Kdelr2 (KDEL endoplasmic reticulum protein retention receptor 2)

Advanced Search (OLGA)

Gene: Kdelr2 (KDEL endoplasmic reticulum protein retention receptor 2) Rattus norvegicus

Analyze

Symbol:

Kdelr2

Name:

KDEL endoplasmic reticulum protein retention receptor 2

RGD ID:

1304618

Description:

Predicted to enable KDEL sequence binding activity. Predicted to be involved in protein retention in ER lumen and retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum. Located in cis-Golgi network and endoplasmic reticulum. Human ortholog(s) of this gene implicated in osteogenesis imperfecta type 21. Orthologous to human KDELR2 (KDEL endoplasmic reticulum protein retention receptor 2); INTERACTS WITH 17alpha-ethynylestradiol; 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

ER lumen protein retaining receptor 2; ER lumen protein-retaining receptor 2; KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 2; KDEL receptor 2; LOC304290

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	16,252,424 - 16,270,737 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	16,252,424 - 16,270,719 (-)	Ensembl				GRCr8
mRatBN7.2	12	11,138,820 - 11,157,117 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	11,138,820 - 11,157,153 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	11,946,125 - 11,964,325 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	12,569,412 - 12,587,613 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	11,595,547 - 11,613,739 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	13,192,452 - 13,210,758 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	13,192,453 - 13,210,758 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	15,232,465 - 15,250,771 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	11,498,420 - 11,513,595 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	12,932,160 - 12,950,458 (-)	NCBI		Celera
RGSC_v3.1	12	11,524,186 - 11,543,482 (-)	NCBI
Cytogenetic Map	12	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

BCARD syndrome (ISO)

Desbuquois dysplasia (ISO)

osteogenesis imperfecta type 21 (ISO)

osteoporosis-pseudoglioma syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2-methylcholine (ISO)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP)

6-propyl-2-thiouracil (EXP)

amiodarone (EXP)

amitrole (EXP)

atrazine (ISO)

benzbromarone (EXP)

benzo[a]pyrene (ISO)

beta-hexachlorocyclohexane (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

cadmium sulfate (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

chlorpyrifos (ISO)

clobetasol (ISO)

clofibrate (EXP)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

Dibutyl phosphate (ISO)

diuron (ISO)

dorsomorphin (ISO)

endosulfan (EXP)

flutamide (EXP)

folic acid (ISO)

formaldehyde (ISO)

genistein (ISO)

gentamycin (EXP)

glafenine (EXP)

ivermectin (ISO)

L-ethionine (EXP)

mercury atom (ISO)

mercury(0) (ISO)

methidathion (ISO)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

methylseleninic acid (ISO)

mifepristone (ISO)

mono(2-ethylhexyl) phthalate (ISO)

monobenzyl phthalate (ISO)

Monobutylphthalate (ISO)

monoethyl phthalate (ISO)

nickel atom (ISO)

nitrates (ISO)

Nivalenol (ISO)

omeprazole (EXP)

paracetamol (ISO)

phenylmercury acetate (ISO)

picoxystrobin (ISO)

pirinixic acid (EXP,ISO)

piroxicam (ISO)

propiconazole (ISO)

pyrimidifen (ISO)

rotenone (EXP)

Salinomycin (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

T-2 toxin (ISO)

tamoxifen (ISO)

temozolomide (ISO)

tetrachloromethane (ISO)

thapsigargin (ISO)

thifluzamide (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (ISO)

trichostatin A (ISO)

tunicamycin (ISO)

valproic acid (EXP,ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

maintenance of protein localization in endoplasmic reticulum (ISO,ISS)

protein retention in ER lumen (IBA,IEA)

protein transport (IEA)

retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum (ISO,ISS)

vesicle-mediated transport (IEA)

Cellular Component

cis-Golgi network (IBA,IDA)

COPI-coated vesicle membrane (IEA,ISO,ISS)

cytoplasmic vesicle (IEA)

endoplasmic reticulum (IBA,IDA,IEA)

endoplasmic reticulum membrane (IEA,ISO,ISS)

Golgi membrane (IEA,ISO,ISS)

membrane (IEA,ISS)

Molecular Function

ER retention sequence binding (IBA,IEA)

KDEL sequence binding (ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	UBXD4, a UBX-containing protein, regulates the cell surface number and stability of alpha3-containing nicotinic acetylcholine receptors.	Rezvani K, etal., J Neurosci. 2009 May 27;29(21):6883-96. doi: 10.1523/JNEUROSCI.4723-08.2009.
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:1325562	PMID:15489334	PMID:18086916	PMID:23376485

Genomics

Comparative Map Data

Kdelr2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	16,252,424 - 16,270,737 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	16,252,424 - 16,270,719 (-)	Ensembl				GRCr8
mRatBN7.2	12	11,138,820 - 11,157,117 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	11,138,820 - 11,157,153 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	11,946,125 - 11,964,325 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	12,569,412 - 12,587,613 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	11,595,547 - 11,613,739 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	13,192,452 - 13,210,758 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	13,192,453 - 13,210,758 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	15,232,465 - 15,250,771 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	11,498,420 - 11,513,595 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	12,932,160 - 12,950,458 (-)	NCBI		Celera
RGSC_v3.1	12	11,524,186 - 11,543,482 (-)	NCBI
Cytogenetic Map	12	p11	NCBI

KDELR2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	6,461,089 - 6,484,152 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	6,445,953 - 6,484,193 (-)	Ensembl			hg38	GRCh38
GRCh37	7	6,500,720 - 6,523,783 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	6,467,237 - 6,490,374 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	7	6,275,509 - 6,296,940	NCBI
Celera	7	6,211,338 - 6,234,431 (+)	NCBI		Celera
Cytogenetic Map	7	p22.1	NCBI
HuRef	7	6,373,518 - 6,395,670 (-)	NCBI		HuRef
CHM1_1	7	6,500,302 - 6,523,431 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	6,580,398 - 6,603,413 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	6,547,172 - 6,570,287 (-)	NCBI

Kdelr2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	143,389,575 - 143,407,659 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	143,389,593 - 143,407,656 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	143,403,820 - 143,421,904 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	143,403,838 - 143,421,901 (+)	Ensembl			mm10	GRCm38
MGSCv37	5	144,165,499 - 144,182,955 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	144,165,505 - 144,182,947 (+)	NCBI		MGSCv36	mm8
Celera	5	140,450,973 - 140,468,362 (+)	NCBI		Celera
Cytogenetic Map	5	G2	NCBI
cM Map	5	82.12	NCBI

Kdelr2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955460	13,202,401 - 13,221,319 (+)	Ensembl
ChiLan1.0	NW_004955460	13,202,400 - 13,221,319 (+)	NCBI	ChiLan1.0	ChiLan1.0

KDELR2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	11,188,025 - 11,211,263 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	59,512,862 - 59,535,981 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	6,960,456 - 6,983,515 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	6,654,430 - 6,667,794 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2

KDELR2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	11,796,586 - 11,815,765 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	11,798,377 - 11,815,760 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	13,421,923 - 13,441,095 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	11,798,777 - 11,817,951 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	11,799,791 - 11,817,956 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	11,674,580 - 11,693,744 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	11,654,175 - 11,673,193 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	11,880,887 - 11,900,112 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Kdelr2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	140,024,950 - 140,042,738 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936765	15,820 - 33,932 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936765	16,017 - 33,812 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

KDELR2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	4,716,646 - 4,735,300 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	3	4,716,651 - 4,735,303 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

KDELR2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	28	15,671,314 - 15,694,192 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	28	15,672,442 - 15,694,148 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666102	377,263 - 401,933 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Kdelr2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624740	30,853,425 - 30,873,754 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624740	30,853,252 - 30,875,730 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Kdelr2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	16	9,724,803 - 9,742,963 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Kdelr2
104 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	113
Count of miRNA genes:	94
Interacting mature miRNAs:	102
Transcripts:	ENSRNOT00000001438
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312418	Kidm41	Kidney mass QTL 41	3.7	0.0001	kidney mass (VT:0002707)	single kidney wet weight to body weight ratio (CMO:0000622)	12	5921918	25247790	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	11200494	52308831	Rat
2306789	Ean6	Experimental allergic neuritis QTL 6	4.9		nervous system integrity trait (VT:0010566)	experimental autoimmune neuritis severity score (CMO:0001528)	12	1	29775522	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
1357337	Gluco3	Glucose level QTL 3		0.0004	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	12	1	16966671	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	3489416	48489416	Rat
1331739	Hrtrt14	Heart rate QTL 14	3.56232		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	12	1	38687564	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200497	52308831	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	15264248	52308831	Rat
61331	Eau2	Experimental allergic uveoretinitis QTL 2		0.0005	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	12	1	33700600	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	11743528	52308831	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
1581516	Cm56	Cardiac mass QTL 56	4.2	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	11869600	16966542	Rat
61334	Gluco17	Glucose level QTL 17	6.3		adipocyte glucose uptake trait (VT:0004185)	adipocyte maximal glucose uptake to basal glucose uptake ratio (CMO:0000874)	12	1	16966671	Rat
2293684	Bmd26	Bone mineral density QTL 26	4.4	0.0002	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	12	1	38635130	Rat
6893681	Bw109	Body weight QTL 109	2.3	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	12	1	28133365	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	12233000	30490641	Rat
1300174	Bw15	Body weight QTL 15	2.93		body mass (VT:0001259)	body weight loss (CMO:0001399)	12	1	28606299	Rat
1331786	Kidm11	Kidney mass QTL 11	3.571		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	12	16187438	52308831	Rat
1331787	Rf41	Renal function QTL 41	2.998		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	12	1	33700556	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	16135029	52308831	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	16187438	51213550	Rat
1331763	Wbc2	White blood cell count QTL 2	3.162		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	12	11200494	52308831	Rat
7204484	Bp358	Blood pressure QTL 358		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	1	24849755	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	11200494	52308831	Rat
7387292	Kidm42	Kidney mass QTL 42	3.03	0.0004	kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	12	1	41361854	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	2747694	47747694	Rat
2303568	Bw88	Body weight QTL 88	3		body mass (VT:0001259)	body weight (CMO:0000012)	12	1	28606299	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	3087180	48087180	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7243862	Mcs30	Mammary carcinoma susceptibility QTL 30	8.62		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	12	5633306	50633306	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	16135029	52308831	Rat
2293086	Iddm30	Insulin dependent diabetes mellitus QTL 30	3.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	7901625	33938215	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
1331755	Bp219	Blood pressure QTL 219	3.041		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	16187438	33700556	Rat

Markers in Region

BF387279

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	11,156,676 - 11,156,867 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	13,210,318 - 13,210,508	NCBI	Rnor6.0
Rnor_5.0	12	15,250,331 - 15,250,521	UniSTS	Rnor5.0
RGSC_v3.4	12	11,513,114 - 11,513,304	UniSTS	RGSC3.4
Celera	12	12,950,018 - 12,950,208	UniSTS
RH 3.4 Map	12	158.61	UniSTS
Cytogenetic Map	12	p11	UniSTS

BI276615

Rat Assembly	Chr	Position (strand)	Source
Celera	12	12,932,328 - 12,932,493	UniSTS
RH 3.4 Map	12	156.0	UniSTS
Cytogenetic Map	12	p11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001013122	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063271257	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC126572	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC085786	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000001438 ⟹ ENSRNOP00000001438

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	16,252,424 - 16,270,354 (-)	Ensembl
mRatBN7.2 Ensembl	12	11,138,820 - 11,157,153 (-)	Ensembl
Rnor_6.0 Ensembl	12	13,192,453 - 13,210,758 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000167024 ⟹ ENSRNOP00000099503

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	16,253,203 - 16,270,719 (-)	Ensembl

RefSeq Acc Id:

NM_001013122 ⟹ NP_001013140

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	16,252,424 - 16,270,719 (-)	NCBI
mRatBN7.2	12	11,138,820 - 11,157,117 (-)	NCBI
Rnor_6.0	12	13,192,452 - 13,210,758 (-)	NCBI
Rnor_5.0	12	15,232,465 - 15,250,771 (-)	NCBI
Celera	12	12,932,160 - 12,950,458 (-)	RGD

Sequence:

show sequence

GCCGCCATCTTTCGCCGCTTCCTCTCTCAGGGGCTGTCGCCGCGTCCTGAGTCGCTGCCGAGCT
CCGGTGCCGCTTTGCCGCGCCGACTGCCACCACCATGAACATCTTCCGGCTGACTGGGGACCTG
TCCCACCTGGCGGCCATCGTCATCCTACTGCTGAAGATCTGGAAGACGCGCTCCTGTGCTGGTA
TTTCTGGGAAAAGCCAGCTCCTGTTTGCACTGGTCTTCACAACTCGTTACCTGGATCTTTTTAC
TTCATTCATTTCGTTATATAATACATCTATGAAGCTTATCTACATTGCCTGCTCCTACGCCACG
GTGTACCTGATCTACATGAAGTTTAAGGCCACCTATGATGGAAATCACGACACCTTCCGAGTGG
AGTTTCTTGTGGTTCCTGTAGGAGGCCTCTCATTCCTAGTCAACCATGACTTCTCTCCTCTTGA
GATCTTGTGGACCTTCTCCATCTACCTGGAGTCCGTGGCCATCCTCCCACAGCTCTTCATGATC
AGCAAGACCGGCGAGGCCGAGACCATCACCACCCACTACCTCTTCTTCCTGGGTCTCTACCGTG
CTCTCTACCTAGTCAACTGGATCTGGCGCTTCTACTTCGAGGGTTTCTTTGATCTCATTGCCGT
GGTGGCTGGTGTCGTCCAGACCATTCTCTACTGCGACTTCTTCTACTTGTACATCACAAAAGTA
CTCAAGGGAAAGAAGCTCAGCCTGCCAGCGTAAGTGCCAAAGACCGTCAGCAGCCTCTGCCCTT
CAGGGTGCTCAGACAGGGTCTCACCATGGCGAAGGCTCGGGATGCTCAGTGCGGAGAAGCAGAC
ACGGCTTCTTCTGTGGCAGCCGCTCACTGGTGGCTCTTCAAGGATGCAGAGCGAAGAGACCAGG
AGGCTTCTGTCTACTGCATCCTGCCTTATCTTTTTTATTACTATGTACAAAGATTTTTTTACAC
AAAGAAACTTAATGCTGTGTTAATAAATTCAGTATGTAGATGAATTGGGGCAGTTTCCAAAAGT
GACGATTTTGTGCAGAATAAGTACAAGCCTCTTTTTATTTTTTTGAAAATTTGCTGAGGTGGTC
AATTCTTTGTGTCTACAATGAAATTATACTCCTTGACACTTGGTAGATTATCCAAACATCGTCA
AATTTTCATGCTATTTATTTTATTTCTTTCTTTCTTTTTTTTTTTTTTTGCCAAAAGATGAGTT
GTGTTTGTTTGAAATCTGAGACACTGTGTTCCATTTGGTGTTTCTGTTCAAATGCATCCTCATT
GTCCTGGAAACCCTTCCCCAGATGTCACACTACATGTCAGGTCCAGGAGGATGACTCGCAAGTC
CTACAGATTTCATTACGAAAACTTCAAGGTTCCCAGTGGAAACCTGGAAACCGTCAGCTGATGC
TCACCAAATGCTCGCCCTTCACCCCTGCGGGGGCCTGGCAGCTCGAGGTTATCTGAGGGTGCCG
AGAGCCACCGCACCCTCTGACTGTGAGAGGGTGGGGGGTTGATGGCTGTTTTGGACAGAGGACT
CTGCTCCTCTGAGGCATGGAACACAGATAGCTACCTGTCAATGTCAGGCACAAATCCGAAGGAT
CACTACAACCATGTCAGACTCAAATGTTTTCTCATAGCACTTTTGGTGATAAATTGATTGACAA
TCTTTAATTGGCAGCACCAGTTATCAGTCCTTACATTCTTTTTAGTATTTTTTTTAAACTGGGC
TCTTGCATGACCTATATTGTGTTAACATCCTAAATAAACATTTTATTAAACAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063271257 ⟹ XP_063127327

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	16,252,424 - 16,270,737 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001013140	(Get FASTA)	NCBI Sequence Viewer
	XP_063127327	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH85786	(Get FASTA)	NCBI Sequence Viewer
	EDL89668	(Get FASTA)	NCBI Sequence Viewer
	Q5U305	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001013140 ⟸ NM_001013122

- UniProtKB:

Q5U305 (UniProtKB/Swiss-Prot), A6K1L0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MNIFRLTGDLSHLAAIVILLLKIWKTRSCAGISGKSQLLFALVFTTRYLDLFTSFISLYNTSMK
LIYIACSYATVYLIYMKFKATYDGNHDTFRVEFLVVPVGGLSFLVNHDFSPLEILWTFSIYLES
VAILPQLFMISKTGEAETITTHYLFFLGLYRALYLVNWIWRFYFEGFFDLIAVVAGVVQTILYC
DFFYLYITKVLKGKKLSLPA

hide sequence

Ensembl Acc Id:

ENSRNOP00000001438 ⟸ ENSRNOT00000001438

RefSeq Acc Id:	XP_063127327 ⟸ XM_063271257
- Peptide Label:	isoform X1

Ensembl Acc Id:

ENSRNOP00000099503 ⟸ ENSRNOT00000167024

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5U305-F1-model_v2	AlphaFold	Q5U305	1-212	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698439

Promoter ID:

EPDNEW_R8964

Type:

initiation region

Name:

Kdelr2_1

Description:

KDEL endoplasmic reticulum protein retention receptor 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	13,210,794 - 13,210,854	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1304618	AgrOrtholog
BioCyc Gene	G2FUF-20006	BioCyc
Ensembl Genes	ENSRNOG00000001083	Ensembl
IMAGE_CLONE	IMAGE:7108608	IMAGE-MGC_LOAD
InterPro	ER_ret_rcpt	UniProtKB/Swiss-Prot
KEGG Report	rno:304290	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:93761	IMAGE-MGC_LOAD
NCBI Gene	304290	ENTREZGENE
PANTHER	PTHR10585	UniProtKB/Swiss-Prot
Pfam	ER_lumen_recept	UniProtKB/Swiss-Prot
PhenoGen	Kdelr2	PhenoGen
PRINTS	ERLUMENR	UniProtKB/Swiss-Prot
PROSITE	ER_LUMEN_RECEPTOR_1	UniProtKB/Swiss-Prot
	ER_LUMEN_RECEPTOR_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000001083	RatGTEx
UniProt	A0A8L2Q098_RAT	UniProtKB/TrEMBL
	A0ABK0L914_RAT	UniProtKB/TrEMBL
	A6K1L0	ENTREZGENE, UniProtKB/TrEMBL
	ERD22_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-12-16	Kdelr2	KDEL endoplasmic reticulum protein retention receptor 2	Kdelr2	KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-05-24	Kdelr2	KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 2	LOC100360920	KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 2	Data merged from RGD:2321139	1643240	APPROVED
2010-05-05	LOC100360920	KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 2			Symbol and Name status set to provisional	70820	PROVISIONAL
2005-12-06	Kdelr2	KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 2	Kdelr2_predicted	KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 2 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Kdelr2_predicted	KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 2 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM