Advanced Search (OLGA)

Gene: Cxcl11 (C-X-C motif chemokine ligand 11) Rattus norvegicus

Analyze

Symbol:

Cxcl11

Name:

C-X-C motif chemokine ligand 11

RGD ID:

727827

Description:

Enables chemokine activity. Involved in immune response. Predicted to be located in extracellular space and membrane. Biomarker of interstitial cystitis. Orthologous to human CXCL11 (C-X-C motif chemokine ligand 11); PARTICIPATES IN chemokine mediated signaling pathway; cytokine mediated signaling pathway; Toll-like receptor signaling pathway; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

C-X-C motif chemokine 11; chemokine (C-X-C motif) ligand 11; SCYB11

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	15,973,728 - 15,976,503 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	14	15,973,720 - 15,976,567 (+)	Ensembl				GRCr8
mRatBN7.2	14	15,689,432 - 15,692,207 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	15,689,424 - 15,692,271 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	14	15,697,639 - 15,700,419 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	17,016,484 - 17,019,264 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	15,711,911 - 15,714,691 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	17,195,395 - 17,198,170 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	17,195,014 - 17,198,291 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	14	17,111,527 - 17,114,302 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	14	17,250,648 - 17,253,423 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	14	15,083,879 - 15,086,654 (+)	NCBI		Celera
RGSC_v3.1	14	17,250,647 - 17,253,423 (+)	NCBI
Cytogenetic Map	14	p22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

bacterial pneumonia (ISO)

bronchiolitis obliterans (ISO)

celiac disease (ISO)

chronic obstructive pulmonary disease (ISO)

COVID-19 (ISO)

extrinsic allergic alveolitis (ISO)

graft-versus-host disease (ISO)

hepatocellular carcinoma (ISO)

inhalation anthrax (ISO)

interstitial cystitis (IEP,ISO)

pancreatic ductal carcinoma (ISO)

pulmonary sarcoidosis (ISO)

severe acute respiratory syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(-)-demecolcine (ISO)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

1-nitropyrene (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-dinitrotoluene (EXP)

2-amino-2-deoxy-D-glucopyranose (EXP)

22-Hydroxycholesterol (ISO)

3,3',4,4',5-pentachlorobiphenyl (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4-(ethoxymethylene)-2-phenyloxazol-5-one (EXP)

4-nitroquinoline N-oxide (ISO)

aflatoxin B1 (ISO)

aldehydo-D-glucosamine (EXP)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

antirheumatic drug (ISO)

arsenous acid (ISO)

asperentin (ISO)

benzo[a]pyrene (ISO)

beta-D-glucosamine (EXP)

beta-naphthoflavone (EXP,ISO)

bilirubin IXalpha (ISO)

biotin (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP)

bisphenol F (ISO)

buspirone (EXP)

cadmium dichloride (EXP,ISO)

calcitriol (ISO)

cannabidiol (ISO)

carbon monoxide (ISO)

carbon nanotube (ISO)

chenodeoxycholic acid (ISO)

chondroitin sulfate (ISO)

cisplatin (EXP,ISO)

cobalt atom (ISO)

cobalt dichloride (EXP)

cyclophosphamide (ISO)

deoxycholic acid (ISO)

deoxynivalenol (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

doxorubicin (ISO)

endosulfan (EXP)

erlotinib hydrochloride (ISO)

ethyl methanesulfonate (ISO)

fentanyl (EXP)

folic acid (ISO)

formaldehyde (ISO)

fragrance (ISO)

fulvestrant (ISO)

fumonisin B1 (ISO)

furan (EXP)

gadodiamide hydrate (ISO)

gemcitabine (ISO)

gentamycin (EXP)

glycochenodeoxycholic acid (ISO)

glycocholic acid (ISO)

glycodeoxycholic acid (ISO)

graphene oxide (ISO)

irinotecan (EXP)

iron(2+) sulfate (anhydrous) (ISO)

lipopolysaccharide (ISO)

malathion (ISO)

methotrexate (ISO)

Moniliformin (ISO)

Muraglitazar (EXP)

mycotoxin (ISO)

N-nitrosodiethylamine (EXP)

N-Nitrosopyrrolidine (ISO)

nickel atom (ISO)

nickel dichloride (EXP,ISO)

nimesulide (ISO)

okadaic acid (ISO)

oxaliplatin (EXP)

ozone (ISO)

paraquat (ISO)

perfluorooctanoic acid (EXP)

phenylephrine (EXP)

pirinixic acid (ISO)

potassium dichromate (ISO)

progesterone (ISO)

rotenone (EXP)

ruxolitinib (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

silicon dioxide (EXP,ISO)

sodium arsenite (ISO)

sotorasib (ISO)

sterigmatocystin (ISO)

succimer (ISO)

sulfur dioxide (ISO)

tacrolimus hydrate (ISO)

taurocholic acid (ISO)

Tesaglitazar (EXP)

testosterone (ISO)

tetrachloromethane (EXP)

thioacetamide (EXP)

titanium dioxide (EXP,ISO)

TMC-120A (ISO)

tofacitinib (ISO)

topotecan (EXP)

trichloroethene (EXP)

triclosan (ISO)

trimellitic anhydride (EXP)

triphenyl phosphate (EXP)

Triptolide (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vincristine (ISO)

zinc atom (ISO)

zinc dichloride (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-activating G protein-coupled receptor signaling pathway (IEA,ISO)

antimicrobial humoral immune response mediated by antimicrobial peptide (ISO)

chemokine-mediated signaling pathway (IEA,ISO)

chemotaxis (IEA,ISO)

defense response (IEA)

immune response (IEA,IMP)

positive regulation of release of sequestered calcium ion into cytosol (IEA,ISO)

regulation of cell population proliferation (IEA,ISO)

response to lipid (IEA)

T cell chemotaxis (IEA,ISO)

Cellular Component

extracellular region (IEA)

extracellular space (IEA)

membrane (IEA,ISO)

Molecular Function

chemokine activity (IEA,IMP,ISO)

chemokine receptor binding (TAS)

CXCR chemokine receptor binding (IEA,ISO)

CXCR3 chemokine receptor binding (IEA,ISO)

cytokine activity (IEA)

heparin binding (IEA,ISO)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

chemokine mediated signaling pathway (IEA)

cytokine mediated signaling pathway (IEA)

Toll-like receptor signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Critical role for CXCR3 chemokine biology in the pathogenesis of bronchiolitis obliterans syndrome.	Belperio JA, etal., J Immunol. 2002 Jul 15;169(2):1037-49.
2.	CXCR3 and CCR5 chemokines in induced sputum from patients with COPD.	Costa C, etal., Chest. 2008 Jan;133(1):26-33. Epub 2007 Oct 9.
3.	Interferon-inducible CXC chemokines directly contribute to host defense against inhalational anthrax in a murine model of infection.	Crawford MA, etal., PLoS Pathog. 2010 Nov 18;6(11):e1001199.
4.	Hepatocyte-Specific Arid1a Deficiency Initiates Mouse Steatohepatitis and Hepatocellular Carcinoma.	Fang JZ, etal., PLoS One. 2015 Nov 16;10(11):e0143042. doi: 10.1371/journal.pone.0143042. eCollection 2015.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	A SARS-CoV-2 Infection Model in Mice Demonstrates Protection by Neutralizing Antibodies.	Hassan AO, etal., Cell. 2020 Jun 10. pii: S0092-8674(20)30742-X. doi: 10.1016/j.cell.2020.06.011.
7.	Elucidation of the pathophysiology of interstitial cystitis/bladder pain syndrome via experimental autoimmune cystitis rat model.	Kadekawa K, etal., Am J Physiol Regul Integr Comp Physiol. 2024 Aug 1;327(2):R250-R260. doi: 10.1152/ajpregu.00269.2023. Epub 2024 Jun 6.
8.	Lymphoid follicle cells in chronic obstructive pulmonary disease overexpress the chemokine receptor CXCR3.	Kelsen SG, etal., Am J Respir Crit Care Med. 2009 May 1;179(9):799-805. Epub 2009 Feb 12.
9.	Expression of rat I-TAC/CXCL11/SCYA11 during central nervous system inflammation: comparison with other CXCR3 ligands.	McColl SR, etal., Lab Invest 2004 Nov;84(11):1418-29.
10.	Chemokine production during hypersensitivity pneumonitis.	Nance S, etal., Eur J Immunol. 2004 Mar;34(3):677-85.
11.	NCBI rat LocusLink and RefSeq merged data October 15, 2003	NCBI rat LocusLink and RefSeq merged data October 15, 2003
12.	CXCL9 and 11 in patients with pulmonary sarcoidosis: a role of alveolar macrophages.	Nishioka Y, etal., Clin Exp Immunol. 2007 Aug;149(2):317-26. Epub 2007 Jun 5.
13.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
14.	GOA pipeline	RGD automated data pipeline
15.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
16.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
17.	CXCR3 and its ligands participate in the host response to Bordetella bronchiseptica infection of the mouse respiratory tract but are not required for clearance of bacteria from the lung.	Widney DP, etal., Infect Immun. 2005 Jan;73(1):485-93.

Additional References at PubMed

PMID:12477932	PMID:12782716	PMID:12949249	PMID:17264982	PMID:18645041

Genomics

Comparative Map Data

Cxcl11
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	15,973,728 - 15,976,503 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	14	15,973,720 - 15,976,567 (+)	Ensembl				GRCr8
mRatBN7.2	14	15,689,432 - 15,692,207 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	15,689,424 - 15,692,271 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	14	15,697,639 - 15,700,419 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	17,016,484 - 17,019,264 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	15,711,911 - 15,714,691 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	17,195,395 - 17,198,170 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	17,195,014 - 17,198,291 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	14	17,111,527 - 17,114,302 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	14	17,250,648 - 17,253,423 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	14	15,083,879 - 15,086,654 (+)	NCBI		Celera
RGSC_v3.1	14	17,250,647 - 17,253,423 (+)	NCBI
Cytogenetic Map	14	p22	NCBI

CXCL11
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	76,033,682 - 76,036,070 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	76,033,682 - 76,041,415 (-)	Ensembl			hg38	GRCh38
GRCh37	4	76,954,835 - 76,957,223 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	77,173,859 - 77,176,257 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	4	77,312,020 - 77,314,412	NCBI
Celera	4	74,255,322 - 74,257,722 (-)	NCBI		Celera
Cytogenetic Map	4	q21.1	NCBI
HuRef	4	72,707,280 - 72,709,795 (-)	NCBI		HuRef
CHM1_1	4	76,931,383 - 76,933,900 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	79,374,343 - 79,376,731 (-)	NCBI		T2T-CHM13v2.0

Cxcl11
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	92,507,403 - 92,511,155 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	92,507,403 - 92,513,344 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	92,359,544 - 92,363,296 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	92,359,544 - 92,365,485 (-)	Ensembl			mm10	GRCm38
MGSCv37	5	92,788,570 - 92,792,303 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	93,434,744 - 93,438,477 (-)	NCBI		MGSCv36	mm8
Celera	5	90,503,193 - 90,506,930 (-)	NCBI		Celera
Cytogenetic Map	5	E2	NCBI
cM Map	5	46.61	NCBI

Cxcl11
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955433	766,272 - 771,231 (-)	Ensembl
ChiLan1.0	NW_004955433	769,449 - 771,137 (-)	NCBI	ChiLan1.0	ChiLan1.0

CXCL11
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	54,037,310 - 54,039,639 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	54,227,065 - 54,229,394 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	48,169,954 - 48,172,455 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	54,007,818 - 54,010,343 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	54,007,818 - 54,010,336 (+)	Ensembl			panPan2	panpan1.1

CXCL11
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	32	631,084 - 636,997 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	32	631,478 - 632,868 (-)	Ensembl			canFam3	CanFam3.1
CanFam3.1 Ensembl	32	631,478 - 632,868 (-)	NCBI			canFam3	CanFam3.1
ROS_Cfam_1.0	32	655,797 - 662,280 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
UMICH_Zoey_3.1	32	655,531 - 661,573 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	32	609,837 - 615,880 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	32	39,553,718 - 39,589,852 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Cxcl11
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405285	11,433,511 - 11,435,471 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936676	71,667 - 73,738 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936676	72,383 - 73,697 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CXCL11
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	71,713,803 - 71,725,674 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	8	71,713,790 - 71,725,669 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	75,909,581 - 75,921,427 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CXCL11
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	24,540,401 - 24,543,456 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	7	24,541,767 - 24,542,832 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666037	2,882,698 - 2,885,219 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cxcl11
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624757	14,952,851 - 14,954,905 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624757	14,952,966 - 14,954,343 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Cxcl11
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	11	5,211,905 - 5,214,846 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Cxcl11
27 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	82
Count of miRNA genes:	72
Interacting mature miRNAs:	77
Transcripts:	ENSRNOT00000031667
Prediction methods:	Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300114	Srn2	Serum renin concentration QTL 2	3.27		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	14	3957878	21572472	Rat
2293089	Iddm31	Insulin dependent diabetes mellitus QTL 31	4.7		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	14	3957878	18558812	Rat
7411573	Bw139	Body weight QTL 139	4.7	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	14	1	40068101	Rat
9589814	Gluco67	Glucose level QTL 67	4.54	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	14	1	40068101	Rat
731183	Pia20	Pristane induced arthritis QTL 20	3.55		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	14	9393298	39411170	Rat
631212	Bw5	Body weight QTL5	5.43		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	14	11334906	30674469	Rat
2302277	Gluco38	Glucose level QTL 38	5.8		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11334716	28389666	Rat
1331740	Bw26	Body weight QTL 26	3.028		body mass (VT:0001259)	body weight (CMO:0000012)	14	3957878	31121464	Rat
71117	Niddm17	Non-insulin dependent diabetes mellitus QTL 17	2.35		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	14	1	17877928	Rat
1358296	Ael3	Aortic elastin QTL 3	3.7	0.00051	aorta elastin amount (VT:0003905)	aortic elastin	14	8621398	53621398	Rat
70195	Mcs8	Mammary carcinoma susceptibility QTL 8	4.28		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	14	3957878	24886169	Rat
631839	Niddm37	Non-insulin dependent diabetes mellitus QTL 37	3.37		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11334716	100078267	Rat
634352	Apr6	Acute phase response QTL 6	3.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	14	1	41415516	Rat
70204	Niddm20	Non-insulin dependent diabetes mellitus QTL 20	5.1	0.000008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	1	31893212	Rat
2302045	Pia39	Pristane induced arthritis QTL 39	4.9	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G2a level (CMO:0002116)	14	8621398	53621398	Rat
1300140	Srn3	Serum renin concentration QTL 3	3.19		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	14	15137594	31238250	Rat

Markers in Region

RH128858

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	15,691,988 - 15,692,208 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	17,197,952 - 17,198,171	NCBI	Rnor6.0
Rnor_5.0	14	17,114,084 - 17,114,303	UniSTS	Rnor5.0
RGSC_v3.4	14	17,253,205 - 17,253,424	UniSTS	RGSC3.4
Celera	14	15,086,436 - 15,086,655	UniSTS
RH 3.4 Map	14	164.4	UniSTS
Cytogenetic Map	14	p22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	11	64	118	91	90	59	54	59	6	305	146	7	97	76	79	31	9	9

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_182952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF537209	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY340181	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC168725	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474060	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000014	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000031667 ⟹ ENSRNOP00000035380

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	14	15,973,720 - 15,976,567 (+)	Ensembl
mRatBN7.2 Ensembl	14	15,689,424 - 15,692,271 (+)	Ensembl
Rnor_6.0 Ensembl	14	17,195,014 - 17,198,291 (+)	Ensembl

RefSeq Acc Id:

NM_182952 ⟹ NP_891997

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	15,973,728 - 15,976,503 (+)	NCBI
mRatBN7.2	14	15,689,432 - 15,692,207 (+)	NCBI
Rnor_6.0	14	17,195,395 - 17,198,170 (+)	NCBI
Rnor_5.0	14	17,111,527 - 17,114,302 (+)	NCBI
RGSC_v3.4	14	17,250,648 - 17,253,423 (+)	RGD
Celera	14	15,083,879 - 15,086,654 (+)	RGD

Sequence:

show sequence

TGCTGCTCTCTGCGAAGAAAGATCACCAGAGCCACAGCAGAGAGCTGCAGCTGCCGCTGAGATG
AACAGGACGGGCATGGCCGTAGCCCTGGCTATGATCATCTGGGCCACAACGGTTCCAGGCTTCG
TTATGTTCAAAGGGGGGCGCTGTCTTTGCATCGACCGCGGAGTGAAAGTGGTCAAAATGGCAGC
AATCAAGGAAGTTTCTGTAATTTACCCGAGTAACGGCTGTGACAAAGTTGAAGTGATTGTTACC
CTGAAGGCTCATAAAGGACAAAGGTGCCTGGACCCCACATCCAAGCAAGCTCGCCTCATAATGC
AGACAATACAAAAAAAGAATTTTTTAAGGCGCCAGAACATGTGATGGGCCCTCAAATTCGAGCT
CTGTGCCAAGAAGCTGACCCTCTCCTGTCTTGGAATATGCATCCGTTTTGCCAGATTGCAGAAC
TCGCTAGGAGGTCGGATACCTCTAAACTATTCTGCTTGGCTATGAAAATATTTATCTCGAAGAG
TCATGTGTCTCTGTGTGTGCACACTCCGAGTTATCGTCTATGGTTACAATGGACACATTGTTAC
TGGAATCCCGCCCGCCCGCTGGTTGGATTCAGAAGCATCTAGTGTAGAAAAACATTACTCAAGG
AATTTTTCATGGAAATAACATCCCTTTCCCCAAATAACACGAGGCACATGAACATCTAGGAAGA
AGATTCCACATATCATCTTGCTTGTACATTTAAAAAGATTTAGCATTCATGAGGTGCCCTGCAA
ACATTTCTACGCTGTAGAAACGAGTAAGAGAACACTACTGTTTCCTGAGTTAATCACACTGGCT
TCCCACTGAGGCAGTCTAAAGGGCTAAAGATGTGTATTTCCTGTACATCTGGCTTTATCTGTTT
TATCAGTGACAATAATCTGGATAGATTTTTAAAATAAATTGCTTTTGCTCACCAAAGAAAATGT
TGGAAAAAAAATCTATTCATCTCTTTGAGTCTGTTTTCCATTATTCTGCCTTTGAAAAAAATAT
GTAAATGTGTACTTGGTCCTTTCCTTTGTC

hide sequence

Protein Sequences


Protein RefSeqs	NP_891997	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI68725	(Get FASTA)	NCBI Sequence Viewer
	AAQ02665	(Get FASTA)	NCBI Sequence Viewer
	AAQ10776	(Get FASTA)	NCBI Sequence Viewer
	EDL88638	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000035380
	ENSRNOP00000035380.3

RefSeq Acc Id:	NP_891997 ⟸ NM_182952
- Peptide Label:	precursor
- UniProtKB:	Q7TNL0 (UniProtKB/TrEMBL), B5DEM2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MNRTGMAVALAMIIWATTVPGFVMFKGGRCLCIDRGVKVVKMAAIKEVSVIYPSNGCDKVEVIV TLKAHKGQRCLDPTSKQARLIMQTIQKKNFLRRQNM hide sequence

Ensembl Acc Id:

ENSRNOP00000035380 ⟸ ENSRNOT00000031667

Protein Domains

Chemokine interleukin-8-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q7TNL0-F1-model_v2	AlphaFold	Q7TNL0	1-100	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699210

Promoter ID:

EPDNEW_R9735

Type:

single initiation site

Name:

Cxcl11_1

Description:

C-X-C motif chemokine ligand 11

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	14	17,195,387 - 17,195,447	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:727827	AgrOrtholog
BioCyc Gene	G2FUF-16261	BioCyc
Ensembl Genes	ENSRNOG00000022298	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000031667	ENTREZGENE
	ENSRNOT00000031667.6	UniProtKB/TrEMBL
Gene3D-CATH	2.40.50.40	UniProtKB/TrEMBL
InterPro	Chemokine_b/g/d	UniProtKB/TrEMBL
	Chemokine_IL8	UniProtKB/TrEMBL
	CXC_Chemokine_domain	UniProtKB/TrEMBL
	CXC_chmkine_smll	UniProtKB/TrEMBL
	Interleukin_8-like_sf	UniProtKB/TrEMBL
	Small_chemokine_CXC_CS	UniProtKB/TrEMBL
KEGG Report	rno:305236	UniProtKB/TrEMBL
NCBI Gene	305236	ENTREZGENE
PANTHER	C-X-C MOTIF CHEMOKINE 11	UniProtKB/TrEMBL
	SMALL INDUCIBLE CYTOKINE A	UniProtKB/TrEMBL
Pfam	IL8	UniProtKB/TrEMBL
PhenoGen	Cxcl11	PhenoGen
PRINTS	INTERLEUKIN8	UniProtKB/TrEMBL
	SMALLCYTKCXC	UniProtKB/TrEMBL
PROSITE	SMALL_CYTOKINES_CXC	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000022298	RatGTEx
SMART	SCY	UniProtKB/TrEMBL
Superfamily-SCOP	Chemokine_IL8	UniProtKB/TrEMBL
UniProt	B5DEM2	ENTREZGENE, UniProtKB/TrEMBL
	Q7TNL0	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-08	Cxcl11	C-X-C motif chemokine ligand 11	Cxcl11	chemokine (C-X-C motif) ligand 11	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-07-08	Cxcl11	chemokine (C-X-C motif) ligand 11			Symbol and Name status set to approved	1299863	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)