Advanced Search (OLGA)

Gene: Gna12 (G protein subunit alpha 12) Rattus norvegicus

Analyze

Symbol:

Gna12

Name:

G protein subunit alpha 12

RGD ID:

71018

Description:

Enables D5 dopamine receptor binding activity. Involved in response to xenobiotic stimulus. Acts upstream of or within G protein-coupled receptor signaling pathway; negative regulation of vascular associated smooth muscle cell migration; and negative regulation of vascular associated smooth muscle cell proliferation. Located in brush border membrane. Orthologous to human GNA12 (G protein subunit alpha 12); PARTICIPATES IN eicosanoid signaling pathway; endothelin signaling pathway; sphingosine 1-phosphate signaling pathway; INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; 3H-1,2-dithiole-3-thione.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

g alpha-12; G-protein subunit alpha-12; guanine nucleotide binding protein (G protein) alpha 12; guanine nucleotide binding protein, alpha 12; guanine nucleotide-binding protein subunit alpha-12; heterotrimeric guanine nucleotide-binding protein 1m1; Hg1m1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GNA12 (G protein subunit alpha 12)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Gna12 (guanine nucleotide binding protein, alpha 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gna12 (G protein subunit alpha 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GNA12 (G protein subunit alpha 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GNA12 (G protein subunit alpha 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	LOC101967153 (guanine nucleotide-binding protein subunit alpha-12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GNA12 (G protein subunit alpha 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GNA12 (G protein subunit alpha 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gna12 (G protein subunit alpha 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Gna12 (G protein subunit alpha 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	GNA13 (G protein subunit alpha 13)	HGNC	OrthoDB
Homo sapiens (human):	FOXL3 (forkhead box L3)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	GNA12 (G protein subunit alpha 12)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gna12 (guanine nucleotide binding protein, alpha 12)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gna12a (guanine nucleotide binding protein (G protein) alpha 12a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	GPA1	Alliance	DIOPT (Ensembl Compara\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	gpa-12	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	cta	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	18,919,629 - 19,000,185 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	18,919,629 - 19,000,185 (+)	Ensembl				GRCr8
mRatBN7.2	12	13,805,580 - 13,886,255 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	13,805,698 - 13,886,255 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	14,613,893 - 14,694,474 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	15,237,164 - 15,317,743 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	14,264,094 - 14,344,680 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	12	20,394,399 - 20,474,988 (+)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	12	20,319,493 - 20,400,091 (+)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	12	19,179,433 - 19,260,039 (+)	NCBI		Lyon_Hypertensive
F344_StmMcwi	12	29,773,848 - 29,854,331 (+)	NCBI		F344_StmMcwi
Rnor_6.0	12	15,890,202 - 15,971,212 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	15,890,170 - 15,971,212 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	17,889,996 - 17,970,852 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	14,275,708 - 14,354,843 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	15,567,135 - 15,646,904 (+)	NCBI		Celera
RGSC_v3.1	12	14,305,635 - 14,384,771 (+)	NCBI
Cytogenetic Map	12	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Myocardial Ischemia (ISO)

ulcerative colitis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane (ISO)

1,1,1-trichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-methylcholine (ISO)

3,3',4,4'-tetrachlorobiphenyl (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3H-1,2-dithiole-3-thione (EXP)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acrolein (ISO)

acrylamide (ISO)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

ammonium chloride (EXP)

Azoxymethane (ISO)

benzatropine (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

Butylbenzyl phthalate (ISO)

C60 fullerene (EXP)

cadmium dichloride (ISO)

calcidiol (EXP)

carbamazepine (ISO)

CGP 52608 (ISO)

chlordecone (ISO)

chlorpyrifos (EXP)

clofibrate (ISO)

clozapine (EXP,ISO)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

Cuprizon (EXP,ISO)

decabromodiphenyl ether (EXP)

dexamethasone (ISO)

dextran sulfate (ISO)

diazinon (EXP)

Dibutyl phosphate (ISO)

dichloroacetic acid (ISO)

diethylstilbestrol (EXP)

doxorubicin (ISO)

epoxiconazole (ISO)

ethanol (EXP,ISO)

finasteride (EXP)

fipronil (EXP)

flavonoids (EXP)

fluoxetine (EXP)

folic acid (ISO)

gamma-hexachlorocyclohexane (EXP)

genistein (EXP)

glyphosate (ISO)

GSK-J4 (ISO)

haloperidol (EXP)

hydrogen cyanide (ISO)

indometacin (ISO)

inulin (ISO)

methoxychlor (EXP)

methyl methanesulfonate (ISO)

nitrates (ISO)

okadaic acid (ISO)

ozone (EXP,ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

potassium cyanide (ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium arsenite (EXP)

sunitinib (ISO)

titanium dioxide (ISO)

triphenyl phosphate (EXP,ISO)

troglitazone (ISO)

tungsten (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-modulating G protein-coupled receptor signaling pathway (IBA)

cell differentiation (ISO)

embryonic digit morphogenesis (ISO)

G protein-coupled dopamine receptor signaling pathway (TAS)

G protein-coupled receptor signaling pathway (IEA,IMP)

in utero embryonic development (ISO)

intracellular signal transduction (ISO)

negative regulation of vascular associated smooth muscle cell migration (IEA,IMP)

negative regulation of vascular associated smooth muscle cell proliferation (IEA,IMP)

regulation of blood pressure (IEA,ISO)

regulation of cell shape (ISO)

regulation of fibroblast migration (IEA,ISO,ISS)

regulation of proteasomal ubiquitin-dependent protein catabolic process (IEA,ISO,ISS)

regulation of TOR signaling (IEA,ISO,ISS)

response to xenobiotic stimulus (IEP)

Rho protein signal transduction (IBA,IEA,ISO)

Rho-activating G protein-coupled receptor signaling pathway (IEA,ISO,ISS)

signal transduction (IEA)

Cellular Component

brush border membrane (IBA,IDA,IEA)

cytoplasm (IBA,IEA)

cytosol (IEA,ISO)

heterotrimeric G-protein complex (IBA,TAS)

lateral plasma membrane (IEA,ISO)

neuron projection (IEA,ISO)

neuronal cell body (IEA,ISO)

plasma membrane (IEA)

Molecular Function

D5 dopamine receptor binding (IBA,IEA,IPI)

G protein activity (IEA,ISO,ISS)

G protein-coupled receptor binding (IEA)

G-protein beta/gamma-subunit complex binding (IBA,IEA)

GTP binding (IEA)

GTPase activity (IBA,IEA)

guanyl nucleotide binding (IEA)

metal ion binding (IEA)

nucleotide binding (IEA)

protein binding (ISO)

protein phosphatase 2A binding (IEA,ISO)

protein phosphatase activator activity (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

eicosanoid signaling pathway (ISO)

endothelin signaling pathway (ISO)

long term depression (IEA)

mitogen activated protein kinase signaling pathway (IEA)

sphingosine 1-phosphate signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
6.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
7.	GOA pipeline	RGD automated data pipeline
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Novel Adipokine, FAM19A5, Inhibits Neointima Formation After Injury Through Sphingosine-1-Phosphate Receptor 2.	Wang Y, etal., Circulation. 2018 Jul 3;138(1):48-63. doi: 10.1161/CIRCULATIONAHA.117.032398. Epub 2018 Feb 16.
10.	Galpha12- and Galpha13-protein subunit linkage of D5 dopamine receptors in the nephron.	Zheng S, etal., Hypertension 2003 Mar;41(3):604-10.

Additional References at PubMed

PMID:9305907	PMID:10037795	PMID:12077299	PMID:15525651	PMID:15826947	PMID:17533154	PMID:18155002	PMID:18480127	PMID:19043202	PMID:19095998	PMID:21423176	PMID:21633357
PMID:22609986	PMID:25989500

Genomics

Comparative Map Data

Gna12
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	18,919,629 - 19,000,185 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	18,919,629 - 19,000,185 (+)	Ensembl				GRCr8
mRatBN7.2	12	13,805,580 - 13,886,255 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	13,805,698 - 13,886,255 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	14,613,893 - 14,694,474 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	15,237,164 - 15,317,743 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	14,264,094 - 14,344,680 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	12	20,394,399 - 20,474,988 (+)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	12	20,319,493 - 20,400,091 (+)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	12	19,179,433 - 19,260,039 (+)	NCBI		Lyon_Hypertensive
F344_StmMcwi	12	29,773,848 - 29,854,331 (+)	NCBI		F344_StmMcwi
Rnor_6.0	12	15,890,202 - 15,971,212 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	15,890,170 - 15,971,212 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	17,889,996 - 17,970,852 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	14,275,708 - 14,354,843 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	15,567,135 - 15,646,904 (+)	NCBI		Celera
RGSC_v3.1	12	14,305,635 - 14,384,771 (+)	NCBI
Cytogenetic Map	12	q11	NCBI

GNA12
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	2,728,105 - 2,844,308 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	2,721,822 - 2,870,786 (-)	Ensembl			hg38	GRCh38
GRCh37	7	2,767,739 - 2,883,942 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	2,734,265 - 2,850,485 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	7	2,540,980 - 2,657,200	NCBI
Celera	7	2,736,337 - 2,852,578 (-)	NCBI		Celera
Cytogenetic Map	7	p22.3-p22.2	NCBI
HuRef	7	2,686,290 - 2,802,582 (-)	NCBI		HuRef
CHM1_1	7	2,767,404 - 2,883,659 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	2,841,649 - 2,957,882 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	2,815,641 - 2,931,835 (-)	NCBI

Gna12
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	140,745,699 - 140,816,186 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	140,744,163 - 140,816,186 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	140,759,944 - 140,830,431 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	140,758,408 - 140,830,431 (-)	Ensembl			mm10	GRCm38
MGSCv37	5	141,235,898 - 141,306,385 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	141,012,418 - 141,082,905 (-)	NCBI		MGSCv36	mm8
Celera	5	137,821,586 - 137,847,268 (-)	NCBI		Celera
Cytogenetic Map	5	G2	NCBI
cM Map	5	79.3	NCBI

Gna12
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955460	12,534,168 - 12,622,537 (+)	Ensembl
ChiLan1.0	NW_004955460	12,534,210 - 12,628,090 (+)	NCBI	ChiLan1.0	ChiLan1.0

GNA12
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	7,686,160 - 7,801,169 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	56,010,860 - 56,125,869 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	2,989,832 - 3,104,848 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	3,081,004 - 3,147,356 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2

GNA12
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	14,375,144 - 14,476,018 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	14,413,576 - 14,473,764 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	15,830,291 - 15,937,728 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	14,493,454 - 14,600,978 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	14,493,362 - 14,600,974 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	14,298,807 - 14,406,220 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	14,226,168 - 14,333,618 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	14,511,840 - 14,619,319 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

LOC101967153
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	142,508,304 - 142,603,457 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936823	447,917 - 543,140 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936823	447,979 - 543,134 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GNA12
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	2,004,471 - 2,105,952 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	3	2,002,494 - 2,105,937 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	1,963,865 - 2,020,488 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GNA12
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	28	18,778,768 - 18,890,420 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	28	18,778,847 - 18,888,922 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666090	2,884,815 - 2,998,712 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gna12
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624740	30,133,435 - 30,245,079 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624740	30,134,262 - 30,245,079 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Gna12
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	16	12,372,264 - 12,451,392 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Gna12
606 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	582
Count of miRNA genes:	287
Interacting mature miRNAs:	352
Transcripts:	ENSRNOT00000001654
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312418	Kidm41	Kidney mass QTL 41	3.7	0.0001	kidney mass (VT:0002707)	single kidney wet weight to body weight ratio (CMO:0000622)	12	5921918	25247790	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	11200494	52308831	Rat
2306789	Ean6	Experimental allergic neuritis QTL 6	4.9		nervous system integrity trait (VT:0010566)	experimental autoimmune neuritis severity score (CMO:0001528)	12	1	29775522	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	3489416	48489416	Rat
1331739	Hrtrt14	Heart rate QTL 14	3.56232		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	12	1	38687564	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	18473041	52308831	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200497	52308831	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	15264248	52308831	Rat
61331	Eau2	Experimental allergic uveoretinitis QTL 2		0.0005	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	12	1	33700600	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	11743528	52308831	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
2293684	Bmd26	Bone mineral density QTL 26	4.4	0.0002	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	12	1	38635130	Rat
6893681	Bw109	Body weight QTL 109	2.3	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	12	1	28133365	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	12233000	30490641	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	17464979	46784661	Rat
1300174	Bw15	Body weight QTL 15	2.93		body mass (VT:0001259)	body weight loss (CMO:0001399)	12	1	28606299	Rat
1331786	Kidm11	Kidney mass QTL 11	3.571		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	12	16187438	52308831	Rat
1331787	Rf41	Renal function QTL 41	2.998		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	12	1	33700556	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	16135029	52308831	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	16187438	51213550	Rat
1331763	Wbc2	White blood cell count QTL 2	3.162		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	12	11200494	52308831	Rat
61416	Pia4	Pristane induced arthritis QTL 4	8.4		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	12	18749469	36488809	Rat
7204484	Bp358	Blood pressure QTL 358		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	1	24849755	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	11200494	52308831	Rat
7387292	Kidm42	Kidney mass QTL 42	3.03	0.0004	kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	12	1	41361854	Rat
61421	Cia12	Collagen induced arthritis QTL 12	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	18749469	34312613	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	2747694	47747694	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	18473041	52308831	Rat
2303568	Bw88	Body weight QTL 88	3		body mass (VT:0001259)	body weight (CMO:0000012)	12	1	28606299	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	3087180	48087180	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7243862	Mcs30	Mammary carcinoma susceptibility QTL 30	8.62		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	12	5633306	50633306	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	16135029	52308831	Rat
2293086	Iddm30	Insulin dependent diabetes mellitus QTL 30	3.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	7901625	33938215	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
1331755	Bp219	Blood pressure QTL 219	3.041		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	16187438	33700556	Rat

Markers in Region

RH128312

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	13,885,851 - 13,886,037 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	15,970,809 - 15,970,994	NCBI	Rnor6.0
Rnor_5.0	12	17,970,449 - 17,970,634	UniSTS	Rnor5.0
RGSC_v3.4	12	14,356,391 - 14,356,576	UniSTS	RGSC3.4
Celera	12	15,646,501 - 15,646,686	UniSTS
RH 3.4 Map	12	177.4	UniSTS
Cytogenetic Map	12	q11	UniSTS

RH144209

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	13,883,483 - 13,883,584 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	15,968,441 - 15,968,541	NCBI	Rnor6.0
Rnor_5.0	12	17,968,081 - 17,968,181	UniSTS	Rnor5.0
RGSC_v3.4	12	14,354,023 - 14,354,123	UniSTS	RGSC3.4
Celera	12	15,644,133 - 15,644,233	UniSTS
RH 3.4 Map	12	177.6	UniSTS
Cytogenetic Map	12	q11	UniSTS

BE097282

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	13,875,365 - 13,875,546 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	15,960,325 - 15,960,505	NCBI	Rnor6.0
Rnor_5.0	12	17,959,963 - 17,960,143	UniSTS	Rnor5.0
RGSC_v3.4	12	14,345,973 - 14,346,153	UniSTS	RGSC3.4
Celera	12	15,636,104 - 15,636,284	UniSTS
RH 3.4 Map	12	176.8	UniSTS
Cytogenetic Map	12	q11	UniSTS

RH138328

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	13,886,570 - 13,886,710 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	15,971,528 - 15,971,667	NCBI	Rnor6.0
Rnor_5.0	12	17,971,168 - 17,971,307	UniSTS	Rnor5.0
RGSC_v3.4	12	14,357,110 - 14,357,249	UniSTS	RGSC3.4
Celera	12	15,647,220 - 15,647,359	UniSTS
RH 3.4 Map	12	177.4	UniSTS
Cytogenetic Map	12	q11	UniSTS

RH141162

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	13,882,777 - 13,882,963 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	15,967,735 - 15,967,920	NCBI	Rnor6.0
Rnor_5.0	12	17,967,375 - 17,967,560	UniSTS	Rnor5.0
RGSC_v3.4	12	14,353,317 - 14,353,502	UniSTS	RGSC3.4
Celera	12	15,643,427 - 15,643,612	UniSTS
RH 3.4 Map	12	202.4	UniSTS
Cytogenetic Map	12	q11	UniSTS

OMY6173INRA

Rat Assembly	Chr	Position (strand)	Source
Celera	4	89,392,817 - 89,393,473	UniSTS
Celera	12	15,573,775 - 15,575,270	UniSTS
Cytogenetic Map	12	q11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031034	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC119536	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D85760	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ120479	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ120480	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	OU667100	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000001654 ⟹ ENSRNOP00000001654

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	18,919,629 - 19,000,185 (+)	Ensembl
mRatBN7.2 Ensembl	12	13,805,698 - 13,886,255 (+)	Ensembl
Rnor_6.0 Ensembl	12	15,890,170 - 15,971,212 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000093029

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	12	15,890,213 - 15,934,375 (+)	Ensembl

RefSeq Acc Id:

NM_031034 ⟹ NP_112296

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	18,919,629 - 19,000,185 (+)	NCBI
mRatBN7.2	12	13,805,698 - 13,886,255 (+)	NCBI
Dahl_SR_JrHsd	12	20,394,399 - 20,474,988 (+)	NCBI
Lyon_Normotensive	12	20,319,493 - 20,400,091 (+)	NCBI
Lyon_Hypertensive	12	19,179,433 - 19,260,039 (+)	NCBI
F344_StmMcwi	12	29,773,848 - 29,854,331 (+)	NCBI
Rnor_6.0	12	15,890,202 - 15,971,212 (+)	NCBI
Rnor_5.0	12	17,889,996 - 17,970,852 (+)	NCBI
RGSC_v3.4	12	14,275,708 - 14,354,843 (+)	RGD
Celera	12	15,567,135 - 15,646,904 (+)	NCBI

Sequence:

show sequence

CCGGCGGGGCGCGGCCGCGGCCTGAGGGCGGTCATGTCCGGGGTGGTGCGGACCCTCAGCCGCT
GCTTGCTGCCGGCCGAGGCCGGAGCCCGCGAGCGCAGGGCGGGCGCGGCGCGCGACGCGGAACG
CGAGGCCCGACGGCGCAGCCGCGACATCGACGCGCTGCTGGCCCGCGAGCGGCGCGCGGTGCGG
CGGCTGGTCAAGATCTTGCTGCTGGGCGCCGGCGAGAGCGGCAAGTCCACCTTCCTCAAGCAGA
TGCGCATCATCCACGGCCGGGAGTTCGACCAGAAGGCGCTGCTGGAGTTCCGCGACACCATCTT
CGACAACATCCTTAAGGGCTCGAGGGTGCTTGTAGACGCTCGGGACAAGCTTGGCATTCCCTGG
CAGCACTCTGAGAACGAGAAGCACGGGATGTTTCTGATGGCCTTCGAGAACAAGGCAGGGCTGC
CTGTGGAGCCTGCCACCTTCCAGCTCTACGTTCCAGCCCTGAGCGCACTCTGGAGAGACTCCGG
GATCAGGGAAGCCTTCAGCCGCAGAAGCGAGTTCCAGCTGGGTGAGTCAGTGAAGTACTTCCTG
GATAACTTAGACCGGATTGGCCAGCTGAACTACTTCCCCAGTAAGCAAGACATCCTGTTGGCTA
GAAAGGCCACCAAGGGAATCGTGGAGCATGACTTCGTGATAAAGAAAATCCCATTTAAGATGGT
GGATGTGGGCGGCCAGAGGTCGCAGCGCCAGAAGTGGTTCCAGTGCTTCGACGGGATCACATCG
ATCCTGTTCATGGTGTCCTCAAGCGAGTATGACCAGGTCCTCATGGAGGATAGGCGCACCAACC
GGCTGGTGGAGTCCATGAACATCTTCGAGACCATCGTCAACAACAAGCTCTTCTTCAACGTCTC
CATCATCCTCTTCCTCAACAAGATGGACCTGCTGGTGGAGAAGGTGAAGTCGGTGAGCATTAAG
AAGCACTTCCCAGACTTCAAGGGCGACCCGCACCGGCTGGAGGACGTCCAGCGCTACCTGGTCC
AGTGCTTTGACAGGAAGCGCAGGAACCGCGGCAAGCCTCTGTTCCACCACTTCACCACTGCCAT
AGACACCGAGAACATCCGCTTCGTGTTTCATGCCGTGAAGGACACCATCCTGCAGGAGAACCTG
AAAGATATCATGCTGCAGTGAGACAGCCCCTCTGCCGTCCTCTCGTGGCCTCCGTGGCCTGTGG
CCACATGTCTCTGGTGTGTCTGCCACCTGCATGGACCTGCAGTGGGCATCTCGAAGCCACACCA
TCTAATACCTGGCTCAAGAATGCTGGACTGTCAGCCACACCAGCGAGCTGCGGGCAAGAGGACG
TGGGAGTGTCAGTGATAGCTACTGAATCGGGGACTGAAACTACTGAATCCACGCCATCGCTCTG
GTGTTGATCTGTAAAACCTGGGAACACAGCTTTCTCCCTCCCTACAGAAACTCTTCCTTGCTGA
CACGACTTAACCAAGGTTCAGGTGTGCACAGACACACATGCTCTCATTAATGACAGAAACACAA
CCCCAGCTGGCCTTACAGACAGCTCTTCCCTCTGACTCGCAGGTTCTCACGGAGACACACTAAC
TCGGAAGCTTAGCCTCACGGTAGGCTGTAGAGGGCATGCGCTGCTGCTAAGCTCAGAGTGGCTC
AGCCGCAGTGCCACCTCCCAAAGTGAACACACTGCCTTTAAAATTGTGCCAATACCCTCCGAGT
CCCCACTCTGAGGCACGTCAGGGCCAGCAAAGAAGCCAAGTCAGGTGTCCACACTCCCGACTAG
AGAACAAGGTGGGAGCTGTGAAGCTGCCTCACCGCCCCAGGAGCCACTTACCGTGTCTCCATGC
CCAGTGGGCCGGCCGCAGTGTGGAAGGTGACCTCTGAAGCAGCTCTGGCAGCCTGTGCACACAG
TGGTGCTCTACTTCCCCAGCCTCCACAGCCCATGGCAAAGACACACAACCAAGTGGCCTTGTAG
TTTGCCTTACTTGACAGTTGTGGCATGTAGCATCCCCTGTCCTGGGCTCTGAAAGTGGGCCCAA
GACACTCTGCAGCTGTAGAGCGTCTTCATGTCTTGGCTGCTGGACGGGCCCCAGCCACTGGCCC
TTTAGGAGAAGCCCTGGGGTCTGCACACCGCCCTCACCATTGCCTTCACACAGTGCACTCTGCT
CTCAGAGTGGCTGGCAGGCCGCATTCTGTCGCTGTGCACATAAAGTCAGTCAGCACCCTCCTAG
CCCTGGTCCATGAGGGTGCAGAAGGCTGGGGACATCAGCACAACCTGCTAAGCCTCGCCTCCTT
GGCAGGTGTCACTGTTTTACAATACGTTGCATTCCAGACCTGCCTCTGTCACTGATTGCTTTCT
GGGAGCGGGGGTGTGGCTTATAACTTCCCCAGAGTGTTGTTTTGGTTCACTAACATATCCAAGG
GCCCTGTCTGCAACTGAACTACTCCTGACACTTGATCCCTGTTGCATCCTTGTCTTGGCTCATT
TCAGGCACCAGACACATAGGATTCTTGGAGCAGATGCTAAGCCAGGAGACAGGATGGGGCTGCT
TCTTAGAGCCCTTGTTATGGCAGCGCTCCATCTAGGAAACAGCAGTCAGTCTCTCCTGCTCACT
GTTCTCCCTCTCTGTGCTCAAGTCTGTCAGTGCTCGCTGGCCTCTGGCTCTTCCCTTTGGGGAG
GGAGCGGCTGTTCTGCCTGCTTCACCGAGTCTTCACAAGCTGAGGGGATGAGGCCAGGTTAGTA
CCAGGGACCAGCAACCTTTCAGGGCTCCTTGGGGGTCTCAGGTCCACACACAGTGAGCATCCCT
TGCCAGGTGCCCCATGTATCTGTCAGTGCTGAGACGCCAAACACACAACCTGTTCCCAGCTGCT
GCTGGGGGCCACTGTGACCGAGGAGAGTGTGGGGTTGCCAGGGAGAGCGCTGTCCCTCTGACAG
CCTGACCAGATGATGTAGCTTTGAAAGCCGGCAGCATGTGAGTAGCAAGATGTGACCTTGAGCT
AGCTGAGCAGAACACAGGTGGATGGGCAGAGGCCCCCATCCTGGCGAGCTGAGCCTGGCTGTGT
CCTGTCAGGACGCCCTACTCTGTGACCCTACCCTGTGATCTGTGAAGTGGTGCAGTCGGAAGAC
GAGGCTGGAGTCCTTTACAAGTTTCTACACTAGATTGTAGCCAGGTTTTCTCCCAGGCCTTAGG
CTTTGGTTTACTTTTAATTTTAATTTCACTGTTACCCTTGACTATTGTCCTTTTTGTTGCAGTG
TTGGAGAGGCAGGAGGTATTTGTGCCTCATCTATTACTGCAAAAAAATTAAATAAATGTAACAA
TAAACGTCCTAAAATCA

hide sequence

Protein Sequences


Protein RefSeqs	NP_112296	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAZ23818	(Get FASTA)	NCBI Sequence Viewer
	AAZ23819	(Get FASTA)	NCBI Sequence Viewer
	BAA12867	(Get FASTA)	NCBI Sequence Viewer
	CAG9553618	(Get FASTA)	NCBI Sequence Viewer
	EDL89720	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000001654
	ENSRNOP00000001654.5
GenBank Protein	Q63210	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_112296 ⟸ NM_031034

- UniProtKB:

Q63210 (UniProtKB/Swiss-Prot), Q45QM2 (UniProtKB/TrEMBL), Q45QM3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSGVVRTLSRCLLPAEAGARERRAGAARDAEREARRRSRDIDALLARERRAVRRLVKILLLGAG
ESGKSTFLKQMRIIHGREFDQKALLEFRDTIFDNILKGSRVLVDARDKLGIPWQHSENEKHGMF
LMAFENKAGLPVEPATFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYFLDNLDRIGQLNY
FPSKQDILLARKATKGIVEHDFVIKKIPFKMVDVGGQRSQRQKWFQCFDGITSILFMVSSSEYD
QVLMEDRRTNRLVESMNIFETIVNNKLFFNVSIILFLNKMDLLVEKVKSVSIKKHFPDFKGDPH
RLEDVQRYLVQCFDRKRRNRGKPLFHHFTTAIDTENIRFVFHAVKDTILQENLKDIMLQ

hide sequence

Ensembl Acc Id:

ENSRNOP00000001654 ⟸ ENSRNOT00000001654

Protein Domains

G-alpha

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q63210-F1-model_v2	AlphaFold	Q63210	1-379	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698452

Promoter ID:

EPDNEW_R8976

Type:

initiation region

Name:

Gna12_1

Description:

G protein subunit alpha 12

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	15,890,093 - 15,890,153	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:71018	AgrOrtholog
BioCyc Gene	G2FUF-19934	BioCyc
Ensembl Genes	ENSRNOG00000001235	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000001654	ENTREZGENE
	ENSRNOT00000001654.8	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.400.10	UniProtKB/Swiss-Prot
	3.40.50.300	UniProtKB/Swiss-Prot
InterPro	Gprotein_alpha_12/13	UniProtKB/Swiss-Prot
	Gprotein_alpha_su	UniProtKB/Swiss-Prot
	GproteinA_insert	UniProtKB/Swiss-Prot
	P-loop_NTPase	UniProtKB/Swiss-Prot
KEGG Report	rno:81663	UniProtKB/Swiss-Prot
NCBI Gene	81663	ENTREZGENE
PANTHER	GUANINE NUCLEOTIDE-BINDING PROTEIN SUBUNIT ALPHA-12	UniProtKB/Swiss-Prot
	PTHR10218	UniProtKB/Swiss-Prot
Pfam	G-alpha	UniProtKB/Swiss-Prot
PhenoGen	Gna12	PhenoGen
PRINTS	GPROTEINA	UniProtKB/Swiss-Prot
	GPROTEINA12	UniProtKB/Swiss-Prot
PROSITE	G_ALPHA	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000001235	RatGTEx
SMART	G_alpha	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF47895	UniProtKB/Swiss-Prot
	SSF52540	UniProtKB/Swiss-Prot
UniProt	GNA12_RAT	UniProtKB/Swiss-Prot
	Q45QM2	ENTREZGENE, UniProtKB/TrEMBL
	Q45QM3	ENTREZGENE, UniProtKB/TrEMBL
	Q63210	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-15	Gna12	G protein subunit alpha 12	Gna12	guanine nucleotide binding protein (G protein) alpha 12	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-07-09	Gna12	guanine nucleotide binding protein, alpha 12			Symbol and Name updated to reflect Human and Mouse nomenclature	70877	APPROVED

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)