Advanced Search (OLGA)

Gene: C5ar1 (complement C5a receptor 1) Rattus norvegicus

Analyze

Symbol:

C5ar1

Name:

complement C5a receptor 1

RGD ID:

70553

Description:

Enables complement component C5a binding activity and complement component C5a receptor activity. Involved in several processes, including animal organ regeneration; negative regulation of neuron apoptotic process; and response to lipopolysaccharide. Located in cell surface. Used to study adult respiratory distress syndrome; amyotrophic lateral sclerosis; neutropenia; obesity; and thrombosis. Biomarker of asthma and lung disease. Orthologous to human C5AR1 (complement C5a receptor 1); PARTICIPATES IN coagulation cascade pathway; complement system pathway; Staphylococcus aureus infection pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-diaminodiphenylmethane.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

C5a anaphylatoxin chemotactic receptor; C5a anaphylatoxin chemotactic receptor 1; C5a-R; C5aR; C5r1; complement C5a receptor; complement component 5, receptor 1; complement component 5a receptor 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	C5AR1 (complement C5a receptor 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, Panther, PhylomeDB
Mus musculus (house mouse):	C5ar1 (complement component 5a receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	C5ar1 (complement C5a receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	C5AR1 (complement C5a receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	C5AR1 (complement C5a receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	C5ar1 (complement C5a receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	C5AR1 (complement C5a receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	C5AR1 (complement C5a receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	C5ar1 (complement C5a receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	C5ar1 (complement C5a receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	C5ar1 (complement component 5a receptor 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	C5AR1 (complement C5a receptor 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	c5ar1 (C5a anaphylatoxin chemotactic receptor)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	c5ar1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	c5ar1	Alliance	DIOPT (Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	86,077,309 - 86,088,001 (-)	NCBI	GRCr8	GRCr8		GRCr8
mRatBN7.2	1	76,948,622 - 76,959,826 (-)	NCBI	mRatBN7.2	mRatBN7.2
UTH_Rnor_SHR_Utx	1	82,324,234 - 82,334,714 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	90,888,270 - 90,898,748 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	84,079,341 - 84,089,811 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	78,186,777 - 78,195,132 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	78,186,776 - 78,195,328 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	79,452,051 - 79,458,856 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	1	71,439,044 - 71,449,243 (-)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

acute necrotizing pancreatitis (ISO)

adult respiratory distress syndrome (IMP)

Alzheimer's disease (ISO)

amyotrophic lateral sclerosis (IMP)

asthma (IEP,ISO)

chronic obstructive pulmonary disease (ISO)

Endotoxemia (IEP)

Experimental Liver Cirrhosis (ISO)

lung disease (IEP,ISO)

Middle East respiratory syndrome (ISO)

Multiple Organ Failure (IMP)

neutropenia (IDA)

obesity (IDA)

Reperfusion Injury (IMP)

rhinitis (ISO)

Sepsis (IEP,IMP)

severe acute respiratory syndrome (ISO)

systemic lupus erythematosus (ISO)

thrombosis (IMP)

toxic shock syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-nicotine (ISO)

1,1-dichloroethene (ISO)

1-naphthyl isothiocyanate (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2-naphthylamine (ISO)

3,3',4,4'-tetrachlorobiphenyl (ISO)

4,4'-diaminodiphenylmethane (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxynon-2-enal (ISO)

4-hydroxyphenyl retinamide (ISO)

acetamide (EXP)

actinomycin D (ISO)

Aflatoxin B2 alpha (ISO)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

amphetamine (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

Azoxymethane (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

cadmium atom (EXP)

cadmium dichloride (EXP,ISO)

camptothecin (ISO)

carbon nanotube (ISO)

cisplatin (ISO)

copper atom (EXP)

copper(0) (EXP)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

D-glucose (ISO)

dextran sulfate (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP)

dichlorine (EXP)

dimethylselenide (ISO)

dioxygen (EXP)

doxorubicin (EXP)

endosulfan (EXP)

ethanol (ISO)

fenbuconazole (ISO)

fructose (ISO)

furan (EXP)

genistein (ISO)

gentamycin (EXP)

glucose (ISO)

indole-3-methanol (EXP)

ionomycin (ISO)

lead diacetate (ISO)

leflunomide (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methapyrilene (ISO)

methotrexate (ISO)

Muraglitazar (EXP)

N-nitrosodimethylamine (EXP)

N-Nitrosopyrrolidine (ISO)

nickel atom (ISO)

nicotine (ISO)

Nutlin-3 (ISO)

ozone (EXP,ISO)

perfluorohexanesulfonic acid (ISO)

phorbol 13-acetate 12-myristate (ISO)

pioglitazone (ISO)

pravastatin (EXP,ISO)

quercetin (ISO)

reactive oxygen species (ISO)

resorcinol (ISO)

silicon dioxide (EXP,ISO)

simvastatin (EXP)

sodium arsenate (ISO)

sodium arsenite (ISO)

Soman (EXP)

Tesaglitazar (EXP)

tetrachloromethane (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (ISO)

triphenyl phosphate (ISO)

tris(2-butoxyethyl) phosphate (ISO)

tris(2-chloroethyl) phosphate (ISO)

urethane (ISO)

XL147 (ISO)

zaragozic acid A (EXP,ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway (ISO)

amyloid-beta clearance (ISO)

animal organ regeneration (IEP)

astrocyte activation (ISO)

cell proliferation in hindbrain (IMP)

chemotaxis (IEA)

cognition (ISO)

complement component C5a signaling pathway (ISO)

complement receptor mediated signaling pathway (IBA,ISO)

defense response to Gram-positive bacterium (ISO)

G protein-coupled receptor signaling pathway (IEA,ISO)

inflammatory response (IBA)

microglial cell activation (ISO)

mRNA transcription by RNA polymerase II (ISO,ISS)

negative regulation of neuron apoptotic process (IDA,IMP)

neutrophil chemotaxis (ISO)

phospholipase C-activating G protein-coupled receptor signaling pathway (IBA)

positive regulation of angiogenesis (ISO)

positive regulation of cytosolic calcium ion concentration (IBA,IDA)

positive regulation of epithelial cell proliferation (ISO,ISS)

positive regulation of ERK1 and ERK2 cascade (ISO,ISS)

positive regulation of immune system process (IEA)

positive regulation of macrophage chemotaxis (ISO)

positive regulation of neutrophil chemotaxis (ISO)

positive regulation of vascular endothelial growth factor production (ISO)

presynapse organization (ISO)

response to lipopolysaccharide (IEP)

response to peptidoglycan (ISO)

signal transduction (IEA)

Cellular Component

apical part of cell (ISO,ISS)

basolateral plasma membrane (IBA,ISO,ISS)

cell surface (IDA)

cytoplasmic vesicle (IEA)

membrane (IEA)

plasma membrane (IBA,IEA,ISO)

Molecular Function

complement component C5a binding (IDA)

complement component C5a receptor activity (IBA,IDA,ISO,TAS)

complement receptor activity (IEA)

G protein-coupled receptor activity (IBA,IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

coagulation cascade pathway (IEA)

complement system pathway (IEA)

Staphylococcus aureus infection pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	cDNA cloning and characterization of rat C5a anaphylatoxin receptor.	Akatsu H, etal., Microbiol Immunol 1997;41(7):575-80.
2.	Alterations in lung mast cell populations in patients with chronic obstructive pulmonary disease.	Andersson CK, etal., Am J Respir Crit Care Med. 2010 Feb 1;181(3):206-17. Epub 2009 Nov 19.
3.	Protective effect of a human C5a receptor antagonist against hepatic ischaemia-reperfusion injury in rats.	Arumugam TV, etal., J Hepatol. 2004 Jun;40(6):934-41.
4.	Characterization of C3a and C5a receptors in rat cerebellar granule neurons during maturation. Neuroprotective effect of C5a against apoptotic cell death.	Benard M, etal., J Biol Chem. 2004 Oct 15;279(42):43487-96. Epub 2004 Aug 2.
5.	Role of complement anaphylatoxin receptors (C3aR, C5aR) in the development of the rat cerebellum.	Benard M, etal., Mol Immunol. 2008 Aug;45(14):3767-74. Epub 2008 Jul 16.
6.	Complement factor C5a exerts an anti-inflammatory effect in acute pancreatitis and associated lung injury.	Bhatia M, etal., Am J Physiol Gastrointest Liver Physiol. 2001 May;280(5):G974-8.
7.	Amnionitis and T strain mycoplasmemia.	Caspi E, etal., Am J Obstet Gynecol. 1971 Dec 15;111(8):1102-6.
8.	Expression of a functional C5a receptor in regenerating hepatocytes and its involvement in a proliferative signaling pathway in rat.	Daveau M, etal., J Immunol. 2004 Sep 1;173(5):3418-24.
9.	Complement C5a receptor-mediated signaling may be involved in neurodegeneration in Alzheimer's disease.	Farkas I, etal., J Immunol. 2003 Jun 1;170(11):5764-71.
10.	The complement anaphylatoxin C5a induces apoptosis in adrenomedullary cells during experimental sepsis.	Flierl MA, etal., PLoS One. 2008 Jul 2;3(7):e2560.
11.	Expression of the anaphylatoxin receptors C3aR and C5aR is increased in fatal asthma.	Fregonese L, etal., J Allergy Clin Immunol. 2005 Jun;115(6):1148-54.
12.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
13.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
14.	Neutrophil C5a receptor and the outcome in a rat model of sepsis.	Guo RF, etal., FASEB J. 2003 Oct;17(13):1889-91. Epub 2003 Aug 1.
15.	Complement C5a receptor antagonist attenuates multiple organ injury in a model of ruptured abdominal aortic aneurysm.	Harkin DW, etal., J Vasc Surg. 2004 Jan;39(1):196-206.
16.	Complement factor 5 is a quantitative trait gene that modifies liver fibrogenesis in mice and humans.	Hillebrandt S, etal., Nat Genet. 2005 Aug;37(8):835-43. Epub 2005 Jul 3.
17.	Has small-scale audio-visual dental health education a viable future?	Hirsch RS and Clarke NG, Community Dent Oral Epidemiol 1977 Jul;5(4):160-3.
18.	Complement Receptor C5aR1 Inhibition Reduces Pyroptosis in hDPP4-Transgenic Mice Infected with MERS-CoV.	Jiang Y, etal., Viruses. 2019 Jan 9;11(1). pii: v11010039. doi: 10.3390/v11010039.
19.	Overexpression of the anaphylatoxin receptors, complement anaphylatoxin 3a receptor and complement anaphylatoxin 5a receptor, in the nasal mucosa of patients with mild and severe persistent allergic rhinitis.	Jun SW, etal., J Allergy Clin Immunol. 2008 Jul;122(1):119-25. Epub 2008 Jun 5.
20.	A regulatory role for the C5a anaphylatoxin in type 2 immunity in asthma.	Kohl J, etal., J Clin Invest. 2006 Mar;116(3):783-96.
21.	The role of C5a in the development of thrombotic glomerulonephritis in rats.	Kondo C, etal., Clin Exp Immunol. 2001 May;124(2):323-9.
22.	Complement-mediated regulation of the IL-17A axis is a central genetic determinant of the severity of experimental allergic asthma.	Lajoie S, etal., Nat Immunol. 2010 Oct;11(10):928-35. Epub 2010 Aug 29.
23.	C5aR and C3aR antagonists each inhibit diet-induced obesity, metabolic dysfunction, and adipocyte and macrophage signaling.	Lim J, etal., FASEB J. 2013 Feb;27(2):822-31. doi: 10.1096/fj.12-220582. Epub 2012 Nov 1.
24.	Gene Data Set	MGD Curation, June 12, 2002
25.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
26.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
27.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
28.	Comparative anti-inflammatory activities of antagonists to C3a and C5a receptors in a rat model of intestinal ischaemia/reperfusion injury.	Proctor LM, etal., Br J Pharmacol. 2004 Jun;142(4):756-64. Epub 2004 May 24.
29.	Complement inhibitors selectively attenuate injury following administration of cobra venom factor to rats.	Proctor LM, etal., Int Immunopharmacol. 2006 Aug;6(8):1224-32. Epub 2006 Apr 3.
30.	GOA pipeline	RGD automated data pipeline
31.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
32.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
33.	Expression and function of the C5a receptor in rat alveolar epithelial cells.	Riedemann NC, etal., J Immunol 2002 Feb 15;168(4):1919-25.
34.	Molecular cloning and expression of the functional rat C5a receptor.	Rothermel E, etal., Mol Immunol 1997 Aug-Sep;34(12-13):877-86.
35.	Response-selective C5a agonists: differential effects on neutropenia and hypotension in the rat.	Short AJ, etal., Br J Pharmacol. 1999 Oct;128(3):511-4.
36.	Complement Inhibition Alleviates Paraquat-Induced Acute Lung Injury.	Sun S, etal., Am J Respir Cell Mol Biol. 2011 Mar 18.
37.	Use of monoclonal antibodies to assess expression of anaphylatoxin receptors in rat and murine models of lung inflammation.	Tschernig T, etal., Exp Toxicol Pathol. 2007 Aug;58(6):419-25. Epub 2007 Jun 1.
38.	The complement factor C5a contributes to pathology in a rat model of amyotrophic lateral sclerosis.	Woodruff TM, etal., J Immunol. 2008 Dec 15;181(12):8727-34.

Additional References at PubMed

PMID:1401897	PMID:1472004	PMID:10571060	PMID:12477932	PMID:15489334	PMID:16452172	PMID:17114491	PMID:17703884	PMID:19020281	PMID:19561098	PMID:19917081	PMID:21460748
PMID:21753735	PMID:22099750	PMID:22496247	PMID:22960554	PMID:25917954	PMID:28690033	PMID:34637270	PMID:38165570	PMID:38326494

Genomics

Comparative Map Data

C5ar1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	86,077,309 - 86,088,001 (-)	NCBI	GRCr8	GRCr8		GRCr8
mRatBN7.2	1	76,948,622 - 76,959,826 (-)	NCBI	mRatBN7.2	mRatBN7.2
UTH_Rnor_SHR_Utx	1	82,324,234 - 82,334,714 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	90,888,270 - 90,898,748 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	84,079,341 - 84,089,811 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	78,186,777 - 78,195,132 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	78,186,776 - 78,195,328 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	79,452,051 - 79,458,856 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	1	71,439,044 - 71,449,243 (-)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

C5AR1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	47,307,477 - 47,322,066 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	47,290,023 - 47,322,066 (+)	Ensembl			hg38	GRCh38
GRCh37	19	47,813,118 - 47,825,323 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	52,504,944 - 52,517,167 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	19	52,504,970 - 52,517,172	NCBI
Celera	19	44,616,992 - 44,629,218 (+)	NCBI		Celera
Cytogenetic Map	19	q13.32	NCBI
HuRef	19	44,237,376 - 44,249,615 (+)	NCBI		HuRef
CHM1_1	19	47,815,295 - 47,827,515 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	50,129,142 - 50,147,539 (+)	NCBI		T2T-CHM13v2.0

C5ar1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	15,980,668 - 15,993,465 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	15,980,668 - 15,993,465 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	7	16,246,743 - 16,259,540 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	16,246,743 - 16,259,540 (-)	Ensembl			mm10	GRCm38
MGSCv37	7	16,832,092 - 16,844,889 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	7	15,405,265 - 15,417,773 (-)	NCBI		MGSCv36	mm8
Celera	7	13,440,651 - 13,453,692 (-)	NCBI		Celera
Cytogenetic Map	7	A2	NCBI
cM Map	7	8.77	NCBI

C5ar1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955574	1,221,187 - 1,231,655 (+)	Ensembl
ChiLan1.0	NW_004955574	1,221,942 - 1,229,634 (+)	NCBI	ChiLan1.0	ChiLan1.0

C5AR1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	53,452,406 - 53,469,468 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	55,322,450 - 55,339,475 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	44,293,612 - 44,310,430 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	52,950,317 - 52,966,146 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	52,950,317 - 52,966,146 (+)	Ensembl			panPan2	panpan1.1

C5AR1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	108,659,637 - 108,704,217 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	108,659,637 - 108,675,401 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	108,141,196 - 108,156,800 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	109,185,920 - 109,201,726 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	109,185,920 - 109,228,780 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	108,852,877 - 108,868,613 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	108,497,215 - 108,512,964 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	109,365,784 - 109,381,523 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

C5ar1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	19,408,006 - 19,415,325 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936664	1,032,304 - 1,033,374 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936664	1,026,216 - 1,033,438 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

C5AR1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	53,097,142 - 53,111,565 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	53,097,162 - 53,111,563 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	48,523,114 - 48,537,524 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

C5AR1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	40,633,540 - 40,651,839 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	40,633,448 - 40,652,845 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666073	20,348,637 - 20,386,343 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

C5ar1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624832	6,414,587 - 6,423,394 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624832	6,413,169 - 6,423,394 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

C5ar1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	172,803,089 - 172,813,257 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in C5ar1
70 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	87
Count of miRNA genes:	69
Interacting mature miRNAs:	82
Transcripts:	ENSRNOT00000073034
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331732	Srn4	Serum renin concentration QTL 4	4.467		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	1	43457837	87558729	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	51940904	101229020	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	39728272	132889942	Rat
4889929	Bss87	Bone structure and strength QTL 87	6.7		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	46302615	91302615	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
1331792	Rf29	Renal function QTL 29	4.589		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	1	43457837	87558729	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	46302615	91302615	Rat
8552900	Pigfal1	Plasma insulin-like growth factor 1 level QTL 1	7.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	43509952	88509952	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	51940904	168768703	Rat
1354643	Foco2	Food consumption QTL 2	7.17	0.0001	eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	1	42122968	87122968	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	46302615	91302615	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	83019780	128019780	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	46302615	91302615	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	66404680	111404680	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34184556	172281316	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	46302615	91302615	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	81269860	99645535	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	66009857	160501508	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
1331778	Rf28	Renal function QTL 28	4.66		urine potassium amount (VT:0010539)	urine potassium excretion rate (CMO:0000761)	1	43457837	87558729	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	46302615	91302615	Rat
1302788	Scl19	Serum cholesterol QTL 19	4.6	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	66400974	132889942	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	84107164	115183752	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	51511344	153680016	Rat
1331785	Rf27	Renal function QTL 27	4.643		urine sodium amount (VT:0006274)	urine sodium level (CMO:0000129)	1	30708375	87558729	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	65405637	96805205	Rat
4889962	Bss94	Bone structure and strength QTL 94	3.8		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	51909206	91302615	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	58769992	103769992	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	46302615	91302615	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	66077886	111077886	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	46302615	91302615	Rat
9589820	Insglur3	Insulin/glucose ratio QTL 3	10.75	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	1	43509952	88509952	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	52891222	109116986	Rat
1354599	Bw29	Body weight QTL 29	3.46	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	42122968	87122968	Rat
4889919	Bss86	Bone structure and strength QTL 86	4.1		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	1	46302615	91302615	Rat
8552948	Pigfal11	Plasma insulin-like growth factor 1 level QTL 11	4.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	43509952	88509952	Rat

Markers in Region

RH144047

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	76,949,182 - 76,949,331 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	78,186,812 - 78,186,960	NCBI	Rnor6.0
Rnor_5.0	1	79,452,086 - 79,452,234	UniSTS	Rnor5.0
Celera	1	71,439,079 - 71,439,227	UniSTS
RH 3.4 Map	1	772.8	UniSTS
Cytogenetic Map	1	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	153	91	90	59	92	59	6	356	192	11	132	81	88	31	9	9

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053619	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105863	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB003042	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF090996	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC078770	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230454	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ235138	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X65862	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X95990	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	Y09613	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000073034 ⟹ ENSRNOP00000064558

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	1	78,186,776 - 78,195,328 (-)	Ensembl

RefSeq Acc Id:

NM_053619 ⟹ NP_446071

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	86,077,316 - 86,087,749 (-)	NCBI
mRatBN7.2	1	76,949,147 - 76,959,577 (-)	NCBI
Rnor_6.0	1	78,186,777 - 78,195,132 (-)	NCBI
Rnor_5.0	1	79,452,051 - 79,458,856 (-)	NCBI
Celera	1	71,439,044 - 71,449,243 (-)	RGD

Sequence:

show sequence

CCGTTGCTGTCGGGTCACCACAGAGCCCAGGAGAAGCCAGGACATGGACCCCATAAGTAACGAC
AGCAGTGAAATCACCTATGATTACTCTGATGGAACCCCAAATCCTGACATGCCTGCAGATGGCG
TTTACATTCCGAAGATGGAACCTGGGGACATTGCAGCCCTTATTATCTACTTGGCCGTGTTCCT
GGTAGGAGTTACCGGAAATGCCCTGGTGGTGTGGGTGACAGCCTTTGAGGCCAAACGTACTGTC
AACGCCATTTGGTTTCTGAATCTGGCGGTGGCCGACCTCCTCTCGTGCTTGGCACTGCCTATCC
TGTTTACGTCCATTGTAAAGCATAACCACTGGCCCTTCGGTGACCAGGCCTGTATAGTCCTGCC
CTCGCTCATTCTGCTCAACATGTACTCCAGCATCCTGCTGCTGGCCACTATTAGTGCCGACCGT
TTCCTGCTGGTGTTCAAACCCATCTGGTGTCAGAAGTTCCGCCGGCCTGGCCTGGCCTGGATGG
CTTGCGGAGTAACCTGGGTCTTAGCATTGCTCCTCACCATTCCGTCCTTCGTGTTCCGGCGGAT
ACATAAGGACCCCTACTCAGATAGCATTCTATGTAATATTGACTATAGTAAGGGTCCGTTCTTC
ATAGAGAAGGCTATAGCCATCCTGCGGCTGATGGTGGGTTTCGTGTTGCCTCTGCTCACTCTTA
ACATCTGCTACACCTTCCTCCTGATCCGGACCTGGAGTCGCAAGGCCACGCGCTCCACCAAGAC
GCTCAAAGTGGTGATGGCGGTGGTCACATGTTTCTTTGTCTTCTGGCTACCCTACCAGGTAACA
GGGGTGATATTAGCTTGGCTGCCCCGGTCCTCATCCACTTTTCAGTCAGTGGAGAGGCTGAACT
CCTTGTGCGTTTCCCTGGCCTACATCAACTGCTGTGTTAACCCTATCATCTACGTCATGGCTGG
CCAGGGTTTCCATGGGAGACTCCGAAGGTCACTCCCCAGCATCATACGAAACGTGCTCTCTGAG
GACTCCTTGGGCAGGGACAGCAAGAGTTTCACTCGGTCCACGATGGATACCTCCACCCAGAAGA
GTCAGGCAGTGTAGAGGAGATGCCACAACTGCCTAGCTGCTCCTTTTCCAGTCCTCCTCCCCTT
CCTCCTTCCTCCTCTCACCCCTCCTCCCTTCCTCCCATCTCTTTGCATGTTTAATTTTATGTGA
TTCTCTTTAAATTGCCCTGACTAGCCTTGAGCCCAGGATGCTCACGGATGCTGAGATTATAGGT
AAAAATTCCTTTGGAGAGAAACATTACATTAAGATATTACTGGGCTTTTTTTCTGAGGCAGGCC
TTGGCCTCGTTGCCCATCTGCAGTGTCTAGGCAGATACACCTAGTGATGACGTCTAGGGGTCAG
GTAACAGAGAACCCAGGTCTCGAGGGAACCCGGGGCTCACGGATACACTACGTGAGTAAGCTAT
AGCCCTAGACTCCAGGCAACAAATAAGCACCCACCCTTTATTTCTTTTCTATGTCTGATTTTTT
TGTTTATTTGAGACAAAGTCCATGTAGGCTAGTCTAGCCATGGACTCCTCCTGTGATCATCCTC
CAGAGGTCGAGACTGTAGACCTGTGCTACCATGCCCGACCTATCCTTTATTTCTGCAATTTTGT
CTTTTCAAAAATGGTATTCGACAGAACCCAACATATCCAAGTTTTGTAAAAACAACTGTGCACG
GCTTACACGATAAAAAATTTTTGTTTTTTTAAAAAGGCAAAAAA

hide sequence

RefSeq Acc Id:

XM_039105863 ⟹ XP_038961791

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	86,077,309 - 86,088,001 (-)	NCBI
mRatBN7.2	1	76,948,622 - 76,959,826 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_446071	(Get FASTA)	NCBI Sequence Viewer
	XP_038961791	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAG24260	(Get FASTA)	NCBI Sequence Viewer
	AAH78770	(Get FASTA)	NCBI Sequence Viewer
	BAA20263	(Get FASTA)	NCBI Sequence Viewer
	CAA46692	(Get FASTA)	NCBI Sequence Viewer
	CAA70825	(Get FASTA)	NCBI Sequence Viewer
	EDM08332	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000098952
GenBank Protein	P97520	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_446071 ⟸ NM_053619

- UniProtKB:

O09088 (UniProtKB/Swiss-Prot), P97520 (UniProtKB/Swiss-Prot), A6J8A2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDPISNDSSEITYDYSDGTPNPDMPADGVYIPKMEPGDIAALIIYLAVFLVGVTGNALVVWVTA
FEAKRTVNAIWFLNLAVADLLSCLALPILFTSIVKHNHWPFGDQACIVLPSLILLNMYSSILLL
ATISADRFLLVFKPIWCQKFRRPGLAWMACGVTWVLALLLTIPSFVFRRIHKDPYSDSILCNID
YSKGPFFIEKAIAILRLMVGFVLPLLTLNICYTFLLIRTWSRKATRSTKTLKVVMAVVTCFFVF
WLPYQVTGVILAWLPRSSSTFQSVERLNSLCVSLAYINCCVNPIIYVMAGQGFHGRLRRSLPSI
IRNVLSEDSLGRDSKSFTRSTMDTSTQKSQAV

hide sequence

Ensembl Acc Id:

ENSRNOP00000064558 ⟸ ENSRNOT00000073034

RefSeq Acc Id:	XP_038961791 ⟸ XM_039105863
- Peptide Label:	isoform X1

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P97520-F1-model_v2	AlphaFold	P97520	1-352	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:70553	AgrOrtholog
BioCyc Gene	G2FUF-60616	BioCyc
Ensembl Genes	ENSRNOG00000047800	Ensembl
	ENSRNOG00000074439	ENTREZGENE
Ensembl Transcript	ENSRNOT00000132351	ENTREZGENE
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7121456	IMAGE-MGC_LOAD
InterPro	Anphylx_rcpt	UniProtKB/Swiss-Prot
	Formyl_rcpt-rel	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot
KEGG Report	rno:113959	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:93295	IMAGE-MGC_LOAD
NCBI Gene	113959	ENTREZGENE
PANTHER	C5A ANAPHYLATOXIN CHEMOTACTIC RECEPTOR 1	UniProtKB/Swiss-Prot
	PTHR24225	UniProtKB/Swiss-Prot
Pfam	7tm_1	UniProtKB/Swiss-Prot
PhenoGen	C5ar1	PhenoGen
PRINTS	ANPHYLATOXNR	UniProtKB/Swiss-Prot
	C5ANPHYLTXNR	UniProtKB/Swiss-Prot
	GPCRRHODOPSN	UniProtKB/Swiss-Prot
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000047800	RatGTEx
	ENSRNOG00000074439	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot
UniProt	A0ABK0KWS8_RAT	UniProtKB/TrEMBL
	A6J8A2	ENTREZGENE, UniProtKB/TrEMBL
	C5AR1_RAT	UniProtKB/Swiss-Prot
	O09088	ENTREZGENE
	P97520	ENTREZGENE
UniProt Secondary	O09088	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-08-18	C5ar1	complement C5a receptor 1	C5ar1	complement component 5a receptor 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-18	C5ar1	complement component 5a receptor 1	C5r1	complement component 5, receptor 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	C5r1	complement component 5, receptor 1			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_function	receptor for complement 5	70320
gene_function	receptor for complement 5	70679
gene_process	functions in lung inflamatory response	70320
gene_process	functions in lung inflamatory response	70679

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)