Symbol:
Cbx7
Name:
chromobox 7
RGD ID:
735027
Description:
Predicted to enable chromatin binding activity; methylated histone binding activity; and single-stranded RNA binding activity. Involved in developmental process involved in reproduction; positive regulation of transcription elongation by RNA polymerase II; and response to xenobiotic stimulus. Predicted to be located in cytosol; heterochromatin; and nucleoplasm. Predicted to be part of PRC1 complex. Human ortholog(s) of this gene implicated in breast cancer; multiple myeloma; and myeloid leukemia. Orthologous to human CBX7 (chromobox 7); PARTICIPATES IN histone modification pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol; 2,2',4,4'-Tetrabromodiphenyl ether.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
chromobox homolog 7; chromobox protein homolog 7
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CBX7 (chromobox 7) HGNC
Ensembl, HomoloGene, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Cbx7 (chromobox 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cbx7 (chromobox 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CBX7 (chromobox 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CBX7 (chromobox 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cbx7 (chromobox 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CBX7 (chromobox 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CBX7 (chromobox 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cbx7 (chromobox 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
CBX7 (chromobox 7)
Alliance
DIOPT (Ensembl Compara|HGNC|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Cbx7 (chromobox 7)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cbx7a (chromobox homolog 7a)
Alliance
DIOPT (Ensembl Compara|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
cbx7b (chromobox homolog 7b)
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Pc
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PhylomeDB)
Caenorhabditis elegans (roundworm):
cec-6
Alliance
DIOPT (Ensembl Compara|OrthoFinder)
Xenopus tropicalis (tropical clawed frog):
cbx7
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 113,341,030 - 113,358,716 (-) NCBI GRCr8 mRatBN7.2 7 111,460,656 - 111,479,231 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 111,460,656 - 111,477,973 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 113,208,676 - 113,225,978 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 115,432,223 - 115,449,524 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 115,401,568 - 115,418,871 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 121,136,067 - 121,153,503 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 121,136,058 - 121,153,383 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 121,126,405 - 121,144,401 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 118,148,413 - 118,165,701 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 118,182,643 - 118,199,931 (-) NCBI Celera 7 107,790,484 - 107,807,779 (-) NCBI Celera Cytogenetic Map 7 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cbx7 Rat 1,2-dichloroethane decreases expression ISO Cbx7 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of CBX7 mRNA CTD PMID:28960355 Cbx7 Rat 1,2-dimethylhydrazine increases expression ISO Cbx7 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of CBX7 mRNA CTD PMID:22206623 Cbx7 Rat 1-naphthyl isothiocyanate decreases expression EXP 6480464 1-Naphthylisothiocyanate results in decreased expression of CBX7 mRNA CTD PMID:30723492 Cbx7 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of CBX7 mRNA CTD PMID:17351261 Cbx7 Rat 17beta-estradiol multiple interactions ISO CBX7 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of CBX7 mRNA CTD PMID:30165855 Cbx7 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Cbx7 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Cbx7 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2 more ... CTD PMID:27291303 Cbx7 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Cbx7 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Cbx7 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CBX7 mRNA CTD PMID:32109520 Cbx7 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of CBX7 mRNA CTD PMID:33387578 Cbx7 Rat 2,3,7,8-Tetrachlorodibenzofuran increases expression EXP 6480464 2 more ... CTD PMID:32109520 Cbx7 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of CBX7 mRNA CTD PMID:21346803 Cbx7 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of CBX7 mRNA CTD PMID:21346803 Cbx7 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:32119087 Cbx7 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO CBX7 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of CBX7 mRNA CTD PMID:28628672 Cbx7 Rat 4,4'-sulfonyldiphenol decreases expression ISO Cbx7 (Mus musculus) 6480464 bisphenol S results in decreased expression of CBX7 mRNA CTD PMID:39298647 Cbx7 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of CBX7 mRNA CTD PMID:36041667 Cbx7 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of CBX7 mRNA CTD PMID:24780913 and PMID:30047161 Cbx7 Rat acrylamide decreases expression ISO CBX7 (Homo sapiens) 6480464 Acrylamide results in decreased expression of CBX7 mRNA CTD PMID:32763439 Cbx7 Rat all-trans-retinoic acid increases expression ISO CBX7 (Homo sapiens) 6480464 Tretinoin results in increased expression of CBX7 mRNA CTD PMID:23724009 Cbx7 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of CBX7 mRNA CTD PMID:30047161 Cbx7 Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of CBX7 mRNA CTD PMID:30779732 Cbx7 Rat aripiprazole increases expression EXP 6480464 Aripiprazole results in increased expression of CBX7 mRNA CTD PMID:17868501 Cbx7 Rat aripiprazole decreases expression EXP 6480464 Aripiprazole results in decreased expression of CBX7 mRNA CTD PMID:17868501 Cbx7 Rat arsenite(3-) multiple interactions ISO CBX7 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to CBX7 mRNA] CTD PMID:32406909 Cbx7 Rat arsenous acid decreases expression ISO CBX7 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of CBX7 mRNA CTD PMID:22521957 Cbx7 Rat benzo[a]pyrene increases expression ISO Cbx7 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of CBX7 mRNA CTD PMID:22228805 Cbx7 Rat benzo[a]pyrene decreases methylation ISO CBX7 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of CBX7 promoter CTD PMID:27901495 Cbx7 Rat benzo[a]pyrene affects methylation ISO CBX7 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of CBX7 3' UTR CTD PMID:27901495 Cbx7 Rat benzo[a]pyrene decreases expression ISO CBX7 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of CBX7 mRNA CTD PMID:22316170 and PMID:26238291 Cbx7 Rat bisphenol A increases expression ISO CBX7 (Homo sapiens) 6480464 bisphenol A results in increased expression of CBX7 mRNA CTD PMID:25047013 Cbx7 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of CBX7 mRNA CTD PMID:36041667 Cbx7 Rat bisphenol A decreases methylation ISO CBX7 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of CBX7 gene CTD PMID:31601247 Cbx7 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CBX7 mRNA CTD PMID:30816183 and PMID:32528016 Cbx7 Rat bisphenol A multiple interactions ISO CBX7 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of CBX7 mRNA CTD PMID:28628672 Cbx7 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CBX7 mRNA CTD PMID:25181051 Cbx7 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of CBX7 mRNA CTD PMID:36041667 Cbx7 Rat cadmium atom multiple interactions ISO Cbx7 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of CBX7 mRNA CTD PMID:37325564 Cbx7 Rat cadmium dichloride multiple interactions ISO Cbx7 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of CBX7 mRNA CTD PMID:37325564 Cbx7 Rat CGP 52608 multiple interactions ISO CBX7 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to CBX7 gene] CTD PMID:28238834 Cbx7 Rat cisplatin multiple interactions ISO CBX7 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of CBX7 mRNA CTD PMID:27392435 Cbx7 Rat cisplatin increases expression ISO CBX7 (Homo sapiens) 6480464 Cisplatin results in increased expression of CBX7 mRNA CTD PMID:27392435 Cbx7 Rat copper(II) sulfate decreases expression ISO CBX7 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of CBX7 mRNA CTD PMID:19549813 Cbx7 Rat crocidolite asbestos decreases expression ISO Cbx7 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of CBX7 mRNA CTD PMID:29279043 Cbx7 Rat cyclosporin A decreases expression ISO CBX7 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of CBX7 mRNA CTD PMID:20106945 Cbx7 Rat dexamethasone multiple interactions ISO CBX7 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of CBX7 mRNA CTD PMID:28628672 Cbx7 Rat diarsenic trioxide decreases expression ISO CBX7 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of CBX7 mRNA CTD PMID:22521957 Cbx7 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of CBX7 mRNA CTD PMID:37077353 Cbx7 Rat dopamine decreases expression EXP 6480464 Dopamine results in decreased expression of CBX7 mRNA CTD PMID:21983523 Cbx7 Rat dorsomorphin multiple interactions ISO CBX7 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CBX7 mRNA CTD PMID:27188386 Cbx7 Rat doxorubicin decreases expression ISO CBX7 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of CBX7 mRNA CTD PMID:29803840 Cbx7 Rat elemental selenium increases expression ISO CBX7 (Homo sapiens) 6480464 Selenium results in increased expression of CBX7 mRNA CTD PMID:19244175 Cbx7 Rat ethyl methanesulfonate increases expression ISO CBX7 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of CBX7 mRNA CTD PMID:23649840 Cbx7 Rat fenoldopam decreases expression EXP 6480464 Fenoldopam results in decreased expression of CBX7 mRNA CTD PMID:21983523 Cbx7 Rat folic acid decreases expression ISO Cbx7 (Mus musculus) 6480464 Folic Acid results in decreased expression of CBX7 mRNA CTD PMID:25629700 Cbx7 Rat furan increases methylation EXP 6480464 furan results in increased methylation of CBX7 gene CTD PMID:22079235 Cbx7 Rat genistein decreases methylation EXP 6480464 Genistein results in decreased methylation of CBX7 gene CTD PMID:28505145 Cbx7 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of CBX7 mRNA CTD PMID:33387578 Cbx7 Rat hydralazine multiple interactions ISO CBX7 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of CBX7 mRNA CTD PMID:17183730 Cbx7 Rat hydrogen peroxide affects expression ISO CBX7 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of CBX7 mRNA CTD PMID:20044591 Cbx7 Rat indometacin multiple interactions ISO CBX7 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of CBX7 mRNA CTD PMID:28628672 Cbx7 Rat iron dichloride decreases expression ISO CBX7 (Homo sapiens) 6480464 ferrous chloride results in decreased expression of CBX7 mRNA CTD PMID:35984750 Cbx7 Rat ketamine increases expression EXP 6480464 Ketamine results in increased expression of CBX7 mRNA CTD PMID:20080153 Cbx7 Rat ketoconazole increases expression EXP 6480464 Ketoconazole results in increased expression of CBX7 mRNA CTD PMID:37077353 Cbx7 Rat lead diacetate increases expression ISO Cbx7 (Mus musculus) 6480464 lead acetate results in increased expression of CBX7 mRNA CTD PMID:22613225 Cbx7 Rat mercury atom decreases expression ISO Cbx7 (Mus musculus) 6480464 Mercury analog results in decreased expression of CBX7 mRNA CTD PMID:25056781 Cbx7 Rat mercury(0) decreases expression ISO Cbx7 (Mus musculus) 6480464 Mercury analog results in decreased expression of CBX7 mRNA CTD PMID:25056781 Cbx7 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of CBX7 mRNA CTD PMID:30047161 Cbx7 Rat methylseleninic acid increases expression ISO CBX7 (Homo sapiens) 6480464 methylselenic acid results in increased expression of CBX7 mRNA CTD PMID:18548127 Cbx7 Rat N(4)-hydroxycytidine decreases expression ISO Cbx7 (Mus musculus) 6480464 N(4)-hydroxycytidine results in decreased expression of CBX7 mRNA CTD PMID:37748715 Cbx7 Rat nickel atom decreases expression ISO CBX7 (Homo sapiens) 6480464 Nickel results in decreased expression of CBX7 mRNA CTD PMID:24768652 and PMID:25583101 Cbx7 Rat nitrates multiple interactions ISO Cbx7 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of CBX7 mRNA CTD PMID:35964746 Cbx7 Rat ozone multiple interactions ISO Cbx7 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of CBX7 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of CBX7 mRNA CTD PMID:27106289 and PMID:34911549 Cbx7 Rat ozone multiple interactions ISO CBX7 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of CBX7 mRNA CTD PMID:35430440 Cbx7 Rat paracetamol decreases expression ISO CBX7 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of CBX7 mRNA CTD PMID:21420995 Cbx7 Rat PCB138 multiple interactions ISO Cbx7 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Cbx7 Rat perfluorohexanesulfonic acid decreases expression ISO Cbx7 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in decreased expression of CBX7 mRNA CTD PMID:37995155 Cbx7 Rat perfluorooctane-1-sulfonic acid increases expression ISO Cbx7 (Mus musculus) 6480464 perfluorooctane sulfonic acid results in increased expression of CBX7 mRNA and perfluorooctane sulfonic acid results in increased expression of CBX7 protein CTD PMID:25510869 Cbx7 Rat phenobarbital affects expression ISO CBX7 (Homo sapiens) 6480464 Phenobarbital affects the expression of CBX7 mRNA CTD PMID:19159669 Cbx7 Rat phenylmercury acetate decreases expression ISO CBX7 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of CBX7 mRNA CTD PMID:26272509 Cbx7 Rat phenylmercury acetate multiple interactions ISO CBX7 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CBX7 mRNA CTD PMID:27188386 Cbx7 Rat resveratrol multiple interactions ISO CBX7 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of CBX7 mRNA more ... CTD PMID:23557933 and PMID:32621571 Cbx7 Rat resveratrol decreases expression ISO CBX7 (Homo sapiens) 6480464 Resveratrol results in decreased expression of CBX7 protein CTD PMID:32621571 Cbx7 Rat SB 431542 multiple interactions ISO CBX7 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CBX7 mRNA CTD PMID:27188386 Cbx7 Rat selenium atom increases expression ISO CBX7 (Homo sapiens) 6480464 Selenium results in increased expression of CBX7 mRNA CTD PMID:19244175 Cbx7 Rat sodium arsenite increases expression ISO CBX7 (Homo sapiens) 6480464 sodium arsenite results in increased expression of CBX7 mRNA CTD PMID:38568856 Cbx7 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of CBX7 mRNA CTD PMID:30047161 Cbx7 Rat temozolomide decreases expression ISO CBX7 (Homo sapiens) 6480464 Temozolomide results in decreased expression of CBX7 mRNA CTD PMID:31758290 Cbx7 Rat testosterone increases expression ISO Cbx7 (Mus musculus) 6480464 Testosterone deficiency results in increased expression of CBX7 mRNA CTD PMID:33848595 Cbx7 Rat tetrachloroethene increases expression ISO Cbx7 (Mus musculus) 6480464 Tetrachloroethylene results in increased expression of CBX7 mRNA CTD PMID:28973375 Cbx7 Rat thimerosal decreases expression ISO CBX7 (Homo sapiens) 6480464 Thimerosal results in decreased expression of CBX7 mRNA CTD PMID:27188386 Cbx7 Rat thiram decreases expression ISO CBX7 (Homo sapiens) 6480464 Thiram results in decreased expression of CBX7 mRNA CTD PMID:38568856 Cbx7 Rat titanium dioxide decreases methylation ISO Cbx7 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of CBX7 gene and titanium dioxide results in decreased methylation of CBX7 promoter CTD PMID:35295148 Cbx7 Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of CBX7 gene CTD PMID:27618143 Cbx7 Rat trichostatin A increases expression ISO CBX7 (Homo sapiens) 6480464 trichostatin A results in increased expression of CBX7 mRNA CTD PMID:24935251 Cbx7 Rat triphenyl phosphate affects expression ISO CBX7 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of CBX7 mRNA CTD PMID:37042841 Cbx7 Rat triptonide affects expression ISO Cbx7 (Mus musculus) 6480464 triptonide affects the expression of CBX7 mRNA CTD PMID:33045310 Cbx7 Rat urethane decreases expression ISO CBX7 (Homo sapiens) 6480464 Urethane results in decreased expression of CBX7 mRNA CTD PMID:28818685 Cbx7 Rat valproic acid multiple interactions ISO CBX7 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of CBX7 mRNA CTD PMID:17183730 Cbx7 Rat valproic acid affects expression ISO CBX7 (Homo sapiens) 6480464 Valproic Acid affects the expression of CBX7 mRNA CTD PMID:25979313 Cbx7 Rat valproic acid increases expression ISO CBX7 (Homo sapiens) 6480464 Valproic Acid results in increased expression of CBX7 mRNA CTD PMID:24935251 and PMID:29154799 Cbx7 Rat vitamin E increases expression ISO CBX7 (Homo sapiens) 6480464 Vitamin E results in increased expression of CBX7 mRNA CTD PMID:19244175
1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 6-propyl-2-thiouracil (EXP) acrylamide (ISO) all-trans-retinoic acid (ISO) amitrole (EXP) amphetamine (EXP) aripiprazole (EXP) arsenite(3-) (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP) cadmium atom (ISO) cadmium dichloride (ISO) CGP 52608 (ISO) cisplatin (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) diethylstilbestrol (EXP) dopamine (EXP) dorsomorphin (ISO) doxorubicin (ISO) elemental selenium (ISO) ethyl methanesulfonate (ISO) fenoldopam (EXP) folic acid (ISO) furan (EXP) genistein (EXP) gentamycin (EXP) hydralazine (ISO) hydrogen peroxide (ISO) indometacin (ISO) iron dichloride (ISO) ketamine (EXP) ketoconazole (EXP) lead diacetate (ISO) mercury atom (ISO) mercury(0) (ISO) methimazole (EXP) methylseleninic acid (ISO) N(4)-hydroxycytidine (ISO) nickel atom (ISO) nitrates (ISO) ozone (ISO) paracetamol (ISO) PCB138 (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) resveratrol (ISO) SB 431542 (ISO) selenium atom (ISO) sodium arsenite (ISO) sulfadimethoxine (EXP) temozolomide (ISO) testosterone (ISO) tetrachloroethene (ISO) thimerosal (ISO) thiram (ISO) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) triptonide (ISO) urethane (ISO) valproic acid (ISO) vitamin E (ISO)
1.
Chronic treatment with aripiprazole induces differential gene expression in the rat frontal cortex.
Cheng MC, etal., Int J Neuropsychopharmacol. 2007 Sep 17;:1-10.
2.
Common variation at 3q26.2, 6p21.33, 17p11.2 and 22q13.1 influences multiple myeloma risk.
Chubb D, etal., Nat Genet. 2013 Oct;45(10):1221-5. doi: 10.1038/ng.2733. Epub 2013 Aug 18.
3.
Polycomb genes are associated with response to imatinib in chronic myeloid leukemia.
Crea F, etal., Epigenomics. 2015 Aug;7(5):757-65. doi: 10.2217/epi.15.35. Epub 2015 Sep 7.
4.
Chromobox protein homologue 7 protein, with decreased expression in human carcinomas, positively regulates E-cadherin expression by interacting with the histone deacetylase 2 protein.
Federico A, etal., Cancer Res. 2009 Sep 1;69(17):7079-87. doi: 10.1158/0008-5472.CAN-09-1542. Epub 2009 Aug 25.
5.
CBX7 is a tumor suppressor in mice and humans.
Forzati F, etal., J Clin Invest. 2012 Feb 1;122(2):612-23. doi: 10.1172/JCI58620. Epub 2012 Jan 3.
6.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.
PRC1 complex diversity: where is it taking us?
Gil J and O'Loghlen A, Trends Cell Biol. 2014 Jul 22. pii: S0962-8924(14)00102-0. doi: 10.1016/j.tcb.2014.06.005.
8.
Polycomb CBX7 has a unifying role in cellular lifespan.
Gil J, etal., Nat Cell Biol 2004 Jan;6(1):67-72. Epub 2003 Nov 30.
9.
[Downregulation of chromobox protein homolog 7 expression in multiple human cancer tissues]
Guan ZP, etal., Zhonghua Yu Fang Yi Xue Za Zhi. 2011 Jul;45(7):597-600.
10.
Expression parameters of the polycomb group proteins BMI1, SUZ12, RING1 and CBX7 in urothelial carcinoma of the bladder and their prognostic relevance.
Hinz S, etal., Tumour Biol. 2008;29(5):323-9. doi: 10.1159/000170879. Epub 2008 Nov 5.
11.
Loss of the CBX7 protein expression correlates with a more aggressive phenotype in pancreatic cancer.
Karamitopoulou E, etal., Eur J Cancer. 2010 May;46(8):1438-44. doi: 10.1016/j.ejca.2010.01.033. Epub 2010 Feb 23.
12.
CBX7 inhibits breast tumorigenicity through DKK-1-mediated suppression of the Wnt/beta-catenin pathway.
Kim HY, etal., FASEB J. 2015 Jan;29(1):300-13. doi: 10.1096/fj.14-253997. Epub 2014 Oct 28.
13.
Tracing dynamics and clonal heterogeneity of Cbx7-induced leukemic stem cells by cellular barcoding.
Klauke K, etal., Stem Cell Reports. 2015 Jan 13;4(1):74-89. doi: 10.1016/j.stemcr.2014.10.012. Epub 2014 Nov 26.
14.
Altered expression of polycomb group genes in glioblastoma multiforme.
Li G, etal., PLoS One. 2013 Nov 15;8(11):e80970. doi: 10.1371/journal.pone.0080970. eCollection 2013.
15.
Epigenetic control of female puberty.
Lomniczi A, etal., Nat Neurosci. 2013 Mar;16(3):281-9. doi: 10.1038/nn.3319. Epub 2013 Jan 27.
16.
Identification of a New Pathway for Tumor Progression: MicroRNA-181b Up-Regulation and CBX7 Down-Regulation by HMGA1 Protein.
Mansueto G, etal., Genes Cancer. 2010 Mar;1(3):210-24. doi: 10.1177/1947601910366860.
17.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
18.
CBX7 Expression in Oncocytic Thyroid Neoplastic Lesions (Hurthle Cell Adenomas and Carcinomas).
Monaco M, etal., Eur Thyroid J. 2014 Dec;3(4):211-6. doi: 10.1159/000367989. Epub 2014 Oct 15.
19.
Loss of the CBX7 gene expression correlates with a highly malignant phenotype in thyroid cancer.
Pallante P, etal., Cancer Res. 2008 Aug 15;68(16):6770-8. doi: 10.1158/0008-5472.CAN-08-0695.
20.
GOA pipeline
RGD automated data pipeline
21.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
22.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
23.
Comprehensive gene review and curation
RGD comprehensive gene curation
24.
Role of the chromobox protein CBX7 in lymphomagenesis.
Scott CL, etal., Proc Natl Acad Sci U S A. 2007 Mar 27;104(13):5389-94. Epub 2007 Mar 20.
25.
Expression of chromobox homolog 7 (CBX7) is associated with poor prognosis in ovarian clear cell adenocarcinoma via TRAIL-induced apoptotic pathway regulation.
Shinjo K, etal., Int J Cancer. 2014 Jul 15;135(2):308-18. doi: 10.1002/ijc.28692. Epub 2014 Jan 10.
26.
Occupying chromatin: Polycomb mechanisms for getting to genomic targets, stopping transcriptional traffic, and staying put.
Simon JA and Kingston RE, Mol Cell. 2013 Mar 7;49(5):808-24. doi: 10.1016/j.molcel.2013.02.013.
27.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
28.
Oncogenic role of the chromobox protein CBX7 in gastric cancer.
Zhang XW, etal., J Exp Clin Cancer Res. 2010 Aug 19;29:114. doi: 10.1186/1756-9966-29-114.
Cbx7 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 113,341,030 - 113,358,716 (-) NCBI GRCr8 mRatBN7.2 7 111,460,656 - 111,479,231 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 111,460,656 - 111,477,973 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 113,208,676 - 113,225,978 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 115,432,223 - 115,449,524 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 115,401,568 - 115,418,871 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 121,136,067 - 121,153,503 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 121,136,058 - 121,153,383 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 121,126,405 - 121,144,401 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 118,148,413 - 118,165,701 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 118,182,643 - 118,199,931 (-) NCBI Celera 7 107,790,484 - 107,807,779 (-) NCBI Celera Cytogenetic Map 7 q34 NCBI
CBX7 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 22 39,130,772 - 39,152,680 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 22 39,120,167 - 39,152,680 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 22 39,526,777 - 39,548,685 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 22 37,856,723 - 37,878,484 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 22 37,851,280 - 37,873,038 NCBI Celera 22 23,328,820 - 23,350,581 (-) NCBI Celera Cytogenetic Map 22 q13.1 NCBI HuRef 22 22,493,890 - 22,515,575 (-) NCBI HuRef CHM1_1 22 39,485,611 - 39,507,403 (-) NCBI CHM1_1 T2T-CHM13v2.0 22 39,601,155 - 39,623,071 (-) NCBI T2T-CHM13v2.0
Cbx7 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 79,800,005 - 79,855,344 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 79,800,008 - 79,855,320 (-) Ensembl GRCm39 Ensembl GRCm38 15 79,915,804 - 79,971,143 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 79,915,807 - 79,971,119 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 79,746,237 - 79,763,076 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 79,740,244 - 79,759,866 (-) NCBI MGSCv36 mm8 Celera 15 82,033,986 - 82,050,640 (-) NCBI Celera Cytogenetic Map 15 E1 NCBI cM Map 15 37.85 NCBI
Cbx7 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955413 25,086,186 - 25,100,039 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955413 25,079,627 - 25,100,039 (-) NCBI ChiLan1.0 ChiLan1.0
CBX7 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 23 48,978,435 - 49,000,373 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 22 51,669,911 - 51,691,852 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 22 20,037,529 - 20,059,459 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 22 37,854,049 - 37,876,861 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 22 37,854,056 - 37,876,084 (-) Ensembl panpan1.1 panPan2
CBX7 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 25,876,022 - 25,896,284 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 25,876,016 - 25,893,501 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 25,810,682 - 25,832,138 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 26,627,291 - 26,648,764 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 26,627,343 - 26,648,764 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 26,340,710 - 26,362,175 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 26,661,555 - 26,681,886 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 26,836,680 - 26,858,133 (+) NCBI UU_Cfam_GSD_1.0
Cbx7 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 9,400,883 - 9,418,070 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936492 2,410,308 - 2,428,682 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936492 2,411,171 - 2,428,484 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CBX7 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 9,070,353 - 9,087,634 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 9,070,312 - 9,090,467 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 6,355,114 - 6,372,426 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CBX7 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 19 21,776,618 - 21,798,525 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 19 21,775,931 - 21,798,309 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 103,958,387 - 103,980,295 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cbx7
.
Predicted Target Of
Count of predictions: 298 Count of miRNA genes: 198 Interacting mature miRNAs: 222 Transcripts: ENSRNOT00000022631 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 1300112 Bp183 Blood pressure QTL 183 3.51 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 111182207 135012528 Rat 1331728 Bp214 Blood pressure QTL 214 2.825 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 80221299 124373579 Rat 1331731 Bp216 Blood pressure QTL 216 2.851 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 102297359 133492884 Rat 2298475 Eau6 Experimental allergic uveoretinitis QTL 6 0.0029 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 7 84257275 129257275 Rat 71114 Niddm14 Non-insulin dependent diabetes mellitus QTL 14 4.5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 7 84257275 129257275 Rat 1357336 Gluco6 Glucose level QTL 6 3.4 blood glucose amount (VT:0000188) serum glucose level (CMO:0000543) 7 94811326 116294265 Rat 1357338 Stl17 Serum triglyceride level QTL 17 3.23 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 69736356 112729554 Rat 631687 Hcas1 Hepatocarcinoma susceptibility QTL 1 3.9 0.001 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 7 91412594 129807172 Rat 70159 Bp61 Blood pressure QTL 61 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 103146217 116738842 Rat 634331 Pia17 Pristane induced arthritis QTL 17 4.7 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 7 73829340 130221005 Rat 1358914 Bp266 Blood pressure QTL 266 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat 631504 Cm27 Cardiac mass QTL 27 3.45 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 7 44421311 118198041 Rat 634322 Bw12 Body weight QTL 12 0 body mass (VT:0001259) body weight (CMO:0000012) 7 83153392 128153392 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 1549899 Stresp8 Stress response QTL 8 4.37 0.0008 stress-related behavior trait (VT:0010451) defensive burying duration (CMO:0001961) 7 90482196 135012528 Rat 2317052 Aia17 Adjuvant induced arthritis QTL 17 2.13 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 7 81737938 126737938 Rat 731176 Glom5 Glomerulus QTL 5 2.5 0.0035 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 7 96670164 135012528 Rat 7411607 Foco15 Food consumption QTL 15 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 2306821 Bp335 Blood pressure QTL 335 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 106571501 135012528 Rat 631663 Bw6 Body weight QTL 6 3.4 body mass (VT:0001259) body weight (CMO:0000012) 7 111075573 134976056 Rat 1558655 Swd4 Spike wave discharge measurement QTL 4 3.68 0.0002 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge severity grade (CMO:0001988) 7 86983365 131983365 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 1331768 Kidm10 Kidney mass QTL 10 4.62096 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 80221299 125221299 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 2313102 Bmd79 Bone mineral density QTL 79 2.3 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 7 94811085 116738842 Rat 731174 Uae23 Urinary albumin excretion QTL 23 2.4 0.0042 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 7 104603555 135012528 Rat 2316947 Rf58 Renal function QTL 58 7.8 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 7 68938720 113886318 Rat 1331746 Kidm9 Kidney mass QTL 9 3.934 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 7 80221299 112308525 Rat 7411654 Foco25 Food consumption QTL 25 9.3 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 2316955 Stl24 Serum triglyceride level QTL 24 7.1 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 7 68938720 113886318 Rat 2299163 Iddm34 Insulin dependent diabetes mellitus QTL 34 2.71 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 7 91281130 135012528 Rat 2316952 Pur22 Proteinuria QTL 22 5.2 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 7 68938720 113886318 Rat 631540 Bw9 Body weight QTL 9 4.5 body mass (VT:0001259) body weight (CMO:0000012) 7 69736226 117455174 Rat 1358891 Bp265 Blood pressure QTL 265 2.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000022631 ⟹ ENSRNOP00000022631
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 111,460,656 - 111,477,973 (-) Ensembl Rnor_6.0 Ensembl 7 121,136,067 - 121,153,383 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000077731 ⟹ ENSRNOP00000074584
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 111,461,688 - 111,477,973 (-) Ensembl Rnor_6.0 Ensembl 7 121,136,058 - 121,153,231 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000115396 ⟹ ENSRNOP00000076579
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 111,463,166 - 111,477,973 (-) Ensembl
RefSeq Acc Id:
NM_199117 ⟹ NP_954548
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 113,341,030 - 113,358,346 (-) NCBI mRatBN7.2 7 111,460,656 - 111,477,973 (-) NCBI Rnor_6.0 7 121,136,067 - 121,153,383 (-) NCBI Rnor_5.0 7 121,126,405 - 121,144,401 (-) NCBI RGSC_v3.4 7 118,148,413 - 118,165,701 (-) RGD Celera 7 107,790,484 - 107,807,779 (-) NCBI
Sequence:
GCGCTGGGGAAAACGTTGCGCAGGTTCAAAAATGGAACGTCGGCGGCGTGAGGGAGCACTAGAAGGTGTGCGCGCGTGCGCGTGCGCGCCCGGACGAGCCTGACGGGGTCCCCGCCGTCCCGAGCATC
hide sequence
RefSeq Acc Id:
XM_006242020 ⟹ XP_006242082
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 113,341,030 - 113,358,716 (-) NCBI mRatBN7.2 7 111,460,656 - 111,478,046 (-) NCBI Rnor_6.0 7 121,136,067 - 121,153,489 (-) NCBI Rnor_5.0 7 121,126,405 - 121,144,401 (-) NCBI
Sequence:
GCAGGCGGGGTTAAGGAGAGGGGCGTGGCTCCGGCAGCGAGGGGGCGGAGCTGACCCTCTGGGCGCTCTCAGAAGCACGCGCGCGCGCGCGCGCACCCGCTCTCTGGCGCTGGGGAAAACGTTGCGCA
hide sequence
RefSeq Acc Id:
XM_006242021 ⟹ XP_006242083
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 113,343,133 - 113,358,716 (-) NCBI mRatBN7.2 7 111,462,756 - 111,478,053 (-) NCBI Rnor_6.0 7 121,138,216 - 121,153,490 (-) NCBI Rnor_5.0 7 121,126,405 - 121,144,401 (-) NCBI
Sequence:
AGCAGGCGGGGTTAAGGAGAGGGGCGTGGCTCCGGCAGCGAGGGGGCGGAGCTGACCCTCTGGGCGCTCTCAGAAGCACGCGCGCGCGCGCGCGCACCCGCTCTCTGGCGCTGGGGAAAACGTTGCGC
hide sequence
RefSeq Acc Id:
XM_006242022 ⟹ XP_006242084
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 113,341,030 - 113,358,716 (-) NCBI mRatBN7.2 7 111,462,754 - 111,479,231 (-) NCBI Rnor_6.0 7 121,138,485 - 121,153,503 (-) NCBI Rnor_5.0 7 121,126,405 - 121,144,401 (-) NCBI
Sequence:
GCCCAATTTGGCCAGCAGGCGGGGTTAAGGAGAGGGGCGTGGCTCCGGCAGCGAGGGGGCGGAG
hide sequence
RefSeq Acc Id:
XM_039079590 ⟹ XP_038935518
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 113,341,030 - 113,358,025 (-) NCBI mRatBN7.2 7 111,460,656 - 111,477,674 (-) NCBI
RefSeq Acc Id:
XM_039079591 ⟹ XP_038935519
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 113,341,030 - 113,358,716 (-) NCBI mRatBN7.2 7 111,460,656 - 111,478,036 (-) NCBI
RefSeq Acc Id:
XM_039079592 ⟹ XP_038935520
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 113,341,030 - 113,358,716 (-) NCBI mRatBN7.2 7 111,462,754 - 111,478,036 (-) NCBI
RefSeq Acc Id:
XM_039079593 ⟹ XP_038935521
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 113,341,030 - 113,358,716 (-) NCBI mRatBN7.2 7 111,460,656 - 111,478,034 (-) NCBI
RefSeq Acc Id:
XM_063263925 ⟹ XP_063119995
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 113,341,030 - 113,356,299 (-) NCBI
RefSeq Acc Id:
NP_954548 ⟸ NM_199117
- UniProtKB:
P60889 (UniProtKB/Swiss-Prot), A6HSV0 (UniProtKB/TrEMBL)
- Sequence:
MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEEKDRASGYRKRGPKPKRLLLQESAAPDVLQATGDWEPVEQPPEEEAEADLTNGPPPWTPMLPSSEVT
hide sequence
RefSeq Acc Id:
XP_006242082 ⟸ XM_006242020
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2QCQ7 (UniProtKB/TrEMBL), A6HSV1 (UniProtKB/TrEMBL)
- Sequence:
MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEEKD
hide sequence
RefSeq Acc Id:
XP_006242083 ⟸ XM_006242021
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2QCQ7 (UniProtKB/TrEMBL), A6HSV1 (UniProtKB/TrEMBL)
- Sequence:
MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEEKD
hide sequence
RefSeq Acc Id:
XP_006242084 ⟸ XM_006242022
- Peptide Label:
isoform X2
- Sequence:
MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEEKD
hide sequence
Ensembl Acc Id:
ENSRNOP00000074584 ⟸ ENSRNOT00000077731
Ensembl Acc Id:
ENSRNOP00000022631 ⟸ ENSRNOT00000022631
RefSeq Acc Id:
XP_038935519 ⟸ XM_039079591
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_038935521 ⟸ XM_039079593
- Peptide Label:
isoform X7
- UniProtKB:
A0A8L2UR72 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038935518 ⟸ XM_039079590
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_038935520 ⟸ XM_039079592
- Peptide Label:
isoform X6
Ensembl Acc Id:
ENSRNOP00000076579 ⟸ ENSRNOT00000115396
RefSeq Acc Id:
XP_063119995 ⟸ XM_063263925
- Peptide Label:
isoform X5
RGD ID: 13695491 Promoter ID: EPDNEW_R6016 Type: single initiation site Name: Cbx7_1 Description: chromobox 7 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 121,153,391 - 121,153,451 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-12-02
Cbx7
chromobox 7
Cbx7
chromobox homolog 7
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Cbx7
chromobox homolog 7
chromobox 7
Name updated
1299863 APPROVED
