Symbol:
Rida
Name:
reactive intermediate imine deaminase A homolog
RGD ID:
70940
Description:
Enables several functions, including RNA endonuclease activity, producing 3'-phosphomonoesters; identical protein binding activity; and long-chain fatty acid binding activity. Involved in several processes, including G1 to G0 transition; negative regulation of translation; and response to salt. Located in cytosol; mitochondrial matrix; and peroxisome. Orthologous to human RIDA (reactive intermediate imine deaminase A homolog); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
14.5 kDa translational inhibitor protein; 2-iminobutanoate/2-iminopropanoate deaminase; heat-responsive protein 12; Hrsp12; L-PSP; perchloric acid soluble protein; perchloric acid-soluble protein; Psp; PSP1; ribonuclease UK114; rp14.5; translation inhibitor L-PSP ribonuclease; UK114 antigen homolog
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
RIDA (reactive intermediate imine deaminase A homolog) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Rida (reactive intermediate imine deaminase A homolog) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Rida (reactive intermediate imine deaminase A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
RIDA (reactive intermediate imine deaminase A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
RIDA (reactive intermediate imine deaminase A homolog) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Rida (reactive intermediate imine deaminase A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
RIDA (reactive intermediate imine deaminase A homolog) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
RIDA (reactive intermediate imine deaminase A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Rida (reactive intermediate imine deaminase A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
OR10W1 (olfactory receptor family 10 subfamily W member 1) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Rida (reactive intermediate imine deaminase A homolog)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
RIDA (reactive intermediate imine deaminase A homolog)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
HMF1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector)
Caenorhabditis elegans (roundworm):
C23G10.2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
UK114
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Danio rerio (zebrafish):
rida
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
MMF1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 67,576,586 - 67,590,493 (-) NCBI GRCr8 mRatBN7.2 7 65,691,429 - 65,705,257 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 65,691,435 - 65,705,716 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 67,580,616 - 67,594,441 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 69,782,349 - 69,796,174 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 69,647,777 - 69,661,588 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 73,256,506 - 73,270,308 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 73,256,508 - 73,270,308 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 73,422,772 - 73,436,372 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 69,930,464 - 69,944,267 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 69,951,193 - 69,964,994 (-) NCBI Celera 7 62,792,438 - 62,806,237 (-) NCBI Celera Cytogenetic Map 7 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Rida Rat (-)-epigallocatechin 3-gallate decreases expression ISO RIDA (Homo sapiens) 6480464 epigallocatechin gallate results in decreased expression of RIDA mRNA CTD PMID:22079256 Rida Rat (-)-epigallocatechin 3-gallate multiple interactions ISO RIDA (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of RIDA mRNA CTD PMID:22079256 Rida Rat (1->4)-beta-D-glucan multiple interactions ISO Rida (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of RIDA mRNA CTD PMID:36331819 Rida Rat 1,1-dichloroethene decreases expression ISO Rida (Mus musculus) 6480464 vinylidene chloride results in decreased expression of RIDA mRNA CTD PMID:26682919 Rida Rat 1,2-dimethylhydrazine multiple interactions ISO Rida (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of RIDA mRNA CTD PMID:22206623 Rida Rat 1,2-dimethylhydrazine decreases expression ISO Rida (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of RIDA mRNA CTD PMID:22206623 Rida Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of RIDA mRNA CTD PMID:32145629 Rida Rat 17beta-estradiol decreases expression ISO Rida (Mus musculus) 6480464 Estradiol results in decreased expression of RIDA mRNA CTD PMID:39298647 Rida Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Rida (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Rida Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Rida (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of RIDA mRNA CTD PMID:21570461 Rida Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of RIDA mRNA CTD PMID:18465118 more ... Rida Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Rida (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Rida Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of RIDA mRNA CTD PMID:21346803 Rida Rat 2-methylcholine affects expression ISO RIDA (Homo sapiens) 6480464 beta-methylcholine affects the expression of RIDA mRNA CTD PMID:21179406 Rida Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of RIDA mRNA CTD PMID:28522335 Rida Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin results in decreased expression of RIDA protein CTD PMID:34915118 Rida Rat 4,4'-diaminodiphenylmethane increases expression ISO Rida (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of RIDA mRNA CTD PMID:18648102 Rida Rat 4,4'-sulfonyldiphenol increases expression ISO Rida (Mus musculus) 6480464 bisphenol S results in increased expression of RIDA mRNA CTD PMID:39298647 Rida Rat 4,4'-sulfonyldiphenol increases expression ISO RIDA (Homo sapiens) 6480464 bisphenol S results in increased expression of RIDA protein CTD PMID:34186270 Rida Rat 4-hydroxyphenyl retinamide increases expression ISO Rida (Mus musculus) 6480464 Fenretinide results in increased expression of RIDA mRNA CTD PMID:28973697 Rida Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of RIDA mRNA CTD PMID:19483382 Rida Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of RIDA mRNA CTD PMID:19483382 Rida Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of RIDA mRNA CTD PMID:24780913 Rida Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of RIDA mRNA CTD PMID:31881176 Rida Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of RIDA mRNA CTD PMID:28959563 Rida Rat aflatoxin B1 affects expression ISO RIDA (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of RIDA protein CTD PMID:20106945 Rida Rat aflatoxin B1 decreases methylation ISO RIDA (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of RIDA gene CTD PMID:27153756 Rida Rat aflatoxin B1 decreases expression ISO RIDA (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of RIDA mRNA CTD PMID:22100608 Rida Rat all-trans-retinoic acid decreases expression ISO RIDA (Homo sapiens) 6480464 Tretinoin results in decreased expression of RIDA mRNA CTD PMID:21934132 more ... Rida Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of RIDA mRNA CTD PMID:35163327 Rida Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of RIDA mRNA CTD PMID:19483382 Rida Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of RIDA mRNA CTD PMID:16483693 Rida Rat ampicillin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in decreased expression of RIDA protein CTD PMID:30545405 Rida Rat aristolochic acid A increases expression ISO RIDA (Homo sapiens) 6480464 aristolochic acid I results in increased expression of RIDA mRNA CTD PMID:33212167 Rida Rat arsenite(3-) increases expression ISO Rida (Mus musculus) 6480464 arsenite results in increased expression of RIDA mRNA CTD PMID:18929588 Rida Rat arsenite(3-) multiple interactions ISO RIDA (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to RIDA mRNA] CTD PMID:32406909 Rida Rat arsenite(3-) multiple interactions ISO Rida (Mus musculus) 6480464 TRP53 protein affects the reaction [arsenite results in increased expression of RIDA mRNA] CTD PMID:18929588 Rida Rat azathioprine decreases expression ISO RIDA (Homo sapiens) 6480464 Azathioprine results in decreased expression of RIDA mRNA CTD PMID:22623647 Rida Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of RIDA mRNA CTD PMID:19483382 Rida Rat benzo[a]pyrene increases expression ISO RIDA (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of RIDA protein CTD PMID:32717239 Rida Rat benzo[a]pyrene decreases expression ISO RIDA (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of RIDA mRNA CTD PMID:32234424 Rida Rat benzo[a]pyrene diol epoxide I decreases expression ISO RIDA (Homo sapiens) 6480464 7 more ... CTD PMID:20018196 Rida Rat bexarotene decreases expression EXP 6480464 bexarotene results in decreased expression of RIDA mRNA CTD PMID:16648578 Rida Rat bezafibrate multiple interactions EXP 6480464 [Bezafibrate co-treated with Sunflower Oil] results in increased expression of RIDA protein CTD PMID:16843601 Rida Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in increased expression of RIDA mRNA CTD PMID:26496021 Rida Rat bisphenol A decreases expression ISO Rida (Mus musculus) 6480464 bisphenol A results in decreased expression of RIDA mRNA and bisphenol A results in decreased expression of RIDA protein CTD PMID:33221593 and PMID:35999755 Rida Rat bisphenol A decreases expression ISO RIDA (Homo sapiens) 6480464 bisphenol A results in decreased expression of RIDA mRNA CTD PMID:31715268 Rida Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of RIDA mRNA CTD PMID:30903817 Rida Rat bisphenol A affects expression ISO RIDA (Homo sapiens) 6480464 bisphenol A affects the expression of RIDA mRNA CTD PMID:30903817 Rida Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of RIDA mRNA and bisphenol A results in decreased expression of RIDA protein CTD PMID:25181051 and PMID:32145629 Rida Rat bisphenol AF increases expression ISO RIDA (Homo sapiens) 6480464 bisphenol AF results in increased expression of RIDA protein CTD PMID:34186270 Rida Rat Bisphenol B increases expression ISO RIDA (Homo sapiens) 6480464 bisphenol B results in increased expression of RIDA protein CTD PMID:34186270 Rida Rat bisphenol F decreases expression ISO Rida (Mus musculus) 6480464 bisphenol F results in decreased expression of RIDA mRNA CTD PMID:38685157 Rida Rat bromobenzene affects binding EXP 6480464 bromobenzene metabolite binds to RIDA protein CTD PMID:17305373 Rida Rat cadmium dichloride increases expression ISO RIDA (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of RIDA protein CTD PMID:24527689 Rida Rat cadmium dichloride decreases expression ISO RIDA (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of RIDA mRNA CTD PMID:38568856 Rida Rat carbon nanotube decreases expression ISO Rida (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Rida Rat cefaloridine decreases expression EXP 6480464 Cephaloridine results in decreased expression of RIDA mRNA CTD PMID:18500788 Rida Rat chloroprene increases expression ISO Rida (Mus musculus) 6480464 Chloroprene results in increased expression of RIDA mRNA CTD PMID:23125180 Rida Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of RIDA mRNA CTD PMID:19483382 Rida Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of RIDA mRNA CTD PMID:24386269 Rida Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of RIDA mRNA CTD PMID:22465980 Rida Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of RIDA mRNA CTD PMID:22465980 Rida Rat copper(II) sulfate decreases expression ISO RIDA (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of RIDA mRNA CTD PMID:19549813 Rida Rat cyclosporin A decreases expression ISO Rida (Mus musculus) 6480464 Cyclosporine results in decreased expression of RIDA mRNA CTD PMID:19770486 Rida Rat cyclosporin A decreases expression ISO RIDA (Homo sapiens) 6480464 Cyclosporine results in decreased expression of RIDA mRNA CTD PMID:20106945 more ... Rida Rat dextran sulfate decreases expression ISO Rida (Mus musculus) 6480464 Dextran Sulfate results in decreased expression of RIDA protein CTD PMID:35999755 Rida Rat Dibutyl phosphate affects expression ISO RIDA (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of RIDA mRNA CTD PMID:37042841 Rida Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of RIDA mRNA CTD PMID:21266533 Rida Rat dicrotophos decreases expression ISO RIDA (Homo sapiens) 6480464 dicrotophos results in decreased expression of RIDA mRNA CTD PMID:28302478 Rida Rat diethylstilbestrol decreases expression ISO Rida (Mus musculus) 6480464 Diethylstilbestrol results in decreased expression of RIDA mRNA CTD PMID:15171707 Rida Rat dioxygen decreases expression ISO RIDA (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of RIDA mRNA CTD PMID:24236059 Rida Rat dioxygen multiple interactions ISO Rida (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of RIDA mRNA CTD PMID:30529165 Rida Rat esketamine decreases expression ISO RIDA (Homo sapiens) 6480464 Esketamine results in decreased expression of RIDA mRNA CTD PMID:38219984 Rida Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of RIDA protein CTD PMID:23200777 Rida Rat ethanol increases expression ISO Rida (Mus musculus) 6480464 Ethanol results in increased expression of RIDA mRNA CTD PMID:30319688 Rida Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of RIDA mRNA CTD PMID:18035473 Rida Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of RIDA mRNA CTD PMID:24136188 Rida Rat folic acid decreases expression ISO Rida (Mus musculus) 6480464 Folic Acid results in decreased expression of RIDA mRNA CTD PMID:25629700 Rida Rat folic acid multiple interactions ISO Rida (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of RIDA mRNA CTD PMID:22206623 Rida Rat furan affects binding EXP 6480464 furan binds to RIDA protein CTD PMID:22240984 Rida Rat furan increases methylation EXP 6480464 furan results in increased methylation of RIDA gene CTD PMID:22079235 Rida Rat gentamycin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in decreased expression of RIDA protein CTD PMID:30545405 Rida Rat glyphosate increases methylation EXP 6480464 Glyphosate results in increased methylation of RIDA gene CTD PMID:31011160 Rida Rat isotretinoin decreases expression ISO RIDA (Homo sapiens) 6480464 Isotretinoin results in decreased expression of UK114 mRNA CTD PMID:20436886 Rida Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of RIDA mRNA CTD PMID:19483382 Rida Rat methapyrilene increases expression EXP 6480464 Methapyrilene results in increased expression of RIDA mRNA CTD PMID:30467583 Rida Rat metronidazole multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in decreased expression of RIDA protein CTD PMID:30545405 Rida Rat monosodium L-glutamate multiple interactions ISO Rida (Mus musculus) 6480464 [Trans Fatty Acids co-treated with Sodium Glutamate] results in increased expression of RIDA mRNA CTD PMID:22078008 Rida Rat N-nitrosomorpholine increases expression EXP 6480464 N-nitrosomorpholine results in increased expression of RIDA protein CTD PMID:19716841 Rida Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of RIDA mRNA CTD PMID:24136188 Rida Rat neomycin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in decreased expression of RIDA protein CTD PMID:30545405 Rida Rat nitrates multiple interactions ISO Rida (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of RIDA mRNA CTD PMID:35964746 Rida Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of RIDA mRNA CTD PMID:33484710 Rida Rat O-methyleugenol decreases expression ISO RIDA (Homo sapiens) 6480464 methyleugenol results in decreased expression of RIDA mRNA CTD PMID:32234424 Rida Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of RIDA mRNA CTD PMID:19483382 Rida Rat paracetamol decreases expression ISO RIDA (Homo sapiens) 6480464 Acetaminophen results in decreased expression of RIDA mRNA CTD PMID:29067470 Rida Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of RIDA mRNA CTD PMID:33387578 Rida Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of RIDA mRNA CTD PMID:32680482 Rida Rat perfluorohexanesulfonic acid increases expression ISO Rida (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of RIDA mRNA CTD PMID:37995155 Rida Rat perfluorooctane-1-sulfonic acid decreases expression ISO RIDA (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in decreased expression of RIDA mRNA CTD PMID:27153767 Rida Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Rida (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of RIDA mRNA CTD PMID:36331819 Rida Rat perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of RIDA mRNA and perfluorooctanoic acid results in decreased expression of RIDA protein CTD PMID:19162173 and PMID:34958885 Rida Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of RIDA mRNA CTD PMID:35163327 Rida Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of RIDA mRNA CTD PMID:19483382 Rida Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of RIDA mRNA CTD PMID:19162173 Rida Rat potassium chromate multiple interactions ISO RIDA (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of RIDA mRNA CTD PMID:22079256 Rida Rat potassium chromate decreases expression ISO RIDA (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of RIDA mRNA CTD PMID:22079256 Rida Rat pregnenolone 16alpha-carbonitrile decreases expression ISO Rida (Mus musculus) 6480464 Pregnenolone Carbonitrile results in decreased expression of RIDA mRNA CTD PMID:28903501 Rida Rat Propiverine affects binding EXP 6480464 propiverine binds to RIDA protein CTD PMID:29273565 Rida Rat resveratrol multiple interactions ISO RIDA (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of RIDA mRNA CTD PMID:23557933 Rida Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of RIDA protein CTD PMID:35544339 Rida Rat silicon dioxide decreases expression ISO RIDA (Homo sapiens) 6480464 Silicon Dioxide results in decreased expression of RIDA mRNA CTD PMID:25351596 Rida Rat silver atom increases expression ISO Rida (Mus musculus) 6480464 Silver results in increased expression of RIDA mRNA CTD PMID:27131904 Rida Rat silver(0) increases expression ISO Rida (Mus musculus) 6480464 Silver results in increased expression of RIDA mRNA CTD PMID:27131904 Rida Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of RIDA protein CTD PMID:29459688 Rida Rat sodium arsenite decreases expression ISO Rida (Mus musculus) 6480464 sodium arsenite results in decreased expression of RIDA mRNA CTD PMID:37682722 Rida Rat sodium arsenite decreases expression ISO RIDA (Homo sapiens) 6480464 sodium arsenite results in decreased expression of RIDA mRNA CTD PMID:38568856 Rida Rat sodium dichromate affects expression EXP 6480464 sodium bichromate affects the expression of RIDA mRNA CTD PMID:22110744 Rida Rat sodium fluoride increases expression ISO Rida (Mus musculus) 6480464 Sodium Fluoride results in increased expression of RIDA protein CTD PMID:28918527 Rida Rat sunitinib decreases expression ISO RIDA (Homo sapiens) 6480464 Sunitinib results in decreased expression of RIDA mRNA CTD PMID:31533062 Rida Rat testosterone multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in increased expression of RIDA mRNA CTD PMID:26496021 Rida Rat tetrachloromethane affects expression EXP 6480464 Carbon Tetrachloride affects the expression of RIDA protein CTD PMID:16613267 Rida Rat tetrachloromethane decreases expression ISO Rida (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of RIDA mRNA CTD PMID:31919559 Rida Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of RIDA mRNA CTD PMID:31150632 Rida Rat tetrachloromethane affects expression ISO Rida (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of RIDA mRNA CTD PMID:17484886 Rida Rat tetrachloromethane multiple interactions EXP 6480464 Drugs and Chinese Herbal inhibits the reaction [Carbon Tetrachloride affects the expression of RIDA protein] CTD PMID:16613267 Rida Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of RIDA mRNA CTD PMID:19483382 Rida Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of RIDA mRNA CTD PMID:34492290 Rida Rat thiram decreases expression ISO RIDA (Homo sapiens) 6480464 Thiram results in decreased expression of RIDA mRNA CTD PMID:38568856 Rida Rat valproic acid decreases methylation ISO RIDA (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of RIDA gene CTD PMID:29154799 Rida Rat vancomycin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in decreased expression of RIDA protein CTD PMID:30545405 Rida Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of RIDA gene CTD PMID:31079544
(-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) 1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP,ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrotoluene (EXP) 2-methylcholine (ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrylamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) amiodarone (EXP) ammonium chloride (EXP) ampicillin (EXP) aristolochic acid A (ISO) arsenite(3-) (ISO) azathioprine (ISO) benzbromarone (EXP) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bexarotene (EXP) bezafibrate (EXP) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) bromobenzene (EXP) cadmium dichloride (ISO) carbon nanotube (ISO) cefaloridine (EXP) chloroprene (ISO) clofibrate (EXP) cobalt dichloride (EXP) copper atom (EXP) copper(0) (EXP) copper(II) sulfate (ISO) cyclosporin A (ISO) dextran sulfate (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) dicrotophos (ISO) diethylstilbestrol (ISO) dioxygen (ISO) esketamine (ISO) ethanol (EXP,ISO) flavonoids (EXP) flutamide (EXP) folic acid (ISO) furan (EXP) gentamycin (EXP) glyphosate (EXP) isotretinoin (ISO) L-ethionine (EXP) methapyrilene (EXP) metronidazole (EXP) monosodium L-glutamate (ISO) N-nitrosomorpholine (EXP) nefazodone (EXP) neomycin (EXP) nitrates (ISO) nitrofen (EXP) O-methyleugenol (ISO) omeprazole (EXP) paracetamol (EXP,ISO) paraquat (EXP) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) pirinixic acid (EXP) potassium chromate (ISO) pregnenolone 16alpha-carbonitrile (ISO) Propiverine (EXP) resveratrol (ISO) rotenone (EXP) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (EXP,ISO) sodium dichromate (EXP) sodium fluoride (ISO) sunitinib (ISO) testosterone (EXP) tetrachloromethane (EXP,ISO) thioacetamide (EXP) thiram (ISO) valproic acid (ISO) vancomycin (EXP) vinclozolin (EXP)
1.
UK114, a YjgF/Yer057p/UK114 family protein highly conserved from bacteria to mammals, is localized in rat liver peroxisomes.
Antonenkov VD, etal., Biochem Biophys Res Commun. 2007 May 25;357(1):252-7. Epub 2007 Mar 30.
2.
Purification, characterization and differentiation-dependent expression of a perchloric acid soluble protein from rat kidney.
Asagi K, etal., Nephron. 1998;79(1):80-90.
3.
Stable expression and regulation of a rat brain K+ channel.
Critz SD, etal., J Neurochem. 1993 Mar;60(3):1175-8.
4.
Crystallization and preliminary X-ray diffraction studies of perchloric acid soluble protein (PSP) from rat liver.
Djinovic Carugo K, etal., Acta Crystallogr D Biol Crystallogr. 1999 Mar;55(Pt 3):667-8.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
7.
Down regulation of a novel protein, PSP, in rat hepatoma cdRLh 84-beared tumor.
Kaneki K, etal., J Vet Med Sci. 2003 Jul;65(7):781-5.
8.
Perchloric acid-soluble protein is expressed in enterocytes and goblet cells in the intestine and upregulated by dietary lipid.
Kanouchi H, etal., Biochim Biophys Acta. 2006 Sep;1760(9):1380-5. Epub 2006 Apr 19.
9.
Expression and cellular distribution of perchloric acid-soluble protein is dependent on the cell-proliferating states of NRK-52E cells.
Kanouchi H, etal., Cell Mol Life Sci. 2000 Jul;57(7):1103-8.
10.
Recombinant expression of perchloric acid-soluble protein reduces cell proliferation.
Kanouchi H, etal., Cell Mol Life Sci. 2001 Aug;58(9):1340-3.
11.
Characterization, purification and cDNA cloning of a rat perchloric-acid-soluble 23-kDa protein present only in liver and kidney.
Levy-Favatier F, etal., Eur J Biochem 1993 Mar 15;212(3):665-73.
12.
Identification of salt-sensitive genes in the kidneys of Dahl rats.
Lighthall GK, etal., J Hypertens. 2004 Aug;22(8):1487-94.
13.
Purification and characterization of perchloric acid soluble protein from rat lung.
Matsumoto M, etal., Comp Biochem Physiol B Biochem Mol Biol. 2003 Jun;135(2):255-62.
14.
Gene Data Set
MGD Curation, June 12, 2002
15.
Ribonuclease activity of rat liver perchloric acid-soluble protein, a potent inhibitor of protein synthesis.
Morishita R, etal., J Biol Chem. 1999 Jul 16;274(29):20688-92.
16.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
17.
Isolation and characterization of a novel perchloric acid-soluble protein inhibiting cell-free protein synthesis.
Oka T, etal., J Biol Chem. 1995 Dec 15;270(50):30060-7.
18.
Mmf1p, a novel yeast mitochondrial protein conserved throughout evolution and involved in maintenance of the mitochondrial genome.
Oxelmark E, etal., Mol Cell Biol. 2000 Oct;20(20):7784-97.
19.
GOA pipeline
RGD automated data pipeline
20.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
21.
Analysis of the fatty acid components in a perchloric acid-soluble protein.
Sasagawa T, etal., Biochim Biophys Acta. 1999 Mar 25;1437(3):317-24.
22.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
23.
Purification, characterization and developmental expression of rat brain PSP protein.
Suzuki K, etal., Biochim Biophys Acta. 2001 Jul 2;1527(1-2):47-53.
24.
Protective effect of Phellinus linteus polysaccharide extracts against thioacetamide-induced liver fibrosis in rats: a proteomics analysis.
Wang H, etal., Chin Med. 2012 Oct 18;7(1):23. doi: 10.1186/1749-8546-7-23.
Rida Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 67,576,586 - 67,590,493 (-) NCBI GRCr8 mRatBN7.2 7 65,691,429 - 65,705,257 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 65,691,435 - 65,705,716 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 67,580,616 - 67,594,441 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 69,782,349 - 69,796,174 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 69,647,777 - 69,661,588 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 73,256,506 - 73,270,308 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 73,256,508 - 73,270,308 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 73,422,772 - 73,436,372 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 69,930,464 - 69,944,267 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 69,951,193 - 69,964,994 (-) NCBI Celera 7 62,792,438 - 62,806,237 (-) NCBI Celera Cytogenetic Map 7 q22 NCBI
RIDA Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 8 98,102,344 - 98,117,171 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 8 98,102,344 - 98,117,171 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 8 99,114,572 - 99,129,399 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 8 99,183,743 - 99,198,594 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 8 99,183,742 - 99,198,594 NCBI Celera 8 95,300,431 - 95,315,280 (-) NCBI Celera Cytogenetic Map 8 q22.2 NCBI HuRef 8 94,318,228 - 94,332,987 (-) NCBI HuRef CHM1_1 8 99,155,322 - 99,170,170 (-) NCBI CHM1_1 T2T-CHM13v2.0 8 99,227,836 - 99,242,661 (-) NCBI T2T-CHM13v2.0
Rida Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 34,484,168 - 34,495,392 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 34,484,167 - 34,495,401 (-) Ensembl GRCm39 Ensembl GRCm38 15 34,484,022 - 34,495,246 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 34,484,021 - 34,495,255 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 34,413,777 - 34,425,001 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 34,428,726 - 34,439,779 (-) NCBI MGSCv36 mm8 Celera 15 35,111,842 - 35,123,094 (-) NCBI Celera Cytogenetic Map 15 B3.1 NCBI cM Map 15 14.34 NCBI
Rida Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955417 13,810,596 - 13,822,982 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955417 13,810,596 - 13,822,982 (-) NCBI ChiLan1.0 ChiLan1.0
RIDA Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 7 115,443,968 - 115,458,801 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 8 90,985,381 - 91,000,244 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 8 94,739,120 - 94,753,934 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 8 96,923,776 - 96,938,512 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 8 96,923,776 - 96,938,512 (-) Ensembl panpan1.1 panPan2
RIDA Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 13 348,744 - 361,063 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 13 348,860 - 361,522 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 13 342,375 - 354,474 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 13 497,322 - 509,637 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 13 497,438 - 509,539 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 13 340,907 - 353,035 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 13 448,689 - 460,999 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 13 454,739 - 467,052 (-) NCBI UU_Cfam_GSD_1.0
Rida
RIDA Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 38,656,319 - 38,670,987 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 38,656,270 - 38,665,863 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 41,808,015 - 41,817,605 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
RIDA
Rida
.
Predicted Target Of
Count of predictions: 288 Count of miRNA genes: 181 Interacting mature miRNAs: 213 Transcripts: ENSRNOT00000007430 Prediction methods: Microtar, Miranda Result types: miRGate_prediction
7411569 Bw137 Body weight QTL 137 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 21921195 66921195 Rat 1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 2293667 Bss42 Bone structure and strength QTL 42 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 7 47651439 92651439 Rat 10053722 Scort27 Serum corticosterone level QTL 27 2.41 0.0083 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 43228750 88228750 Rat 1641885 Alcrsp9 Alcohol response QTL 9 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 7 24099606 69099606 Rat 1549840 Bss5 Bone structure and strength QTL 5 9.8 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 24751841 69751841 Rat 2317035 Aia16 Adjuvant induced arthritis QTL 16 2.71 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 7 59238038 104238038 Rat 1300127 Srn1 Serum renin concentration QTL 1 3.87 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 7 29409683 84928080 Rat 10059605 Kidm47 Kidney mass QTL 47 2.91 0.05 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 47251783 65728867 Rat 2293678 Bss24 Bone structure and strength QTL 24 6.71 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 7 47651439 92651439 Rat 1358361 Sradr5 Stress Responsive Adrenal Weight QTL 5 5.55 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 7 43747012 108555253 Rat 631513 Scl7 Serum cholesterol level QTL 7 4.1 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 37960569 82960569 Rat 2293685 Bmd21 Bone mineral density QTL 21 4.2 0.0003 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 7 47651439 92651439 Rat 10755453 Coatc12 Coat color QTL 12 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 31112832 76112832 Rat 631504 Cm27 Cardiac mass QTL 27 3.45 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 7 44421311 118198041 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 634326 Hc3 Hypercalciuria QTL 3 2.1 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 7 42787314 87787314 Rat 2293696 Bmd32 Bone mineral density QTL 32 5.1 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 7 47651439 92651439 Rat 7411605 Foco14 Food consumption QTL 14 24.1 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 34293282 79293282 Rat 1300151 Bp181 Blood pressure QTL 181 3.36 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 7 53612714 103945643 Rat 1559283 Emca4 Estrogen-induced mammary cancer QTL 4 3.7 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 7 62004452 101773158 Rat 1643004 Pain2 Pain QTL 2 1 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 7 9462246 98011544 Rat 738030 Anxrr8 Anxiety related response QTL 8 4.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 46590070 91590070 Rat 1300149 Cm6 Cardiac mass QTL 6 4.09 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 7 43747099 102228765 Rat 631534 Lnnr1 Liver neoplastic nodule remodeling QTL 1 3.85 0.001 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705) 7 34293282 79293282 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 2293707 Bss32 Bone structure and strength QTL 32 7.64 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 47651439 92651439 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 2293644 Bmd29 Bone mineral density QTL 29 5.4 0.0001 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 7 47651439 92651439 Rat 2300178 Bmd54 Bone mineral density QTL 54 5.3 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 7 47651439 92651439 Rat 1298528 Bp169 Blood pressure QTL 169 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 61074194 106074194 Rat 61428 Scl3 Serum cholesterol level QTL 3 3.2 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 44867533 89867533 Rat 1300132 Bp182 Blood pressure QTL 182 3.49 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 19654317 84928080 Rat 1576303 Ept7 Estrogen-induced pituitary tumorigenesis QTL 7 3.7 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 7 62004452 101773158 Rat 10402855 Bp379 Blood pressure QTL 379 0.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 29409683 74409683 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000007430 ⟹ ENSRNOP00000007430
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 65,691,435 - 65,705,716 (-) Ensembl Rnor_6.0 Ensembl 7 73,256,508 - 73,270,308 (-) Ensembl
RefSeq Acc Id:
NM_031714 ⟹ NP_113902
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 67,576,586 - 67,590,411 (-) NCBI mRatBN7.2 7 65,691,429 - 65,705,257 (-) NCBI Rnor_6.0 7 73,256,506 - 73,270,308 (-) NCBI Rnor_5.0 7 73,422,772 - 73,436,372 (-) NCBI RGSC_v3.4 7 69,930,464 - 69,944,267 (-) RGD Celera 7 62,792,438 - 62,806,237 (-) RGD
Sequence:
CACGAGGTTGTTACTGCCGTTTCTTCTCTGGAGGATCTTCAAGAGGGAAGGATTAGCATGTCGTCAATAATCAGAAAAGTGATCAGCACTTCAAAAGCCCCGGCGGCCATTGGTGCCTACAGCCAAGC
hide sequence
RefSeq Acc Id:
XM_063264217 ⟹ XP_063120287
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 67,576,587 - 67,590,493 (-) NCBI
RefSeq Acc Id:
NP_113902 ⟸ NM_031714
- UniProtKB:
P52759 (UniProtKB/Swiss-Prot), O35262 (UniProtKB/Swiss-Prot), Q9WUV8 (UniProtKB/Swiss-Prot), A6HR02 (UniProtKB/TrEMBL)
- Sequence:
MSSIIRKVISTSKAPAAIGAYSQAVLVDRTIYVSGQIGMDPSSGQLVPGGVAEEANQALKNLGEILKAAGCDFTNVVKTTVLLADINDFGTVNEIYKTYFQGNLPARAAYQVAALPKGSRIEIEAIAV
hide sequence
Ensembl Acc Id:
ENSRNOP00000007430 ⟸ ENSRNOT00000007430
RefSeq Acc Id:
XP_063120287 ⟸ XM_063264217
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2Q359 (UniProtKB/TrEMBL)
RGD ID: 13695282 Promoter ID: EPDNEW_R5807 Type: initiation region Name: Rida_1 Description: reactive intermediate imine deaminase A homolog SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 73,270,324 - 73,270,384 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-01-27
Rida
reactive intermediate imine deaminase A homolog
Hrsp12
heat-responsive protein 12
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-07-09
Hrsp12
heat-responsive protein 12
Symbol and Name updated to reflect Human and Mouse nomenclature
70877 APPROVED
Note Type
Note
Reference
gene_protein
23 kDa
70764
