Advanced Search (OLGA)

Gene: Mkrn2 (makorin, ring finger protein, 2) Rattus norvegicus

Analyze

Symbol:

Mkrn2

Name:

makorin, ring finger protein, 2

RGD ID:

1310618

Description:

Predicted to enable ubiquitin protein ligase activity. Predicted to be involved in several processes, including negative regulation of inflammatory response to antigenic stimulus; negative regulation of non-canonical NF-kappaB signal transduction; and ubiquitin-dependent protein catabolic process. Predicted to be located in cytoplasm and nucleus. Orthologous to human MKRN2 (makorin ring finger protein 2); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

E3 ubiquitin-protein ligase makorin-2; LOC297525; MGC95133; probable E3 ubiquitin-protein ligase makorin-2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MKRN2 (makorin ring finger protein 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Mkrn2 (makorin, ring finger protein, 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Mkrn2 (makorin ring finger protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MKRN2 (makorin ring finger protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MKRN2 (makorin ring finger protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mkrn2 (makorin ring finger protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MKRN2 (makorin ring finger protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MKRN2 (makorin ring finger protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Mkrn2 (makorin ring finger protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Mkrn2 (makorin ring finger protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	TERF2 (telomeric repeat binding factor 2)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	MKRN2 (makorin ring finger protein 2)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Mkrn2 (makorin, ring finger protein, 2)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	mkrn2 (makorin, ring finger protein, 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	mkrn2 (makorin, ring finger protein, 2)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG12477	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	lep-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	lep-2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG5347	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG5347	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Mkrn1	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Mkrn1	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	mkrn2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	mkrn2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	150,334,164 - 150,352,271 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	150,334,142 - 150,352,263 (+)	Ensembl				GRCr8
mRatBN7.2	4	148,661,529 - 148,679,580 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	148,661,553 - 148,679,642 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	154,885,604 - 154,904,019 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	150,668,687 - 150,687,102 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	149,292,510 - 149,310,925 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	147,514,041 - 147,532,086 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	147,514,120 - 147,532,084 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	210,801,433 - 210,819,194 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	151,734,327 - 151,752,629 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	137,552,122 - 137,570,545 (+)	NCBI		Celera
RGSC_v3.1	4	151,979,167 - 151,997,468 (+)	NCBI
Cytogenetic Map	4	q42	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

4,4'-sulfonyldiphenol (EXP)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

antirheumatic drug (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP)

bisphenol F (EXP)

cadmium dichloride (ISO)

chlorpyrifos (ISO)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (ISO)

diclofenac (ISO)

flutamide (EXP)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methapyrilene (ISO)

methidathion (ISO)

methotrexate (ISO)

paracetamol (ISO)

phenobarbital (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

tamoxifen (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trovafloxacin (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell differentiation (IEA)

negative regulation of inflammatory response to antigenic stimulus (IEA,ISO)

negative regulation of non-canonical NF-kappaB signal transduction (IEA,ISO)

protein polyubiquitination (IEA)

protein ubiquitination (IBA)

ubiquitin-dependent protein catabolic process (IEA,ISO)

Cellular Component

cytoplasm (IEA,ISO)

nucleus (IEA,ISO)

Molecular Function

metal ion binding (IEA)

protein binding (ISO)

transferase activity (IEA)

ubiquitin protein ligase activity (IBA,IEA,ISO)

zinc ion binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:11597136	PMID:12477932	PMID:22681889

Genomics

Comparative Map Data

Mkrn2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	150,334,164 - 150,352,271 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	150,334,142 - 150,352,263 (+)	Ensembl				GRCr8
mRatBN7.2	4	148,661,529 - 148,679,580 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	148,661,553 - 148,679,642 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	154,885,604 - 154,904,019 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	150,668,687 - 150,687,102 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	149,292,510 - 149,310,925 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	147,514,041 - 147,532,086 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	147,514,120 - 147,532,084 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	210,801,433 - 210,819,194 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	151,734,327 - 151,752,629 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	137,552,122 - 137,570,545 (+)	NCBI		Celera
RGSC_v3.1	4	151,979,167 - 151,997,468 (+)	NCBI
Cytogenetic Map	4	q42	NCBI

MKRN2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	12,557,087 - 12,583,713 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	12,557,020 - 12,586,208 (+)	Ensembl			hg38	GRCh38
GRCh37	3	12,598,586 - 12,625,212 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	12,573,594 - 12,600,212 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	3	12,573,593 - 12,600,208	NCBI
Celera	3	12,535,907 - 12,563,538 (+)	NCBI		Celera
Cytogenetic Map	3	p25.2	NCBI
HuRef	3	12,531,728 - 12,559,429 (+)	NCBI		HuRef
CHM1_1	3	12,548,570 - 12,575,291 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	12,554,891 - 12,582,517 (+)	NCBI		T2T-CHM13v2.0

Mkrn2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	115,578,844 - 115,598,647 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	115,578,863 - 115,599,585 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	6	115,601,883 - 115,621,683 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	115,601,902 - 115,622,624 (+)	Ensembl			mm10	GRCm38
MGSCv37	6	115,551,956 - 115,568,688 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	6	115,567,557 - 115,584,289 (+)	NCBI		MGSCv36	mm8
Celera	6	117,442,079 - 117,458,793 (+)	NCBI		Celera
Cytogenetic Map	6	E3	NCBI
cM Map	6	53.61	NCBI

Mkrn2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955429	18,049,624 - 18,071,185 (-)	Ensembl
ChiLan1.0	NW_004955429	18,049,617 - 18,070,526 (-)	NCBI	ChiLan1.0	ChiLan1.0

MKRN2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	12,541,577 - 12,570,539 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	12,546,338 - 12,574,276 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	12,481,268 - 12,510,196 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	12,824,341 - 12,853,527 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	12,824,341 - 12,853,520 (+)	Ensembl			panPan2	panpan1.1

MKRN2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	5,972,567 - 6,002,424 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	5,973,866 - 6,002,353 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	6,009,205 - 6,039,062 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	6,000,763 - 6,030,623 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	6,000,775 - 6,030,626 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	5,716,930 - 5,746,803 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	6,070,843 - 6,100,697 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	6,045,895 - 6,075,772 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Mkrn2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404942	17,765,643 - 17,795,434 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936602	1,114,832 - 1,144,251 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936602	1,114,271 - 1,144,045 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MKRN2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	68,546,464 - 68,581,232 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	13	68,546,482 - 68,584,341 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	75,816,743 - 75,847,270 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MKRN2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	48,532,155 - 48,559,373 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	22	48,532,205 - 48,558,949 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666041	117,940,139 - 117,969,026 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mkrn2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624872	183,446 - 204,956 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624872	183,421 - 204,463 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Mkrn2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	6	31,093,708 - 31,111,500 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Mkrn2
141 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	125
Count of miRNA genes:	98
Interacting mature miRNAs:	115
Transcripts:	ENSRNOT00000013146
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
6478754	Anxrr43	Anxiety related response QTL 43		0.14035	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	146370897	184426481	Rat
2302049	Pia32	Pristane induced arthritis QTL 32	5.1	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112)	4	107346299	152346299	Rat
724558	Plsm2	Polydactyly-luxate syndrome (PLS) morphotypes QTL 2		0.0003	hindlimb integrity trait (VT:0010563)	hind foot phalanges count (CMO:0001949)	4	134095016	179095016	Rat
1582237	Kidm34	Kidney mass QTL 34	4	0.0001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	4	149763204	169799698	Rat
61446	Coreg2	Compensatory renal growth QTL 2	3.5		kidney mass (VT:0002707)	compensatory renal growth score (CMO:0001894)	4	150095743	159267220	Rat
1300116	Hrtrt5	Heart rate QTL 5	3.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	117737142	152833657	Rat
6478693	Anxrr32	Anxiety related response QTL 32		0.00092	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	146370897	184426481	Rat
1358364	Sradr4	Stress Responsive Adrenal Weight QTL 4	4.92		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	4	131384565	176384565	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	27730518	170099664	Rat
6478763	Anxrr46	Anxiety related response QTL 46		0.07428	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	112427331	157427331	Rat
6478760	Anxrr45	Anxiety related response QTL 45		0.06717	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	112427331	157427331	Rat
61451	Ciaa4	CIA Autoantibody QTL 4	3.1		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	4	123870974	168870974	Rat
1331802	Srn5	Serum renin concentration QTL 5	3.045		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	4	117559384	162559384	Rat
1331738	Bp209	Blood pressure QTL 209	2.979		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	140059299	181024663	Rat
6478700	Anxrr33	Anxiety related response QTL 33		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	146370897	184426481	Rat
1298524	Oia8	Oil induced arthritis QTL 8			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	140059299	184426481	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	60916264	184426481	Rat
7207480	Bss105	Bone structure and strength QTL 105	8.1		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	4	111383604	156383604	Rat
634335	Anxrr16	Anxiety related response QTL 16	7.22		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	94638356	168870820	Rat
737821	Hcar9	Hepatocarcinoma resistance QTL 9	3.7		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	106848959	168870974	Rat
731165	Uae21	Urinary albumin excretion QTL 21	2.4	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	4	108206096	153206096	Rat
7411558	Bw133	Body weight QTL 133	13.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	127263297	172263297	Rat
6478778	Anxrr51	Anxiety related response QTL 51		0.25384	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	126334185	171334185	Rat
10401796	Kidm48	Kidney mass QTL 48			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	147299608	184426481	Rat
6478718	Anxrr34	Anxiety related response QTL 34		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	146370897	184426481	Rat
631511	Pia7	Pristane induced arthritis QTL 7	4.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	123870974	168870974	Rat
1549832	Bss3	Bone structure and strength QTL 3	11		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	4	111383604	156383604	Rat
70177	Xhs1	X-ray hypersensitivity QTL 1	25.1		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	82944895	154403548	Rat
634347	Hcar8	Hepatocarcinoma resistance QTL 8	5.8		liver integrity trait (VT:0010547)	liver tumorous lesion area to total liver area ratio (CMO:0001075)	4	124700988	169700988	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	174095838	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	100752691	179366077	Rat
1581566	Eae21	Experimental allergic encephalomyelitis QTL 21	6.2		body mass (VT:0001259)	maximum body weight loss to initial body weight ratio (CMO:0001400)	4	137447185	182447185	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	45429709	157555683	Rat
1578674	Bmd12	Bone mineral density QTL 12	3.8		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	4	137430611	182430611	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	184426481	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	86709649	168870974	Rat
61422	Cia13	Collagen induced arthritis QTL 13	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	134199006	168870974	Rat
634342	Cia24	Collagen induced arthritis QTL 24	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	148121375	176967367	Rat
737978	Pia23	Pristane induced arthritis QTL 23	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	123870974	168870974	Rat
61362	Oia2	Oil induced arthritis QTL 2		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	140059299	184426481	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	65495851	159259805	Rat
12798519	Anxrr54	Anxiety related response QTL 54	2.54	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	116184844	161184844	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	57613339	151163960	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	12212457	182430611	Rat
6478748	Anxrr42	Anxiety related response QTL 42		0.28008	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	146370897	184426481	Rat
12798525	Anxrr57	Anxiety related response QTL 57	3.21	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	148834094	168870974	Rat

Markers in Region

RH127364

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	148,679,257 - 148,679,472 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	147,531,764 - 147,531,978	NCBI	Rnor6.0
Rnor_5.0	4	210,818,872 - 210,819,086	UniSTS	Rnor5.0
RGSC_v3.4	4	151,752,307 - 151,752,521	UniSTS	RGSC3.4
Celera	4	137,570,223 - 137,570,437	UniSTS
RH 3.4 Map	15	457.3	UniSTS
Cytogenetic Map	4	q42	UniSTS

BI284862

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	148,679,723 - 148,679,931 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	147,532,230 - 147,532,437	NCBI	Rnor6.0
Rnor_5.0	4	210,819,338 - 210,819,545	UniSTS	Rnor5.0
RGSC_v3.4	4	151,752,773 - 151,752,980	UniSTS	RGSC3.4
Celera	4	137,570,689 - 137,570,896	UniSTS
RH 3.4 Map	4	950.71	UniSTS
Cytogenetic Map	4	q42	UniSTS

RH137569

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	148,678,552 - 148,678,802 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	147,531,059 - 147,531,308	NCBI	Rnor6.0
Rnor_5.0	4	210,818,167 - 210,818,416	UniSTS	Rnor5.0
RGSC_v3.4	4	151,751,602 - 151,751,851	UniSTS	RGSC3.4
Celera	4	137,569,518 - 137,569,767	UniSTS
Cytogenetic Map	4	q42	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001008314	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017592582	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107421	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107422	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107423	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107424	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC094445	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC083870	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473964	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000013146 ⟹ ENSRNOP00000013145

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	150,343,046 - 150,352,263 (+)	Ensembl
mRatBN7.2 Ensembl	4	148,670,498 - 148,679,642 (+)	Ensembl
Rnor_6.0 Ensembl	4	147,514,120 - 147,532,084 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000105331 ⟹ ENSRNOP00000090666

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	148,671,008 - 148,679,642 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114812 ⟹ ENSRNOP00000091392

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	150,334,142 - 150,352,263 (+)	Ensembl
mRatBN7.2 Ensembl	4	148,661,553 - 148,679,642 (+)	Ensembl

RefSeq Acc Id:

NM_001008314 ⟹ NP_001008315

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	150,334,238 - 150,352,204 (+)	NCBI
mRatBN7.2	4	148,661,613 - 148,679,580 (+)	NCBI
Rnor_6.0	4	147,514,120 - 147,532,086 (+)	NCBI
Rnor_5.0	4	210,801,433 - 210,819,194 (+)	NCBI
RGSC_v3.4	4	151,734,327 - 151,752,629 (+)	RGD
Celera	4	137,552,122 - 137,570,545 (+)	RGD

Sequence:

show sequence

CCGCCATGAGCACCAAGCAGGTCACCTGCAGGTATTTTATGCATGGTGTATGTCGAGAAGGCAG
CCAGTGCCTGTTTTCACATGACTTGGCAAACAGCAAGCCGTCCACCATCTGCAAATACTACCAG
AAGGGCTACTGTGCCTACGGTGCACGCTGCAGATATGATCATACAAAGCCCCCAGCTGCAGCAG
GTGGAGCTGTGGGTCCTGCACCCCACCCTTCGCCCTCCTCAGGCCTGCATAGTCCTCACCCTTC
TTCCGACATTGCCACGTCTGTTATGAGGACACATTCAAATGAACCTAGAAAGCGGGAGAAGAAG
ACGCTGGTGCTCAGAGACCGCAATCTCACTGGTCTGGCTGAAGACAAGACTCCTCCTCCAAGCA
CAGTGAATAATCCAGGTGGCTGCAATGACCCTCAGACCAGCCCAGAGATGAAGCCCCATTCCTA
CCTAGATGCCATCAGGACTGGCCTGGATGACTTGGAGGCCAGCAGCTCCTACAGCAACGAGCAG
CAGTTGTGCCCCTATGCTGCTGCTGGGGAATGCCGGTTTGGAGATGCCTGTGTCTATCTGCATG
GGGACATGTGTGAAATCTGCAGGCTTCAAGTCCTCCACCCCTTTGACCCAGAACAGAGGAAAGC
TCACGAGAAGATGTGTATGTCGACATTTGAACATGAGATGGAAAAGGCTTTTGCCTTCCAGGCG
AGCCAGGACAAAGTGTGCAGTATCTGTATGGAGGTGATCCTAGAGAAAGCCTCTGCTTCTGAGA
GGAGGTTTGGCATTCTCTCCAACTGCAGCCACACCTACTGCCTGTCCTGCATCCGTCAATGGAG
ATGTGCCAAGCAGTTTGAAAACCCCATCATCAAGTCTTGTCCAGAGTGCCGTGTGATATCAGAG
TTTGTAATTCCAAGTGTGTATTGGGTAGAAGATCAGAATAAAAAGAATGAATTAATTGAAGCTT
TTAAACAGGGAATGGGGAAAAAGGCATGTAAATACTTTGAACAAGGCAAGGGGACCTGTCCCTT
TGGAAGCAAGTGCCTTTACCGCCATGCTTACCCTGATGGGCGGCTGGCAGAGCCAGAGAAACCT
CGGAAGCAGCTAAGTTCTGAAGGCACTGTGAGGTTCTTTAACTCAGTGCGGCTTTGGGATTTTA
TCGAGAACCGAGAAACCCGGCAAGTCCCCAGCACTGATGATGTGGATGTGACGGAGCTAGGAGA
CCTCTTCATGCACCTTTCTGGAGTAGAGTCATCAGAACCCTAGTCAGTGCCTTCATTTGGGCTC
TGCAGTCAACTTTCCAAGGCGTGGTGTGGACGCATCTGTCACTGACCCGAGGTGATGTGGTACC
GGGGTGTGAGTGCAGTAGTGAGTCCCCTTGGTCTCTTCATGATGAAATTTCCCTGCCCTGGTGA
AGGGAAGGGAGATCACCAAGTCCATGGAATCACTACATTTAGATTTGAGAGCTCTGAGTTGTAC
CTCCAGCCCCTTTATCAGGGACCAGCTATGTGGTCCAGCTGTTTTAATTGATTGCTTCTAAATG
AAACCCGACTACCATCTTTCTTTTGTGACTTTCTTCTTTAAGCAACAGTAAACTTAACAGCTGC
TCCTAAAGCAGCAAATCTTTCTTGCCAAGACATCGCCAACCCTATAGAGGACTCCCGTGCAGTG
ACCATCTCTAATATAGTTGTTGATCCTTGAATTTATGCAGCTGTATAGTGAGAACACATTTGGT
CATATTGGTGCTGTACCATAGAGTACTTTTAAGGCTGTGAGGATGGCTATTGCATTCCGTCCAG
TGTCTCAAGTCAACAGGCGTGTGCAGTTGTAAAGATCTCCAGGGAGATTCCACCTTCCCTTCCC
CCTAGTAGTTAGAGCACAAGACACAGGACTCACACTCACATTGCTTGTTCTCACCTAAAAGCAG
GCTATACTCTACACTGGTAGACAGGAGCAGTGACTCCTCTCTGTCTAAGGAGAACTGGGGCCAA
GGCAGAGCAAGTTTGTTTTAAACCTGATTTTATTTTTGTAAAAAGCTGTTATTACCTGTGTGCT
TTTTGCTTGGTTGTTCATGTAACTGCAGAGGAAGATCCTTGAGTTCTGCACAAGAAACTGAACA
AGTAGGGCCCACACTGCAAATTTCATATTACTTTTGAAGGAGTCAGTAGCCATTAAACCTAAAT
TTAATTTATTTTATTAAAATAACATAATTGAGGAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039107421 ⟹ XP_038963349

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	150,334,172 - 150,352,271 (+)	NCBI
mRatBN7.2	4	148,661,551 - 148,678,921 (+)	NCBI

RefSeq Acc Id:

XM_039107422 ⟹ XP_038963350

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	150,343,389 - 150,352,271 (+)	NCBI
mRatBN7.2	4	148,670,765 - 148,678,921 (+)	NCBI

RefSeq Acc Id:

XM_039107423 ⟹ XP_038963351

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	150,343,256 - 150,352,271 (+)	NCBI
mRatBN7.2	4	148,670,634 - 148,678,921 (+)	NCBI

RefSeq Acc Id:

XM_039107424 ⟹ XP_038963352

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	150,334,164 - 150,352,271 (+)	NCBI
mRatBN7.2	4	148,661,529 - 148,678,921 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001008315	(Get FASTA)	NCBI Sequence Viewer
	XP_038963349	(Get FASTA)	NCBI Sequence Viewer
	XP_038963350	(Get FASTA)	NCBI Sequence Viewer
	XP_038963351	(Get FASTA)	NCBI Sequence Viewer
	XP_038963352	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH83870	(Get FASTA)	NCBI Sequence Viewer
	EDM02150	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000013145.6
	ENSRNOP00000091392
	ENSRNOP00000091392.1

RefSeq Acc Id:

NP_001008315 ⟸ NM_001008314

- UniProtKB:

Q5XI23 (UniProtKB/TrEMBL), F7EMI5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSTKQVTCRYFMHGVCREGSQCLFSHDLANSKPSTICKYYQKGYCAYGARCRYDHTKPPAAAGG
AVGPAPHPSPSSGLHSPHPSSDIATSVMRTHSNEPRKREKKTLVLRDRNLTGLAEDKTPPPSTV
NNPGGCNDPQTSPEMKPHSYLDAIRTGLDDLEASSSYSNEQQLCPYAAAGECRFGDACVYLHGD
MCEICRLQVLHPFDPEQRKAHEKMCMSTFEHEMEKAFAFQASQDKVCSICMEVILEKASASERR
FGILSNCSHTYCLSCIRQWRCAKQFENPIIKSCPECRVISEFVIPSVYWVEDQNKKNELIEAFK
QGMGKKACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPRKQLSSEGTVRFFNSVRLWDFIE
NRETRQVPSTDDVDVTELGDLFMHLSGVESSEP

hide sequence

Ensembl Acc Id:

ENSRNOP00000013145 ⟸ ENSRNOT00000013146

RefSeq Acc Id:	XP_038963352 ⟸ XM_039107424
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_038963349 ⟸ XM_039107421
- Peptide Label:	isoform X1
- UniProtKB:	A6IKY9 (UniProtKB/TrEMBL), A0A8I6GIE7 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038963351 ⟸ XM_039107423
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I6GIE7 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038963350 ⟸ XM_039107422
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I6GIE7 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000090666 ⟸ ENSRNOT00000105331

Ensembl Acc Id:

ENSRNOP00000091392 ⟸ ENSRNOT00000114812

Protein Domains

C3H1-type RING-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5XI23-F1-model_v2	AlphaFold	Q5XI23	1-417	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693323

Promoter ID:

EPDNEW_R3848

Type:

initiation region

Name:

Mkrn2_1

Description:

makorin, ring finger protein, 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	147,514,095 - 147,514,155	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310618	AgrOrtholog
BioCyc Gene	G2FUF-43319	BioCyc
Ensembl Genes	ENSRNOG00000009176	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000013146.6	UniProtKB/TrEMBL
	ENSRNOT00000114812	ENTREZGENE
	ENSRNOT00000114812.2	UniProtKB/TrEMBL
Gene3D-CATH	2.30.30.1190	UniProtKB/TrEMBL
	3.30.40.10	UniProtKB/TrEMBL
	Pneumovirus matrix protein 2 (M2), zinc-binding domain	UniProtKB/TrEMBL
	Zinc finger, CCCH-type	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7128406	IMAGE-MGC_LOAD
InterPro	MKRN-like	UniProtKB/TrEMBL
	Znf_CCCH	UniProtKB/TrEMBL
	Znf_CCCH_sf	UniProtKB/TrEMBL
	Znf_RING	UniProtKB/TrEMBL
	Znf_RING/FYVE/PHD	UniProtKB/TrEMBL
	Znf_RING_CS	UniProtKB/TrEMBL
KEGG Report	rno:297525	UniProtKB/TrEMBL
MGC_CLONE	MGC:95133	IMAGE-MGC_LOAD
NCBI Gene	297525	ENTREZGENE
PANTHER	PTHR11224	UniProtKB/TrEMBL
	PTHR11224:SF17	UniProtKB/TrEMBL
Pfam	zf-CCCH	UniProtKB/TrEMBL
	zf-CCCH_2	UniProtKB/TrEMBL
PhenoGen	Mkrn2	PhenoGen
PROSITE	ZF_C3H1	UniProtKB/TrEMBL
	ZF_RING_1	UniProtKB/TrEMBL
	ZF_RING_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000009176	RatGTEx
SMART	RING	UniProtKB/TrEMBL
	ZnF_C3H1	UniProtKB/TrEMBL
Superfamily-SCOP	RING/U-box	UniProtKB/TrEMBL
	SSF90229	UniProtKB/TrEMBL
UniProt	A0A8I6GIE7	ENTREZGENE
	A6IKY9	ENTREZGENE, UniProtKB/TrEMBL
	F7EMI5	ENTREZGENE, UniProtKB/TrEMBL
	Q5XI23	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-12-06	Mkrn2	makorin, ring finger protein, 2	Mkrn2_predicted	makorin, ring finger protein, 2 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Mkrn2_predicted	makorin, ring finger protein, 2 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message