Advanced Search (OLGA)

Gene: Lrrc15 (leucine rich repeat containing 15) Rattus norvegicus

Analyze

Symbol:

Lrrc15

Name:

leucine rich repeat containing 15

RGD ID:

70551

Description:

Predicted to enable several functions, including fibronectin binding activity; laminin binding activity; and protein sequestering activity. Predicted to be involved in several processes, including host-mediated suppression of symbiont invasion; negative regulation of protein localization to plasma membrane; and receptor-mediated virion attachment to host cell. Predicted to act upstream of or within entry receptor-mediated virion attachment to host cell. Located in cell surface. Is active in glutamatergic synapse and postsynaptic density membrane. Orthologous to human LRRC15 (leucine rich repeat containing 15); INTERACTS WITH 17beta-estradiol 3-benzoate; acrylamide; alpha-Zearalanol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

leucine-rich repeat protein induced by amyloid-beta; leucine-rich repeat protein induced by beta amyloid; leucine-rich repeat protein induced by beta-amyloid; leucine-rich repeat-containing protein 15; Lib; rLib

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	LRRC15 (leucine rich repeat containing 15)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Lrrc15 (leucine rich repeat containing 15)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Lrrc15 (leucine rich repeat containing 15)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LRRC15 (leucine rich repeat containing 15)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	LRRC15 (leucine rich repeat containing 15)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Lrrc15 (leucine rich repeat containing 15)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	LRRC15 (leucine rich repeat containing 15)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LRRC15 (leucine rich repeat containing 15)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Lrrc15 (leucine rich repeat containing 15)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Lrrc15 (leucine rich repeat containing 15)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	LRRC15 (leucine rich repeat containing 15)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Lrrc15 (leucine rich repeat containing 15)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	lrrc15 (leucine rich repeat containing 15)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	lrrc15 (leucine rich repeat containing 15)	Alliance	DIOPT (OMA\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG7509	Alliance	DIOPT (InParanoid\|OMA\|OrthoInspector)
Drosophila melanogaster (fruit fly):	CG7509	Alliance	DIOPT (OMA\|OrthoInspector\|SonicParanoid)
Caenorhabditis elegans (roundworm):	egg-6	Alliance	DIOPT (OrthoInspector\|PhylomeDB)
Caenorhabditis elegans (roundworm):	lron-1	Alliance	DIOPT (OMA\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	lrrc15	Alliance	DIOPT (OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	lrrc15	Alliance	DIOPT (OMA\|OrthoFinder\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	83,974,708 - 83,989,157 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	11	83,974,695 - 83,989,146 (+)	Ensembl				GRCr8
mRatBN7.2	11	70,469,817 - 70,484,268 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	70,469,804 - 70,484,267 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	11	79,322,922 - 79,324,658 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	71,957,413 - 71,959,149 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	71,012,023 - 71,013,759 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	74,040,846 - 74,052,179 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	74,050,166 - 74,051,902 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	11	77,102,016 - 77,113,020 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	11	72,377,090 - 72,378,826 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	11	69,452,040 - 69,453,776 (+)	NCBI		Celera
RGSC_v3.1	11	72,434,678 - 72,436,415 (+)	NCBI
Cytogenetic Map	11	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

17beta-estradiol (ISO)

17beta-estradiol 3-benzoate (EXP)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2-bromohexadecanoic acid (ISO)

4,4'-sulfonyldiphenol (ISO)

acrylamide (EXP)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

ammonium chloride (EXP)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

C60 fullerene (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

cantharidin (ISO)

capecitabine (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

choline (ISO)

Didecyldimethylammonium (ISO)

doxorubicin (ISO)

ethylparaben (ISO)

flavonoids (EXP)

folic acid (ISO)

genistein (ISO)

graphite (EXP)

L-methionine (ISO)

Licochalcone B (ISO)

lipopolysaccharide (ISO)

manganese(II) chloride (EXP)

N-methyl-4-phenylpyridinium (EXP)

N-nitrosodiethylamine (EXP)

okadaic acid (ISO)

ozone (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

phenethyl caffeate (EXP)

potassium dichromate (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

sodium arsenite (ISO)

tetrachloroethene (ISO)

thiram (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

triptonide (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

host-mediated suppression of symbiont invasion (IEA,ISO)

negative regulation of protein localization to plasma membrane (IEA,ISO)

positive regulation of cell migration (IEA,ISO)

receptor-mediated virion attachment to host cell (IEA,ISO)

regulation of postsynaptic cytosolic calcium ion concentration (IEA)

regulation of postsynaptic membrane potential (IEA)

Cellular Component

apical plasma membrane (IEA,ISO)

cell surface (IDA)

glutamatergic synapse (IDA)

plasma membrane (IEA,ISO,ISS)

postsynaptic density membrane (IDA)

postsynaptic membrane (IDA)

Molecular Function

collagen binding (IEA,ISO)

fibronectin binding (IEA,ISO)

laminin binding (IEA,ISO)

protein binding (ISO)

protein sequestering activity (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	The metabotropic glutamate receptor (mGluR1 alpha) is concentrated at perisynaptic membrane of neuronal subpopulations as detected by immunogold reaction.	Baude A, etal., Neuron. 1993 Oct;11(4):771-87.
2.	Effects of guanethidine on histamine release during reflex vasodilatation in the dog.	Condorelli M, etal., Br J Pharmacol 1977 Jul;60(3):379-84.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	A novel member of the leucine-rich repeat superfamily induced in rat astrocytes by beta-amyloid.	Satoh K, etal., Biochem Biophys Res Commun 2002 Jan 18;290(2):756-62.

Additional References at PubMed

PMID:9069287	PMID:12514201	PMID:15229243	PMID:15829628	PMID:16098915	PMID:17154259	PMID:18385238	PMID:18582438	PMID:18948402	PMID:19056867	PMID:20151362	PMID:23376485
PMID:23533145

Genomics

Comparative Map Data

Lrrc15
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	83,974,708 - 83,989,157 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	11	83,974,695 - 83,989,146 (+)	Ensembl				GRCr8
mRatBN7.2	11	70,469,817 - 70,484,268 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	70,469,804 - 70,484,267 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	11	79,322,922 - 79,324,658 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	71,957,413 - 71,959,149 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	71,012,023 - 71,013,759 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	74,040,846 - 74,052,179 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	74,050,166 - 74,051,902 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	11	77,102,016 - 77,113,020 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	11	72,377,090 - 72,378,826 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	11	69,452,040 - 69,453,776 (+)	NCBI		Celera
RGSC_v3.1	11	72,434,678 - 72,436,415 (+)	NCBI
Cytogenetic Map	11	q22	NCBI

LRRC15
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	194,355,249 - 194,369,743 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	194,355,249 - 194,369,743 (-)	Ensembl			hg38	GRCh38
GRCh37	3	194,075,978 - 194,090,472 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	195,557,273 - 195,571,761 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	3	195,557,280 - 195,571,769	NCBI
Celera	3	192,490,979 - 192,505,408 (-)	NCBI		Celera
Cytogenetic Map	3	q29	NCBI
HuRef	3	191,455,388 - 191,469,818 (-)	NCBI		HuRef
CHM1_1	3	194,038,840 - 194,053,338 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	197,053,410 - 197,067,898 (-)	NCBI		T2T-CHM13v2.0

Lrrc15
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	16	30,088,120 - 30,102,072 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	16	30,088,120 - 30,102,074 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	16	30,269,302 - 30,283,254 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	16	30,269,302 - 30,283,256 (-)	Ensembl			mm10	GRCm38
MGSCv37	16	30,269,388 - 30,283,340 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	16	30,189,051 - 30,202,972 (-)	NCBI		MGSCv36	mm8
Celera	16	30,776,217 - 30,790,244 (-)	NCBI		Celera
Cytogenetic Map	16	B2	NCBI
cM Map	16	21.23	NCBI

Lrrc15
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955420	14,407,926 - 14,409,656 (+)	Ensembl
ChiLan1.0	NW_004955420	14,401,080 - 14,410,277 (+)	NCBI	ChiLan1.0	ChiLan1.0

LRRC15
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	192,278,010 - 192,292,470 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	192,286,051 - 192,290,830 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	191,655,181 - 191,666,727 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	201,968,851 - 201,980,636 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	201,970,221 - 201,974,286 (-)	Ensembl			panPan2	panpan1.1

LRRC15
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	33	31,332,502 - 31,345,895 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	33	31,332,496 - 31,342,583 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	33	31,364,113 - 31,377,495 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	33	31,592,490 - 31,605,874 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
UMICH_Zoey_3.1	33	31,389,449 - 31,402,834 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	33	31,418,407 - 31,431,789 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	33	32,105,985 - 32,118,522 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Lrrc15
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	123,802,384 - 123,808,008 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936711	441,804 - 443,615 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936711	441,804 - 443,615 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LRRC15
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	131,343,940 - 131,345,685 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	13	131,339,778 - 131,354,691 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	140,841,378 - 140,849,189 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LRRC15
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	15	88,451,090 - 88,465,241 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	15	88,455,015 - 88,456,760 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666041	62,137,819 - 62,152,046 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Lrrc15
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624730	63,400,463 - 63,409,006 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Lrrc15
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	4	15,184,617 - 15,186,362 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Lrrc15
72 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	60
Count of miRNA genes:	56
Interacting mature miRNAs:	60
Transcripts:	ENSRNOT00000002348
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
724554	Iddm17	Insulin dependent diabetes mellitus QTL 17		0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	46443168	91443168	Rat
70208	Niddm22	Non-insulin dependent diabetes mellitus QTL 22	3.61		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	11	73308487	96070872	Rat
1581565	Pur10	Proteinuria QTL 10		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	58272363	96350770	Rat
4889859	Pur28	Proteinuria QTL 28	19.5	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	11	58928336	99753367	Rat
10755497	Bp388	Blood pressure QTL 388	2.76		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	32943067	89836615	Rat
1549848	Bvd6	Brain ventricular dilatation QTL 6	3.1	0.0001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	11	79618519	99753367	Rat
10058954	Gmadr7	Adrenal mass QTL 7	2.49	0.0049	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	11	73850894	99753367	Rat
1300135	Rf19	Renal function QTL 19	3.38		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	11	54415391	96071021	Rat
2298551	Neuinf10	Neuroinflammation QTL 10	3.7		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	11	58931822	92356038	Rat
1354656	Bvd3	Brain ventricular dilatation QTL 3	3.64	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	11	82951028	96351019	Rat
2312566	Glom20	Glomerulus QTL 20	3.6	0.001	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	11	57754837	96071021	Rat
724563	Uae10	Urinary albumin excretion QTL 10	6		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	11	20193549	96351019	Rat
724561	Plsm4	Polydactyly-luxate syndrome (PLS) morphotypes QTL 4		0.0003	forelimb integrity trait (VT:0010562)	front foot phalanges count (CMO:0001947)	11	67962184	99753367	Rat
4889521	Gluco62	Glucose level QTL 62	2.82	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	68599321	96497754	Rat
7411658	Foco27	Food consumption QTL 27	16.2	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	11	69855943	99753367	Rat
631506	Bp104	Blood pressure QTL 104	2.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	73308315	99753367	Rat
1581572	Uae35	Urinary albumin excretion QTL 35		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	58272363	96350770	Rat
1300110	Stl7	Serum triglyceride level QTL 7	4.64		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	11	51071021	96071021	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
15	8	30	121	45	53	35	22	35	6	164	69	11	111	40	84	18	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_145083	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB071036	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473999	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000002348 ⟹ ENSRNOP00000064155

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	11	74,050,166 - 74,051,902 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000095941 ⟹ ENSRNOP00000091199

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	11	83,974,695 - 83,989,146 (+)	Ensembl
mRatBN7.2 Ensembl	11	70,469,804 - 70,484,267 (+)	Ensembl

RefSeq Acc Id:

NM_145083 ⟹ NP_659551

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	83,974,708 - 83,989,157 (+)	NCBI
mRatBN7.2	11	70,469,817 - 70,484,268 (+)	NCBI
Rnor_6.0	11	74,050,166 - 74,051,902 (+)	NCBI
Rnor_5.0	11	77,102,016 - 77,113,020 (+)	NCBI
RGSC_v3.4	11	72,377,090 - 72,378,826 (+)	RGD
Celera	11	69,452,040 - 69,453,776 (+)	RGD

Sequence:

show sequence

ATGCCGCTGAAACATTACCTCCTCTTGCTGGTGGGCTGCCAGGCCTGGGCTCTAGGTTTGGCCT
ACTATGGCTGCCCCAGTGAATGCACCTGTTCCCGGGCCTCCCAGGTGGAGTGCACAGGAGCGCG
GATTGTGGCGATGCCTACCCCCCTGCCCTGGAATGCTATGAGCCTGCAGGTCGTTAACACGCAC
ATTACTGAGCTCCCTGAGAACCTGTTCCTCAACATTTCAGCGCTCATTGCCCTAAAGATGGAGA
AGAATGAGCTGTCAACCATCATGCCGGGTGCCTTCCGCAATCTGGGCTCTCTGCGCTACCTCAG
CCTCGCCAACAACAAACTGAGGATGCTGCCCATCAGGGTCTTCCAGGACGTAAACAATCTGGAG
TCCCTTCTGCTCTCCAATAACCAGCTGGTGCAGATCCAGCCAGCCCAGTTCTCCCAGTTTAGTA
ATCTTAGGGAACTCCAGTTGCATGGCAACAATCTGGAATCCATTCCCGAAGAAGCCTTCGACCA
CCTAGTAGGACTCACCAAACTCAACCTGGGCAGGAACAGCTTCACCCACCTATCGCCTAGGCTC
TTTCAGCATCTGGGCAACCTCCAGGTGCTCCGGCTACACGAGAACAGGCTTTCAGACATCCCCA
TGGGCACGTTCGATGCACTCGGCAACCTCCAGGAGCTTGCCCTCCAAGAGAACCAGATTGGCAC
CCTCTCCCCTGGCTTGTTCCACAATAACCGTAACCTCCAGAGACTGTATCTGTCCAACAACCAC
ATCTCCCAGCTGCCCCCTGGCATCTTCATGCAGCTGCCCCAGCTTAACAAGCTCACACTCTTTG
GGAATTCCCTGAGGGAGCTTTCCCCGGGGGTCTTCGGGCCCATGCCCAACCTGAGGGAGCTTTG
GCTCTACAACAACCACATCACCTCCCTCGCCGACAACACCTTCAGCCACCTGAACCAGCTGCAG
GTCCTGATTCTCAGTCACAACCAGCTCACTTACATCTCCCCAGGAGCCTTCAATGGGCTGACGA
ACCTCCGAGAACTGTCCCTCCACACCAACGCTCTACAGGACCTGGACAGCAACGTCTTCCGATC
GCTGGCCAACCTGCAGAACATCTCGCTCCAGAGTAACCGCCTCCGACAGCTTCCGGGCAGCATC
TTTGCCAACGTCAACGGCCTCACAACCATCCAACTGCAGAACAACAATCTAGAAAACTTGCCTT
TGGGCATCTTTGATCACTTGGTGAACCTGTGTGAGCTTCGCCTCTACGACAACCCCTGGAGATG
TGACTCAGATATCCTCCCACTTCATAACTGGCTCCTTCTCAACAGAGCCAGGCTGGGGACAGAC
ACTCTTCCAGTGTGTTCCAGTCCCGCCAACGTCCGAGGCCAGTCCCTCGTCATCATCAATATCA
ATTTCCCTGGACCCAGTGTCCAGGGCCCAGAGACCCCTGAAGTACCTAGTTACCCAGATACGCC
CAGCTATCCCGACACCACATCTGTTTCCTCTACCACGGAGATCACCAGCGCCGTCGACGACTAC
ACCGATCTAACCACCATTGAAGCCACCGATGACCGAAATACGTGGGGCATGACTGAGGCCCAGA
GCGGGCTGGCCATTGCTGCCATCGTGATCGGCATCATAGCTTTGGCCTGTTCCCTAGCCGCCTG
CATCTGCTGCTGCTGCTGCAAAAAGAGGAGCCAAGCAGTCCTGATGCAGATGAAGGCTCCCAAT
GAGTGCTAG

hide sequence

Protein Sequences


Protein RefSeqs	NP_659551	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAB84586	(Get FASTA)	NCBI Sequence Viewer
	EDL78155	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000091199
GenBank Protein	Q8R5M3	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_659551 ⟸ NM_145083
- Peptide Label:	precursor
- UniProtKB:	Q8R5M3 (UniProtKB/Swiss-Prot), M0R476 (UniProtKB/TrEMBL), A6JRV2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MPLKHYLLLLVGCQAWALGLAYYGCPSECTCSRASQVECTGARIVAMPTPLPWNAMSLQVVNTH ITELPENLFLNISALIALKMEKNELSTIMPGAFRNLGSLRYLSLANNKLRMLPIRVFQDVNNLE SLLLSNNQLVQIQPAQFSQFSNLRELQLHGNNLESIPEEAFDHLVGLTKLNLGRNSFTHLSPRL FQHLGNLQVLRLHENRLSDIPMGTFDALGNLQELALQENQIGTLSPGLFHNNRNLQRLYLSNNH ISQLPPGIFMQLPQLNKLTLFGNSLRELSPGVFGPMPNLRELWLYNNHITSLADNTFSHLNQLQ VLILSHNQLTYISPGAFNGLTNLRELSLHTNALQDLDSNVFRSLANLQNISLQSNRLRQLPGSI FANVNGLTTIQLQNNNLENLPLGIFDHLVNLCELRLYDNPWRCDSDILPLHNWLLLNRARLGTD TLPVCSSPANVRGQSLVIININFPGPSVQGPETPEVPSYPDTPSYPDTTSVSSTTEITSAVDDY TDLTTIEATDDRNTWGMTEAQSGLAIAAIVIGIIALACSLAACICCCCCKKRSQAVLMQMKAPN EC hide sequence

Ensembl Acc Id:

ENSRNOP00000064155 ⟸ ENSRNOT00000002348

Ensembl Acc Id:

ENSRNOP00000091199 ⟸ ENSRNOT00000095941

Protein Domains

LRRCT LRRNT

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8R5M3-F1-model_v2	AlphaFold	Q8R5M3	1-578	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:70551	AgrOrtholog
BioCyc Gene	G2FUF-21002	BioCyc
Ensembl Genes	ENSRNOG00000038539	Ensembl
	ENSRNOG00000068415	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000095941	ENTREZGENE
Gene3D-CATH	3.80.10.10	UniProtKB/Swiss-Prot
InterPro	Cys-rich_flank_reg_C	UniProtKB/Swiss-Prot
	Leu-rich_rpt	UniProtKB/Swiss-Prot
	Leu-rich_rpt_4	UniProtKB/Swiss-Prot
	Leu-rich_rpt_typical-subtyp	UniProtKB/Swiss-Prot
	LRR_dom_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:246296	UniProtKB/Swiss-Prot
NCBI Gene	246296	ENTREZGENE
PANTHER	IG(IMMUNOGLOBULIN) AND LRR(LEUCINE RICH REPEAT) DOMAINS	UniProtKB/Swiss-Prot
	TIR DOMAIN-CONTAINING PROTEIN	UniProtKB/Swiss-Prot
Pfam	LRR_1	UniProtKB/Swiss-Prot
	LRR_4	UniProtKB/Swiss-Prot
	LRR_8	UniProtKB/Swiss-Prot
PhenoGen	Lrrc15	PhenoGen
PROSITE	LRR	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000038539	RatGTEx
	ENSRNOG00000068415	RatGTEx
SMART	LRR_SD22	UniProtKB/Swiss-Prot
	LRR_TYP	UniProtKB/Swiss-Prot
	LRRCT	UniProtKB/Swiss-Prot
Superfamily-SCOP	L domain-like	UniProtKB/Swiss-Prot
UniProt	A6JRV2	ENTREZGENE, UniProtKB/TrEMBL
	LRC15_RAT	UniProtKB/Swiss-Prot
	M0R476	ENTREZGENE, UniProtKB/TrEMBL
	Q8R5M3	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Lrrc15	leucine rich repeat containing 15		leucine-rich repeat protein induced by beta-amyloid	Name updated	1299863	APPROVED
2004-09-10	Lrrc15	leucine-rich repeat protein induced by beta-amyloid	Lib		Symbol and Name updated	1299863	APPROVED
2002-06-10	Lib	leucine-rich repeat protein induced by beta-amyloid			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	localized to cell surfaces	70253
gene_disease	associated with Alzheimers disease	70253
gene_domains	extracellular domain contains fifteen leucine-rich repeats	70253
gene_process	may function in extracellular protein recognition and encourage neuronal intercellular interactions	70253
gene_protein	578 amino acid protein	70253
gene_regulation	mRNA increased by pro-inflammatory cytokines	70253

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message