID:25446187	PMID:28410192	PMID:29883609	PMID:33885999	PMID:35901910

Genomics

Comparative Map Data

Peli1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	99,455,970 - 99,510,474 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	14	99,455,811 - 99,510,466 (+)	Ensembl				GRCr8
mRatBN7.2	14	95,254,274 - 95,309,168 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	74,299,142 - 74,300,543 (-)	Ensembl				mRatBN7.2
mRatBN7.2 Ensembl	14	95,254,589 - 95,308,285 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	14	99,600,859 - 99,654,628 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	100,841,202 - 100,894,967 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	97,314,719 - 97,368,484 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	106,008,086 - 106,062,566 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	106,008,086 - 106,061,641 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	14	106,075,061 - 106,128,271 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	14	101,870,272 - 101,924,228 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	14	94,267,696 - 94,321,536 (+)	NCBI		Celera
RGSC_v3.1	14	101,920,929 - 101,943,454 (+)	NCBI
Cytogenetic Map	14	q22	NCBI

PELI1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	64,092,652 - 64,144,420 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	64,092,652 - 64,144,420 (-)	Ensembl			hg38	GRCh38
GRCh37	2	64,319,786 - 64,371,554 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	64,173,499 - 64,192,987 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	2	64,231,645 - 64,251,134	NCBI
Celera	2	64,165,044 - 64,216,871 (-)	NCBI		Celera
Cytogenetic Map	2	p14	NCBI
HuRef	2	64,059,563 - 64,111,396 (-)	NCBI		HuRef
CHM1_1	2	64,250,026 - 64,301,844 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	64,100,282 - 64,152,062 (-)	NCBI		T2T-CHM13v2.0

Peli1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	21,041,283 - 21,100,327 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	21,041,291 - 21,100,323 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	11	21,091,283 - 21,150,327 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	21,091,291 - 21,150,323 (+)	Ensembl			mm10	GRCm38
MGSCv37	11	20,991,327 - 21,050,330 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	11	21,035,472 - 21,050,326 (+)	NCBI		MGSCv36	mm8
Celera	11	23,239,549 - 23,298,574 (+)	NCBI		Celera
Cytogenetic Map	11	A3.1	NCBI
cM Map	11	13.81	NCBI

Peli1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955424	20,211,600 - 20,263,761 (+)	Ensembl
ChiLan1.0	NW_004955424	20,212,077 - 20,263,761 (+)	NCBI	ChiLan1.0	ChiLan1.0

PELI1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	12	62,250,630 - 62,306,758 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2A	62,257,658 - 62,310,709 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2A	64,160,362 - 64,213,200 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2A	65,284,472 - 65,336,335 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2A	65,284,480 - 65,336,339 (-)	Ensembl			panPan2	panpan1.1

PELI1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	63,727,905 - 63,863,599 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	63,729,604 - 63,743,303 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	63,616,694 - 63,752,371 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	64,736,541 - 64,872,342 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	10	64,736,553 - 64,795,619 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	10	64,418,361 - 64,554,038 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	64,727,691 - 64,863,369 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	65,019,832 - 65,155,570 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Peli1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024406292	19,530,464 - 19,586,021 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936491	8,985,074 - 9,041,244 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936491	8,985,074 - 9,040,863 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PELI1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	77,713,489 - 77,796,914 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	3	77,740,460 - 77,796,911 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

PELI1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	42,864,857 - 42,930,315 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	14	42,864,897 - 42,930,394 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666045	68,937,787 - 69,003,497 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Peli1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624762	9,328,109 - 9,386,067 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624762	9,328,275 - 9,382,996 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Peli1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	11	89,305,604 - 89,360,825 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Peli1
294 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	712
Count of miRNA genes:	303
Interacting mature miRNAs:	391
Transcripts:	ENSRNOT00000009319
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1582201	Sffal2	Serum free fatty acids level QTL 2	4	0.0002	blood free fatty acid amount (VT:0001553)	serum free fatty acids level (CMO:0000547)	14	96755448	100078267	Rat
631213	Bw60	Body weight QTL60	4.51		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	14	84164970	100078267	Rat
9590294	Uminl4	Urine mineral level QTL 4	5.66	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	14	59848686	104848686	Rat
2300197	Scl59	Serum cholesterol level QTL 59			blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	14	77914838	104348525	Rat
631523	Pia13	Pristane induced arthritis QTL 13	3.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	14	33424686	102238540	Rat
1582259	Gluco23	Glucose level QTL 23	3.1	0.0008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	74255551	109089856	Rat
634328	Hc5	Hypercalciuria QTL 5	2.3		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	14	62398852	107398852	Rat
1582250	Gluco26	Glucose level QTL 26	3.3	0.0009	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	77640071	100078267	Rat
2317879	Alcrsp27	Alcohol response QTL 27	3.3	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	14	60854936	105854936	Rat
1641900	Alcrsp11	Alcohol response QTL 11			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	14	74255551	109089856	Rat
4889951	Bss92	Bone structure and strength QTL 92	3.9		tibia area (VT:1000281)	tibia-fibula cortical bone total cross-sectional area (CMO:0001721)	14	86271332	100078267	Rat
631839	Niddm37	Non-insulin dependent diabetes mellitus QTL 37	3.37		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11334716	100078267	Rat
9589034	Epfw11	Epididymal fat weight QTL 11	6	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	14	59848686	104848686	Rat

Markers in Region

UniSTS:226084

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	74,298,663 - 74,298,801 (+)	MAPPER	mRatBN7.2
mRatBN7.2	14	95,307,732 - 95,307,870 (-)	MAPPER	mRatBN7.2
mRatBN7.2	14	95,307,732 - 95,307,870 (+)	MAPPER	mRatBN7.2
mRatBN7.2	1	74,298,663 - 74,298,801 (-)	MAPPER	mRatBN7.2
Rnor_6.0	1	75,643,964 - 75,644,101	NCBI	Rnor6.0
Rnor_6.0	14	106,061,135 - 106,061,272	NCBI	Rnor6.0
Rnor_5.0	1	76,947,978 - 76,948,115	UniSTS	Rnor5.0
Rnor_5.0	14	106,127,765 - 106,127,902	UniSTS	Rnor5.0
RGSC_v3.4	1	73,925,391 - 73,925,528	UniSTS	RGSC3.4
RGSC_v3.4	14	101,923,722 - 101,923,859	UniSTS	RGSC3.4
Celera	14	94,321,030 - 94,321,167	UniSTS
Celera	1	69,728,745 - 69,728,882	UniSTS
Cytogenetic Map	1	q21	UniSTS
Cytogenetic Map	14	q22	UniSTS

D11Ertd676e

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	74,298,359 - 74,298,557 (-)	MAPPER	mRatBN7.2
mRatBN7.2	14	95,307,976 - 95,308,174 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	106,061,379 - 106,061,576	NCBI	Rnor6.0
Rnor_5.0	14	106,128,009 - 106,128,206	UniSTS	Rnor5.0
RGSC_v3.4	14	101,923,966 - 101,924,163	UniSTS	RGSC3.4
Celera	14	94,321,274 - 94,321,471	UniSTS
Cytogenetic Map	14	q22	UniSTS

RH141447

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	95,308,909 - 95,309,097 (+)	MAPPER	mRatBN7.2
mRatBN7.2	1	74,297,493 - 74,297,682 (-)	MAPPER	mRatBN7.2
mRatBN7.2	1	74,297,493 - 74,297,682 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	75,642,794 - 75,642,982	NCBI	Rnor6.0
Rnor_6.0	14	106,062,310 - 106,062,497	NCBI	Rnor6.0
Rnor_5.0	14	106,128,940 - 106,129,127	UniSTS	Rnor5.0
Rnor_5.0	1	76,946,808 - 76,946,996	UniSTS	Rnor5.0
RGSC_v3.4	1	73,924,221 - 73,924,409	UniSTS	RGSC3.4
RGSC_v3.4	14	101,924,898 - 101,925,085	UniSTS	RGSC3.4
Celera	14	94,322,206 - 94,322,393	UniSTS
Celera	1	69,727,575 - 69,727,763	UniSTS
RH 3.4 Map	14	779.79	UniSTS
Cytogenetic Map	1	q21	UniSTS
Cytogenetic Map	14	q22	UniSTS

BQ194767

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	95,299,514 - 95,299,676 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	106,052,917 - 106,053,078	NCBI	Rnor6.0
Rnor_5.0	14	106,119,547 - 106,119,708	UniSTS	Rnor5.0
RGSC_v3.4	14	101,915,504 - 101,915,665	UniSTS	RGSC3.4
Celera	14	94,312,812 - 94,312,973	UniSTS
RH 3.4 Map	14	749.8	UniSTS
Cytogenetic Map	14	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001100565	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063273239	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC092604	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC166745	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB770819	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473996	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214971	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000014	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000009319 ⟹ ENSRNOP00000009319

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	14	99,455,811 - 99,510,466 (+)	Ensembl
mRatBN7.2 Ensembl	14	95,254,589 - 95,308,285 (+)	Ensembl
Rnor_6.0 Ensembl	14	106,008,086 - 106,061,641 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000149128 ⟹ ENSRNOP00000112206

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	14	99,455,811 - 99,510,466 (+)	Ensembl

RefSeq Acc Id:

NM_001100565 ⟹ NP_001094035

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	99,455,970 - 99,509,548 (+)	NCBI
mRatBN7.2	14	95,254,660 - 95,308,239 (+)	NCBI
Rnor_6.0	14	106,008,086 - 106,061,641 (+)	NCBI
Rnor_5.0	14	106,075,061 - 106,128,271 (+)	NCBI
RGSC_v3.4	14	101,870,272 - 101,924,228 (+)	RGD
Celera	14	94,267,696 - 94,321,536 (+)	RGD

Sequence:

show sequence

GCTCACTACAAAGCGGGCCCGAGCCTCTCTCTCGTCCGCGCTCATCCGCGCTCGGCTCCGCGTT
CCACTCGGCCTCGCGGGGCTCGGCAGCTGGCGGGAAGGCTGCAGGCTCCGCCGGTACCTACGTT
CAACCGGTGCTTGCGCCGCCCCCGCGTCCCGGGTGTCCGCGCGGCGGGCCGAGCTGGCGTTCCG
GCCCCCAGCAGTCGTCCGGAAATAATGCAAAAGGTGTCTCAAGGCTCCTGACCAGTGAACAGAG
ATTTGAGAAAGACAGCCAAGCTCATGTTTTCTCCTGATCAAGAAAATCATCCTTCCAAAGCCCC
AGTAAAATATGGCGAACTCATTGTCTTAGGGTATAATGGGTCTCTCCCAAACGGCGACAGAGGA
AGGAGGAAAAGTAGGTTTGCTTTGTTTAAAAGACCTAAGGCAAATGGGGTGAAGCCTAGCACCG
TGCACATTGCATGCACTCCTCAGGCCGCCAAGGCAATAAGCAACAAGGACCAGCATAGCATATC
GTATACTTTATCTCGAGCCCAGACAGTGGTGGTTGAATATACTCACGACAGCAACACTGATATG
TTTCAGATTGGCCGGTCAACTGAAAGTCCTATTGATTTTGTGGTAACTGACACAGTTCCTGGAA
GTCAGAGTAATTCCGACACGCAGTCCGTACAAAGCACTATATCGAGGTTTGCCTGTAGGATCAT
TTGTGAACGCAATCCTCCCTTTACAGCTCGGATTTATGCTGCAGGATTTGATTCATCAAAAAAC
ATCTTTCTTGGGGAGAAGGCTGCCAAATGGAAGACGTCCGACGGGCAGATGGACGGCCTGACCA
CCAATGGAGTTCTTGTGATGCATCCACGCGATGGGTTCACAGAAGACTCCAAGCCTGGAATATG
GAGAGAGATATCCGTATGTGGGAACGTCTTCAGTCTGCGTGAAACCAGATCAGCGCAACAGAGA
GGAAAGATGGTGGAAATCGAAACCAATCAGCTGCAAGATGGCTCCTTAATCGACCTCTGTGGTG
CAACCCTGCTGTGGCGCACAGCAGAAGGCCTTTCCCACACCCCTACTGTGAAACACTTAGAAGC
TCTGAGACAGGAGATCAATGCAGCTCGGCCTCAGTGCCCTGTAGGCTTCAACACACTAGCCTTC
CCCAGCATGAAGAGGAAAGATGTTGTAGATGAGAAGCAACCATGGGTATATCTGAACTGCGGCC
ATGTTCATGGTTACCATAACTGGGGAAACAAGGAAGAACGTGACGGCAAAGATCGTGAATGTCC
TATGTGTAGGTCTGTTGGTCCCTATGTCCCTCTGTGGCTTGGATGTGAAGCTGGATTTTATGTG
GACGCCGGCCCTCCCACCCATGCCTTTAGCCCCTGTGGGCATGTGTGTTCAGAAAAGACAACGG
CTTACTGGTCCCAGATCCCGCTTCCTCATGGTACGCACACTTTTCACGCAGCCTGTCCCTTCTG
TGCACATCAGTTGGCTGGTGAACAAGGCTATATCAGACTTATTTTCCAAGGACCTCTAGACTAG
CAGCTGTCCTCCAGGACTGCATTACAAGTTCATAAGCTAAGTGATTGGGTTTGCCGACCCCTTG
TCCGTGTAAGTTTCTCTGCTCTGGTCATTTGCATTAAGATGAAGAATTTTTTTAAATATTTATA
ATAGCAATTTCTGAGAAAAATTTGGGAAACTCGAGCAAAGGAATATTTGAAAGTTCCAGACTTC
TGAATTCTGAGTTTTGAAAATCTATTTTGAGGAGAAAAAGACATAGTCTAATTTGATGCCTTCG
TTTAGTGTTCTTGAATCCCTGCTCACCCTCAGTGTTGAGAGGTTGTTCTGTAGAACTGAGGGTC
TGTTGGTTCAAACTATGTTAGTTTACAATTTGTTGCAAACATTGTAAAATACAGCAACATGTAT
ATTAATTTTCTATTTATCTTTATCATAGAAAATACCTTAGAATGTTGTGATAGGTAGCATGGTA
ATGATGGTGTCACACACTTGGTGTGAGTGGTAGGTTAGTGGGCACGCAGCTCAAGGATTTGCAA
AGTTAAGGAGAAAGGTAGGAGAGCTCCCCCAGCCCCATACAAGTAGGGGATTTGATGAACTAGA
ATATTTCATAAAACCAGATTCACATTAATTACCATTGTCTAAAAGGTGTTTGTTTTTAACCACA
TTGAATTTAACCAGAAAATGGTTTTTTCCTTCATGTTTCTCTCAAGTGTAGTACTATAACAAAA
GTTAATGCTAAGAAACGTTTTATATGCTCCTTTGAATATGCAATTAATCTAGATGATCTATTTT
TCTCCCATGATAACTGATCTGTTTTTAGTGCCAGCAACATTTGGCAAGTTTATTTTTTTGGATA
TAAACTGTGGTTCAT

hide sequence

RefSeq Acc Id:

XM_063273239 ⟹ XP_063129309

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	99,456,045 - 99,510,474 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001094035	(Get FASTA)	NCBI Sequence Viewer
	XP_063129309	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH92604	(Get FASTA)	NCBI Sequence Viewer
	AAI66745	(Get FASTA)	NCBI Sequence Viewer
	EDL97953	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000009319
	ENSRNOP00000009319.4
	ENSRNOP00000112206.1

RefSeq Acc Id:

NP_001094035 ⟸ NM_001100565

- UniProtKB:

B2RYE1 (UniProtKB/TrEMBL), A6JQ36 (UniProtKB/TrEMBL), A0A8I6AJP0 (UniProtKB/TrEMBL), F7FFX2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MFSPDQENHPSKAPVKYGELIVLGYNGSLPNGDRGRRKSRFALFKRPKANGVKPSTVHIACTPQ
AAKAISNKDQHSISYTLSRAQTVVVEYTHDSNTDMFQIGRSTESPIDFVVTDTVPGSQSNSDTQ
SVQSTISRFACRIICERNPPFTARIYAAGFDSSKNIFLGEKAAKWKTSDGQMDGLTTNGVLVMH
PRDGFTEDSKPGIWREISVCGNVFSLRETRSAQQRGKMVEIETNQLQDGSLIDLCGATLLWRTA
EGLSHTPTVKHLEALRQEINAARPQCPVGFNTLAFPSMKRKDVVDEKQPWVYLNCGHVHGYHNW
GNKEERDGKDRECPMCRSVGPYVPLWLGCEAGFYVDAGPPTHAFSPCGHVCSEKTTAYWSQIPL
PHGTHTFHAACPFCAHQLAGEQGYIRLIFQGPLD

hide sequence

Ensembl Acc Id:

ENSRNOP00000009319 ⟸ ENSRNOT00000009319

RefSeq Acc Id:	XP_063129309 ⟸ XM_063273239
- Peptide Label:	isoform X1
- UniProtKB:	A6JQ36 (UniProtKB/TrEMBL), B2RYE1 (UniProtKB/TrEMBL), F7FFX2 (UniProtKB/TrEMBL), A0A8I6AJP0 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000112206 ⟸ ENSRNOT00000149128

Protein Domains

Pellino FHA Pellino RING

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B2RYE1-F1-model_v2	AlphaFold	B2RYE1	1-418	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311199	AgrOrtholog
BioCyc Gene	G2FUF-14835	BioCyc
Ensembl Genes	ENSRNOG00000006329	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
	ENSRNOG00000065015	Ensembl
Ensembl Transcript	ENSRNOT00000009319	ENTREZGENE
	ENSRNOT00000009319.7	UniProtKB/TrEMBL
	ENSRNOT00000149128.1	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7306737	IMAGE-MGC_LOAD
	IMAGE:7939059	IMAGE-MGC_LOAD
InterPro	Pellino	UniProtKB/TrEMBL
	Pellino_FHA	UniProtKB/TrEMBL
	Pellino_RING	UniProtKB/TrEMBL
KEGG Report	rno:305549	UniProtKB/TrEMBL
MGC_CLONE	MGC:109200	IMAGE-MGC_LOAD
	MGC:188476	IMAGE-MGC_LOAD
NCBI Gene	305549	ENTREZGENE
PANTHER	E3 UBIQUITIN-PROTEIN LIGASE PELLINO HOMOLOG 1	UniProtKB/TrEMBL
	PTHR12098	UniProtKB/TrEMBL
Pfam	Pellino	UniProtKB/TrEMBL
	Pellino_RING	UniProtKB/TrEMBL
PhenoGen	Peli1	PhenoGen
PIRSF	Pellino	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000006329	RatGTEx
	ENSRNOG00000065015	RatGTEx
UniProt	A0A8I6AJP0	ENTREZGENE
	A0ABK0M072_RAT	UniProtKB/TrEMBL
	A6JQ36	ENTREZGENE, UniProtKB/TrEMBL
	B2RYE1	ENTREZGENE
	F7FFX2	ENTREZGENE, UniProtKB/TrEMBL
	Q562B8_RAT	UniProtKB/TrEMBL
UniProt Secondary	B2RYE1	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-10-05	Peli1	pellino E3 ubiquitin protein ligase 1	Peli1	pellino homolog 1 (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-01-20	Peli1	pellino homolog 1 (Drosophila)	Peli1	pellino 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-06	Peli1	pellino 1	Peli1	pellino homolog 1 (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Peli1	pellino homolog 1 (Drosophila)	Peli1_predicted	pellino homolog 1 (Drosophila) (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Peli1_predicted	pellino homolog 1 (Drosophila) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - CTD

RGD Manual Annotations