Advanced Search (OLGA)

Gene: Faf1 (Fas associated factor 1) Rattus norvegicus

Analyze

Symbol:

Faf1

Name:

Fas associated factor 1

RGD ID:

70987

Description:

Predicted to enable several functions, including NF-kappaB binding activity; enzyme binding activity; and ubiquitin binding activity. Predicted to be involved in several processes, including Fas signaling pathway; negative regulation of canonical NF-kappaB signal transduction; and positive regulation of macromolecule metabolic process. Predicted to act upstream of or within positive regulation of extrinsic apoptotic signaling pathway via death domain receptors and regulation of cell adhesion. Predicted to be located in several cellular components, including nuclear envelope; ooplasm; and perinuclear region of cytoplasm. Predicted to be part of VCP-NPL4-UFD1 AAA ATPase complex. Predicted to be active in endoplasmic reticulum and nucleus. Orthologous to human FAF1 (Fas associated factor 1); PARTICIPATES IN aldosterone signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 4,4'-sulfonyldiphenol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Fas (TNFRSF6) associated factor 1; Fas-associated factor 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FAF1 (Fas associated factor 1)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Faf1 (Fas-associated factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Faf1 (Fas associated factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FAF1 (Fas associated factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FAF1 (Fas associated factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Faf1 (Fas associated factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FAF1 (Fas associated factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FAF1 (Fas associated factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Faf1 (Fas associated factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Faf1 (Fas associated factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ZFP82 (ZFP82 zinc finger protein)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	FAF1 (Fas associated factor 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Faf1 (Fas-associated factor 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	faf1 (Fas (TNFRSF6) associated factor 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	UBX3	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	UBX3	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	casp	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ubc-23	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	ubxn-3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	ubxn-3	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	faf1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	faf1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Candidate Gene For:

Bp372

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	129,654,677 - 130,018,604 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	129,654,445 - 130,020,516 (+)	Ensembl				GRCr8
mRatBN7.2	5	124,426,032 - 124,790,014 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	124,426,062 - 124,789,977 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	127,040,102 - 127,404,051 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	128,763,178 - 129,127,120 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	128,814,456 - 129,178,395 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	129,370,767 - 129,738,393 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	129,448,879 - 129,738,252 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	133,203,185 - 133,570,391 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	131,027,463 - 131,394,549 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	123,166,747 - 123,528,958 (+)	NCBI		Celera
RGSC_v3.1	5	131,032,690 - 131,399,775 (+)	NCBI
Cytogenetic Map	5	q35	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-dexrazoxane (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

4,4'-sulfonyldiphenol (EXP,ISO)

4-hydroxyphenyl retinamide (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP)

bisphenol F (EXP)

bortezomib (ISO)

Butylbenzyl phthalate (ISO)

cadmium atom (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

coumarin (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

diazinon (EXP)

dieldrin (EXP)

disodium selenite (ISO)

doxorubicin (ISO)

enzyme inhibitor (ISO)

fenthion (ISO)

flutamide (EXP)

folic acid (ISO)

FR900359 (ISO)

fulvestrant (ISO)

gentamycin (EXP)

ivermectin (ISO)

ketoconazole (EXP,ISO)

lead(0) (ISO)

menadione (ISO)

methidathion (ISO)

methylmercury chloride (ISO)

N-methyl-4-phenylpyridinium (ISO)

nefazodone (EXP)

NMS-873 (ISO)

oxaliplatin (EXP)

p-menthan-3-ol (ISO)

pentachlorophenol (ISO)

Ptaquiloside (ISO)

rofecoxib (ISO)

rotenone (EXP)

tetrachloromethane (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (EXP)

Torularhodin (ISO)

trichloroethene (ISO)

trovafloxacin (ISO)

tunicamycin (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

apoptotic process (IEA)

biological_process (ND)

ERAD pathway (IBA)

Fas signaling pathway (IEA,ISO,ISS)

negative regulation of canonical NF-kappaB signal transduction (IEA,ISO,ISS)

positive regulation of DNA replication (IEA,ISO)

positive regulation of extrinsic apoptotic signaling pathway via death domain receptors (ISO)

positive regulation of protein catabolic process (IEA,ISO)

regulation of cell adhesion (ISO)

regulation of protein catabolic process (IEA,ISO,ISS)

regulation of signal transduction (IEA)

Cellular Component

ATPase complex (IEA,ISO)

cytoplasm (IEA,ISO)

cytosol (IEA,ISO,ISS)

endomembrane system (IEA)

endoplasmic reticulum (IBA)

nuclear envelope (IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IBA,IEA,ISO,ISS)

perinuclear region of cytoplasm (IEA,ISO,ISS)

VCP-NPL4-UFD1 AAA ATPase complex (IEA,ISO)

Molecular Function

heat shock protein binding (IEA,ISO,ISS)

NF-kappaB binding (IBA,IEA,ISO)

protein binding (ISO)

protein domain specific binding (IEA,ISO)

protein kinase binding (IEA,ISO,ISS)

ubiquitin binding (IBA,IEA,ISO)

ubiquitin protein ligase binding (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

aldosterone signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
3.	Fas-associated factor-1 inhibits nuclear factor-kappaB (NF-kappaB) activity by interfering with nuclear translocation of the RelA (p65) subunit of NF-kappaB.	Park MY, etal., J Biol Chem 2004 Jan 23;279(4):2544-9. Epub 2003 Nov 04.
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Comprehensive gene review and curation	RGD comprehensive gene curation
8.	Interactions of the mineralocorticoid receptor--within and without.	Yang J and Fuller PJ, Mol Cell Endocrinol. 2012 Mar 24;350(2):196-205. doi: 10.1016/j.mce.2011.07.001. Epub 2011 Jul 18.

Additional References at PubMed

PMID:8524870	PMID:11713579	PMID:11731229	PMID:15596450	PMID:15688372	PMID:15743842	PMID:16510717	PMID:18775313	PMID:22871113	PMID:26842564	PMID:33510836

Genomics

Comparative Map Data

Faf1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	129,654,677 - 130,018,604 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	129,654,445 - 130,020,516 (+)	Ensembl				GRCr8
mRatBN7.2	5	124,426,032 - 124,790,014 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	124,426,062 - 124,789,977 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	127,040,102 - 127,404,051 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	128,763,178 - 129,127,120 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	128,814,456 - 129,178,395 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	129,370,767 - 129,738,393 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	129,448,879 - 129,738,252 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	133,203,185 - 133,570,391 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	131,027,463 - 131,394,549 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	123,166,747 - 123,528,958 (+)	NCBI		Celera
RGSC_v3.1	5	131,032,690 - 131,399,775 (+)	NCBI
Cytogenetic Map	5	q35	NCBI

FAF1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	50,437,028 - 50,960,267 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	50,437,028 - 50,960,279 (-)	Ensembl			hg38	GRCh38
GRCh37	1	50,902,700 - 51,425,939 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	50,679,523 - 51,198,524 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	50,618,955 - 51,137,957	NCBI
Celera	1	49,192,822 - 49,712,449 (-)	NCBI		Celera
Cytogenetic Map	1	p32.3	NCBI
HuRef	1	49,025,012 - 49,543,520 (-)	NCBI		HuRef
CHM1_1	1	51,024,587 - 51,543,485 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	50,316,640 - 50,840,146 (-)	NCBI		T2T-CHM13v2.0

Faf1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	109,533,873 - 109,821,157 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	109,533,785 - 109,821,157 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	4	109,676,627 - 109,963,960 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	109,676,588 - 109,963,960 (+)	Ensembl			mm10	GRCm38
MGSCv37	4	109,349,232 - 109,636,565 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	4	109,174,559 - 109,461,892 (+)	NCBI		MGSCv36	mm8
Celera	4	108,016,524 - 108,303,952 (+)	NCBI		Celera
Cytogenetic Map	4	C7	NCBI
cM Map	4	51.33	NCBI

Faf1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955464	8,036,955 - 8,479,249 (+)	Ensembl
ChiLan1.0	NW_004955464	8,037,344 - 8,477,798 (+)	NCBI	ChiLan1.0	ChiLan1.0

FAF1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	175,904,738 - 176,428,403 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	175,045,303 - 175,570,884 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	49,679,198 - 50,207,129 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	51,188,540 - 51,603,694 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	51,188,540 - 51,606,904 (-)	Ensembl			panPan2	panpan1.1

FAF1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	10,232,520 - 10,691,106 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	15	10,232,614 - 10,690,741 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	10,381,228 - 10,841,837 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	10,361,829 - 10,827,913 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	15	10,364,290 - 10,827,550 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	15	10,167,164 - 10,628,188 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	10,255,573 - 10,716,512 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	10,272,462 - 10,733,482 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Faf1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	65,257,206 - 65,632,085 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936522	9,784,203 - 10,161,774 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936522	9,774,943 - 10,160,987 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FAF1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	161,166,996 - 161,603,725 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	161,173,915 - 161,603,731 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	148,924,017 - 149,306,842 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FAF1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	81,978,590 - 82,475,130 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	81,978,966 - 82,477,842 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666033	34,720,209 - 35,259,074 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Faf1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624859	2,105,884 - 2,630,090 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624859	2,105,840 - 2,628,074 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Faf1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	42,324,655 - 42,660,984 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Faf1
1570 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	70
Count of miRNA genes:	67
Interacting mature miRNAs:	67
Transcripts:	ENSRNOT00000011765
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	102105698	152749382	Rat
2303586	Gluco52	Glucose level QTL 52	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	100826632	145826632	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	44924861	153890773	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	116702075	161702075	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	38207390	136631402	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	99905133	172190305	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	48523123	134369373	Rat
1582230	Bw78	Body weight QTL 78	3.2	0.0016	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	5	124314582	133270832	Rat
7411582	Foco3	Food consumption QTL 3	7.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	92583776	137583776	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	65089051	166764498	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	112142946	157142946	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	112142946	157142946	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	110770739	155770739	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	51657967	166600247	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	112142946	157142946	Rat
7411564	Bw135	Body weight QTL 135		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	92583776	137583776	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	98972960	143972960	Rat
1581510	Cm54	Cardiac mass QTL 54	3.4	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	125969677	172190305	Rat
11528624	Bss114	Bone structure and strength QTL 114	6.54	3e-07	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	129627938	131996704	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55124766	172190305	Rat
7411601	Foco12	Food consumption QTL 12	19.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	92583776	137583776	Rat
2303618	Vencon1	Ventilatory control QTL 1	3.8		respiration trait (VT:0001943)	oxygen consumption (CMO:0002169)	5	100826632	145826632	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	111236572	156236572	Rat
7394710	Emca12	Estrogen-induced mammary cancer QTL 12			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	94034903	139034903	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	114131300	159131300	Rat
2293642	Bss37	Bone structure and strength QTL 37	4.64	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	125969677	156302135	Rat
1358909	Kidm25	Kidney mass QTL 25	1.87		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	95062526	133270832	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	60601597	137492949	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	112142946	157142946	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	116702075	161702075	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	112142946	157142946	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	116702075	161702075	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	36460764	136631402	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	74335621	156302135	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	116702075	161702075	Rat
1298086	Bp156	Blood pressure QTL 156			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	89369373	134369373	Rat
2306971	Anxrr21	Anxiety related response QTL 21	9.47		fear/anxiety-related behavior trait (VT:1000241)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	5	70969494	136328156	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	114131300	159131300	Rat
1358895	Bp254	Blood pressure QTL 254	3.6	0.0003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	97492524	133270832	Rat
6903316	Bw113	Body weight QTL 113	2	0.0103	body mass (VT:0001259)	body weight (CMO:0000012)	5	92881678	137881678	Rat
1358889	Bp261	Blood pressure QTL 261	2.86		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	95062526	133270832	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	104262817	153890625	Rat

Markers in Region

D5Got47

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	124,456,846 - 124,457,033 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	129,401,534 - 129,401,718	NCBI	Rnor6.0
Rnor_5.0	5	133,233,952 - 133,234,136	UniSTS	Rnor5.0
RGSC_v3.4	5	131,058,232 - 131,058,417	RGD	RGSC3.4
RGSC_v3.4	5	131,058,233 - 131,058,417	UniSTS	RGSC3.4
Celera	5	123,197,227 - 123,197,411	UniSTS
RGSC_v3.1	5	131,063,459 - 131,063,643	RGD
RH 3.4 Map	5	817.8	UniSTS
RH 3.4 Map	5	817.8	RGD
RH 2.0 Map	5	760.7	RGD
Cytogenetic Map	5	q35	UniSTS

AA959731

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	124,789,846 - 124,789,944 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	129,738,256 - 129,738,353	NCBI	Rnor6.0
Rnor_5.0	5	133,570,254 - 133,570,351	UniSTS	Rnor5.0
RGSC_v3.4	5	131,394,412 - 131,394,509	UniSTS	RGSC3.4
Celera	5	123,528,821 - 123,528,918	UniSTS
Cytogenetic Map	5	q35	UniSTS

BE106300

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	124,669,402 - 124,669,572 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	129,615,953 - 129,616,122	NCBI	Rnor6.0
Rnor_5.0	5	133,448,239 - 133,448,408	UniSTS	Rnor5.0
RGSC_v3.4	5	131,271,621 - 131,271,790	UniSTS	RGSC3.4
Celera	5	123,409,718 - 123,409,887	UniSTS
RH 3.4 Map	5	804.9	UniSTS
Cytogenetic Map	5	q35	UniSTS

RH134610

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	124,789,784 - 124,789,965 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	129,738,194 - 129,738,374	NCBI	Rnor6.0
Rnor_5.0	5	133,570,192 - 133,570,372	UniSTS	Rnor5.0
RGSC_v3.4	5	131,394,350 - 131,394,530	UniSTS	RGSC3.4
Celera	5	123,528,759 - 123,528,939	UniSTS
RH 3.4 Map	5	822.7	UniSTS
Cytogenetic Map	5	q35	UniSTS

RH124745

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	124,789,789 - 124,789,947 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	129,738,199 - 129,738,356	NCBI	Rnor6.0
Rnor_5.0	5	133,570,197 - 133,570,354	UniSTS	Rnor5.0
RGSC_v3.4	5	131,394,355 - 131,394,512	UniSTS	RGSC3.4
Celera	5	123,528,764 - 123,528,921	UniSTS
Cytogenetic Map	5	q35	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	163	91	90	59	92	59	6	356	192	11	142	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_130406	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109189	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287104	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215100	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000011765 ⟹ ENSRNOP00000011765

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	129,655,544 - 130,018,600 (+)	Ensembl
mRatBN7.2 Ensembl	5	124,467,538 - 124,789,977 (+)	Ensembl
Rnor_6.0 Ensembl	5	129,448,879 - 129,738,252 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000096889 ⟹ ENSRNOP00000094033

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	129,654,555 - 130,020,516 (+)	Ensembl
mRatBN7.2 Ensembl	5	124,426,062 - 124,762,352 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000108187 ⟹ ENSRNOP00000085918

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	129,741,470 - 130,020,516 (+)	Ensembl
mRatBN7.2 Ensembl	5	124,512,866 - 124,789,977 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000116220 ⟹ ENSRNOP00000094545

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	129,654,445 - 130,018,600 (+)	Ensembl
mRatBN7.2 Ensembl	5	124,426,062 - 124,789,977 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000172746 ⟹ ENSRNOP00000108653

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	129,696,147 - 130,020,516 (+)	Ensembl

RefSeq Acc Id:

NM_130406 ⟹ NP_569090

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	129,654,677 - 130,018,604 (+)	NCBI
mRatBN7.2	5	124,426,064 - 124,790,014 (+)	NCBI
Rnor_6.0	5	129,370,767 - 129,738,393 (+)	NCBI
Rnor_5.0	5	133,203,185 - 133,570,391 (+)	NCBI
RGSC_v3.4	5	131,027,463 - 131,394,549 (+)	RGD
Celera	5	123,166,747 - 123,528,958 (+)	RGD

Sequence:

show sequence

CACTGATTGAGGAAAACATACTGGTCCTCTGTCTGTACCATCAGAGGCCTGTGCATCCGAAGAT
CGTAGGTTACCGAGTGCATGAGCACCTAGTCTCCCGCGCTGCCCCGCCCGCCGGCCCGGCCCTC
CCGCCGGCTCGCCCGCCAGCCCCTCGCCACCCGGCGGCGGCCGCAGCTTCGGCCGCAGGAGGCG
CCGTCTCGCTCCCAGGTGCGCGCTTCGTTCCCGGAGCCGCGGAGCTCGGCGGCCGCCATGGCGT
CCAACATGGACCGGGAGATGATCCTTGCGGATTTTCAGGCATGTACTGGTATTGAAAACATTGA
TGAAGCTATTACACTGCTTGAGCAAAATAACTGGGACTTGGTGGCAGCTATCAATGGTGTAATA
CCCCAGGAAAATGGCATTCTACAAAGTGACTTTGGAGGTGAGACCATGCCAGGACCCACATTTG
ACCCAGCAAGTCCACCTGCTCCAGCTCCAGCTCCCTCTTCTTCCGCGTTCCGACCTGTAATGCC
ATCCAGGCAGATCGTAGAAAGGCAGCCGCGCATGCTCGACTTCAGAGTTGAATACAGGGACAGG
AATGTTGATGTGGTACTTGAAGACAGCTGTACTGTTGGAGAGATTAAACAGATTCTAGAAAATG
AACTTCAGATACCTGTGCCTAAAATGCTGTTGAAAGGCTGGAAGACTGGAGATGTGGAAGACAG
TACGGTCTTAAAATCACTACACTTGCCAAAAAACAACAGTCTTTATGTCCTTACACCAGACTTA
CCACCACCTTCATCATCCAGTCATGCTGGTGCCCTGCAGGAATCATTAAATCAAAACTTCATGC
TGATCATCACCCACCGAGAGGTCCAGCGGGAGTACAACCTGAACTTCTCAGGAAGCAGTACCGT
TCAAGAGGTAAAGAGAAATGTGTATGATCTGACAAGCATACCTGTTCGACATCAGTTATGGGAA
GGCTGGCCAGCTTCTGCCACTGATGATTCAATGTGTCTTGCTGAATCAGGGCTCTCTTATCCCT
GCCATCGACTCACTGTGGGACGAAGAACTTCACCTGTACAGACCCGTGAGCAATCAGAAGAGCA
AAGCACGGTAGTTCATATGGTTAGTGATAGTGATGGAGATGACTTTGAAGATGCTTCAGAATTT
GGAGTGGTAGACGGAGAAGTATTTGGCATGGCATCATCTACCATGAGAAAATCTCCAATGATGC
CAGAAAACGCAGAAAATGAAGGAGATGCCTTATTACAATTTACAGCAGAGTTTTCTTCAAGATA
TGGTGACTGCCATCCTGTATTTTTTATTGGCTCATTAGAAGCTGCTTTCCAAGAGGCCTTCTAT
GTGAAAGCCAGAGACAGAAAGCTTCTTGCTATCTACCTCCACCATGATGAAAGTGTACTAACCA
ACGTGTTCTGCTCACAAATGCTTTGTGCTGAATCCATTGTTTCTTATCTGAGTCAAAATTTTAT
AACCTGGGCTTGGGATCTGACAAAGGACGCCAACAGAGCAAGATTTCTGACAATGTGCAATAGA
CACTTTGGCAGCGTTATTGCACAAACCATTCGGACTCAAAAGACAGATCAGTTTCCACTTTTCC
TGATTATCATGGGAAAGCGATCATCTAATGAAGTGCTAAATGTGATACAAGGTAATACAACAGT
GGATGAGTTAATGATGAGACTCATGGCTGCCATGGAGATTTTCTCAGCTCAACAACAGGAAGAC
ATAAAGGATGAGGATGAACGTGAAGCCAGAGAAAATGTGAAGAGAGAGCAAGATGAGGCTTATC
GCCTTTCCCTTGAAGCCGACAGGGCAAAGAGAGAAGCTCATGAGAGAGAGATGGCAGAACAGTT
TCGTTTGGAGCAGATTCGCAAAGAGCAAGAAGAGGAACGCGAGGCCATCAGACTCTCCTTAGAA
CAAGCCCTGCCTCCAGAGCCAGAGGAGGAAAATGCGGAGCCTGTTAGCAAGCTTCGGATTCGAA
CCCCCAGTGGCGAGTTCCTGGAACGCCGTTTCCTGGCCAGCAATAAGCTCCAGATTGTCTTTGA
TTTTGTGGCTTCCAAGGGATTTCCTTGGGATGAGTTCAAGTTACTGAGCACCTTTCCTAGGAGA
GACGTAACTCAGCTAGACCCCAATAAGTCATTATTGGAGGTAAACTTGTTCCCTCAAGAAACCC
TTTTCCTTCTAGCAAAAGAGTAAACATGACTGAGAGGTGGAGGCAGCCACTCCTGACAAGCCAA
CGGCACGCGTCAAGAGACGGGCTCCTCACCAGCCCACCTAGATGCTCGTGTCACTCAGTTCAAT
GTCACCTCTGCCTCTTGCAAGATTGCTGGAAAAAAG

hide sequence

RefSeq Acc Id:

XM_039109189 ⟹ XP_038965117

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	129,753,103 - 130,018,600 (+)	NCBI
mRatBN7.2	5	124,524,441 - 124,790,010 (+)	NCBI

RefSeq Acc Id:

XM_063287104 ⟹ XP_063143174

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	129,676,375 - 130,018,600 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_569090	(Get FASTA)	NCBI Sequence Viewer
	XP_038965117	(Get FASTA)	NCBI Sequence Viewer
	XP_063143174	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL90354	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000011765
	ENSRNOP00000094033
GenBank Protein	Q924K2	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_569090 ⟸ NM_130406

- UniProtKB:

Q924K2 (UniProtKB/Swiss-Prot), A0A8I6AMD4 (UniProtKB/TrEMBL), A6JYZ8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MASNMDREMILADFQACTGIENIDEAITLLEQNNWDLVAAINGVIPQENGILQSDFGGETMPGP
TFDPASPPAPAPAPSSSAFRPVMPSRQIVERQPRMLDFRVEYRDRNVDVVLEDSCTVGEIKQIL
ENELQIPVPKMLLKGWKTGDVEDSTVLKSLHLPKNNSLYVLTPDLPPPSSSSHAGALQESLNQN
FMLIITHREVQREYNLNFSGSSTVQEVKRNVYDLTSIPVRHQLWEGWPASATDDSMCLAESGLS
YPCHRLTVGRRTSPVQTREQSEEQSTVVHMVSDSDGDDFEDASEFGVVDGEVFGMASSTMRKSP
MMPENAENEGDALLQFTAEFSSRYGDCHPVFFIGSLEAAFQEAFYVKARDRKLLAIYLHHDESV
LTNVFCSQMLCAESIVSYLSQNFITWAWDLTKDANRARFLTMCNRHFGSVIAQTIRTQKTDQFP
LFLIIMGKRSSNEVLNVIQGNTTVDELMMRLMAAMEIFSAQQQEDIKDEDEREARENVKREQDE
AYRLSLEADRAKREAHEREMAEQFRLEQIRKEQEEEREAIRLSLEQALPPEPEEENAEPVSKLR
IRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEFKLLSTFPRRDVTQLDPNKSLLEVNLFPQ
ETLFLLAKE

hide sequence

Ensembl Acc Id:

ENSRNOP00000011765 ⟸ ENSRNOT00000011765

RefSeq Acc Id:	XP_038965117 ⟸ XM_039109189
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I6A189 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000085918 ⟸ ENSRNOT00000108187

Ensembl Acc Id:

ENSRNOP00000094033 ⟸ ENSRNOT00000096889

Ensembl Acc Id:

ENSRNOP00000094545 ⟸ ENSRNOT00000116220

RefSeq Acc Id:	XP_063143174 ⟸ XM_063287104
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6A189 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000108653 ⟸ ENSRNOT00000172746

Protein Domains

UBA UBX

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q924K2-F1-model_v2	AlphaFold	Q924K2	1-649	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:70987	AgrOrtholog
BioCyc Gene	G2FUF-40344	BioCyc
Ensembl Genes	ENSRNOG00000008523	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000011765	ENTREZGENE
	ENSRNOT00000096889	ENTREZGENE
Gene3D-CATH	DNA helicase RuvA subunit, C-terminal domain	UniProtKB/Swiss-Prot
	Glutaredoxin	UniProtKB/Swiss-Prot
	Phosphatidylinositol 3-kinase Catalytic Subunit, Chain A, domain 1	UniProtKB/Swiss-Prot
InterPro	FAF1_2-like_UAS	UniProtKB/Swiss-Prot
	FAF1_UBA	UniProtKB/Swiss-Prot
	FAF1_UBX	UniProtKB/Swiss-Prot
	Thioredoxin-like_sf	UniProtKB/Swiss-Prot
	UAS	UniProtKB/Swiss-Prot
	Ubiquitin-like_domsf	UniProtKB/Swiss-Prot
	UBX_dom	UniProtKB/Swiss-Prot
	UBX_domain-protein	UniProtKB/Swiss-Prot
KEGG Report	rno:140657	UniProtKB/Swiss-Prot
NCBI Gene	140657	ENTREZGENE
PANTHER	FAS-ASSOCIATED FACTOR 1	UniProtKB/Swiss-Prot
	FAS-ASSOCIATED PROTEIN	UniProtKB/Swiss-Prot
Pfam	FAF1	UniProtKB/Swiss-Prot
	UBA_4	UniProtKB/Swiss-Prot
	UBX	UniProtKB/Swiss-Prot
PhenoGen	Faf1	PhenoGen
PROSITE	UBX	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000008523	RatGTEx
SMART	UAS	UniProtKB/Swiss-Prot
	UBX	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF52833	UniProtKB/Swiss-Prot
	SSF54236	UniProtKB/Swiss-Prot
UniProt	A0A8I6A189	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AIN8_RAT	UniProtKB/TrEMBL
	A0A8I6AMD4	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0LD55_RAT	UniProtKB/TrEMBL
	A6JYZ8	ENTREZGENE, UniProtKB/TrEMBL
	F1LSQ0_RAT	UniProtKB/TrEMBL
	FAF1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-01-27	Faf1	Fas associated factor 1	Faf1	Fas (TNFRSF6) associated factor 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-10-17	Faf1	Fas (TNFRSF6) associated factor 1	Faf1	Fas-associated factor 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-07-09	Faf1	Fas-associated factor 1			Symbol and Name updated to reflect Human and Mouse nomenclature	70877	APPROVED

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

RGD Manual Annotations