Advanced Search (OLGA)

Gene: Ccn4 (cellular communication network factor 4) Rattus norvegicus

Analyze

Symbol:

Ccn4

Name:

cellular communication network factor 4

RGD ID:

69431

Description:

Predicted to enable heparin binding activity and integrin binding activity. Involved in positive regulation of cell growth involved in cardiac muscle cell development; positive regulation of smooth muscle cell migration; and positive regulation of smooth muscle cell proliferation. Predicted to be located in cytoplasm. Predicted to be active in extracellular matrix and extracellular space. Orthologous to human CCN4 (cellular communication network factor 4); INTERACTS WITH 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol; 2,2',4,4'-Tetrabromodiphenyl ether.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

CCN family member 4; ELM-1; MGC93340; WISP-1; Wisp1; WNT1 inducible signaling pathway protein 1; WNT1-inducible-signaling pathway protein 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CCN4 (cellular communication network factor 4)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Ccn4 (cellular communication network factor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ccn4 (cellular communication network factor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CCN4 (cellular communication network factor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CCN4 (cellular communication network factor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ccn4 (cellular communication network factor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CCN4 (cellular communication network factor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CCN4 (cellular communication network factor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ccn4 (cellular communication network factor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Ccn4 (cellular communication network factor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	AKT1S1 (AKT1 substrate 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	CCN4 (cellular communication network factor 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ccn4 (cellular communication network factor 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ccn4b (cellular communication network factor 4b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ccn4a (cellular communication network factor 4a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ccn	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ccn	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ccn4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ccn4	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	100,534,578 - 100,566,287 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	100,534,505 - 100,563,094 (+)	Ensembl				GRCr8
mRatBN7.2	7	98,645,238 - 98,677,253 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	98,645,182 - 98,677,248 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	100,410,333 - 100,438,888 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	102,612,004 - 102,640,558 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	102,531,335 - 102,559,884 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	107,695,227 - 107,723,759 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	107,695,215 - 107,723,772 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	107,644,976 - 107,673,508 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	104,263,089 - 104,291,621 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	95,196,524 - 95,225,037 (+)	NCBI		Celera
RGSC_v3.1	7	104,297,318 - 104,325,846 (+)	NCBI
Cytogenetic Map	7	q33	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Airway Remodeling (IMP)

Experimental Liver Cirrhosis (IEP)

Hyperoxia (IEP)

Neoplasm Metastasis (ISO)

Paraquat Lung (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1-bis(2-aminoethyl)-2-hydroxy-3-oxotriazane (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4,6-trinitrobenzenesulfonic acid (EXP,ISO)

3,4-methylenedioxymethamphetamine (ISO)

3-methylcholanthrene (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

actinomycin D (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

Butylbenzyl phthalate (ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

cannabidiol (ISO)

carbon nanotube (ISO)

carmustine (ISO)

chloroprene (ISO)

cisplatin (ISO)

copper atom (ISO)

copper(0) (ISO)

Cuprizon (EXP)

cycloheximide (ISO)

cyclosporin A (ISO)

decabromodiphenyl ether (EXP)

dexamethasone (ISO)

diarsenic trioxide (ISO)

dibenz[a,h]anthracene (ISO)

dibutyl phthalate (ISO)

diethyl phthalate (ISO)

diisobutyl phthalate (ISO)

diisononyl phthalate (ISO)

dioxygen (ISO)

doxorubicin (ISO)

fenvalerate (EXP)

folic acid (ISO)

gentamycin (EXP)

graphite (EXP)

homocysteine (ISO)

indometacin (ISO)

lipopolysaccharide (ISO)

methotrexate (ISO)

methylmercury chloride (ISO)

N-nitrosodiethylamine (ISO)

nitrofen (EXP)

nitroprusside (ISO)

ochratoxin A (ISO)

okadaic acid (ISO)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (EXP)

paraquat (ISO)

pentane-2,3-dione (EXP)

perfluorohexanesulfonic acid (ISO)

perfluorononanoic acid (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

propiconazole (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

temozolomide (ISO)

tetrachloromethane (ISO)

titanium dioxide (ISO)

topotecan (EXP)

trichloroethene (EXP)

trimellitic anhydride (ISO)

troglitazone (ISO)

valproic acid (ISO)

vancomycin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

bone development (ISO)

cell adhesion (IBA,IEA)

glucose homeostasis (ISO)

negative regulation of chondrocyte differentiation (ISO)

negative regulation of fat cell differentiation (ISO)

osteoblast differentiation (ISO)

osteoclast differentiation (ISO)

positive regulation of cell differentiation (IBA)

positive regulation of cell growth involved in cardiac muscle cell development (IMP)

positive regulation of inflammatory response (IEA,ISO)

positive regulation of osteoblast differentiation (IEA,ISO)

positive regulation of smooth muscle cell migration (IMP)

positive regulation of smooth muscle cell proliferation (IMP)

positive regulation of Wnt signaling pathway (ISO)

positive regulation of wound healing (ISO)

regulation of cell differentiation (IEA)

regulation of cytokine production (IEA,ISO)

regulation of multicellular organismal process (IEA)

signal transduction (IBA,IEA)

Wnt signaling pathway (IEA)

Cellular Component

cytoplasm (ISO,ISS)

extracellular matrix (IBA)

extracellular region (IEA)

extracellular space (IBA,IEA,ISO,ISS)

Molecular Function

heparin binding (IBA)

integrin binding (IBA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Inhibition of LRP5/6-mediated Wnt/beta-catenin signaling by Mesd attenuates hyperoxia-induced pulmonary hypertension in neonatal rats.	Alapati D, etal., Pediatr Res. 2013 Jun;73(6):719-25. doi: 10.1038/pr.2013.42. Epub 2013 Mar 12.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Wnt-induced secreted protein 1/CCN4 in liver fibrosis both in vitro and in vivo.	Jian YC, etal., Clin Lab. 2014;60(1):29-35.
5.	CCN4 regulates vascular smooth muscle cell migration and proliferation.	Liu H, etal., Mol Cells. 2013 Aug;36(2):112-8. doi: 10.1007/s10059-013-0012-2. Epub 2013 Jun 25.
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	GOA pipeline	RGD automated data pipeline
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Comprehensive gene review and curation	RGD comprehensive gene curation
11.	Angiotensin-II type 1 receptor and NOX2 mediate TCF/LEF and CREB dependent WISP1 induction and cardiomyocyte hypertrophy.	Shanmugam P, etal., J Mol Cell Cardiol. 2011 Mar 2.
12.	Gene expression in rat dermal papilla cells: analysis of 2529 ESTs.	Sleeman MA, etal., Genomics 2000 Oct 15;69(2):214-24.
13.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
14.	A novel variant of WISP1 lacking a Von Willebrand type C module overexpressed in scirrhous gastric carcinoma.	Tanaka S, etal., Oncogene 2001 Sep 6;20(39):5525-32.
15.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
16.	A role for WNT1-inducible signaling protein-1 in airway remodeling in a rat asthma model.	Yang M, etal., Int Immunopharmacol. 2013 Oct;17(2):350-7. doi: 10.1016/j.intimp.2013.06.011. Epub 2013 Jul 8.

Additional References at PubMed

PMID:15331410	PMID:17616748	PMID:20684029	PMID:22272766	PMID:22475393	PMID:24006456	PMID:25281430	PMID:25864198	PMID:26242865	PMID:26627308	PMID:28496206	PMID:29319180
PMID:29330021	PMID:30556898

Genomics

Comparative Map Data

Ccn4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	100,534,578 - 100,566,287 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	100,534,505 - 100,563,094 (+)	Ensembl				GRCr8
mRatBN7.2	7	98,645,238 - 98,677,253 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	98,645,182 - 98,677,248 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	100,410,333 - 100,438,888 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	102,612,004 - 102,640,558 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	102,531,335 - 102,559,884 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	107,695,227 - 107,723,759 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	107,695,215 - 107,723,772 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	107,644,976 - 107,673,508 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	104,263,089 - 104,291,621 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	95,196,524 - 95,225,037 (+)	NCBI		Celera
RGSC_v3.1	7	104,297,318 - 104,325,846 (+)	NCBI
Cytogenetic Map	7	q33	NCBI

CCN4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	133,191,039 - 133,231,690 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	133,191,039 - 133,231,690 (+)	Ensembl			hg38	GRCh38
GRCh37	8	134,203,282 - 134,243,933 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	134,272,494 - 134,310,753 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	8	134,272,493 - 134,309,234	NCBI
Celera	8	130,380,567 - 130,419,496 (+)	NCBI		Celera
Cytogenetic Map	8	q24.22	NCBI
HuRef	8	129,522,987 - 129,563,677 (+)	NCBI		HuRef
CHM1_1	8	134,244,050 - 134,284,955 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	8	134,314,374 - 134,355,795 (+)	NCBI		T2T-CHM13v2.0

Ccn4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	66,763,337 - 66,795,050 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	66,763,169 - 66,795,050 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	15	66,891,369 - 66,923,201 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	66,891,320 - 66,923,201 (+)	Ensembl			mm10	GRCm38
MGSCv37	15	66,722,955 - 66,754,761 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	15	66,721,062 - 66,752,868 (+)	NCBI		MGSCv36	mm8
Celera	15	68,424,047 - 68,455,874 (+)	NCBI		Celera
Cytogenetic Map	15	D2	NCBI
cM Map	15	29.3	NCBI

Ccn4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955461	7,748,005 - 7,780,427 (+)	Ensembl
ChiLan1.0	NW_004955461	7,748,399 - 7,780,359 (+)	NCBI	ChiLan1.0	ChiLan1.0

CCN4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	150,576,117 - 150,619,035 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	126,090,690 - 126,133,538 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	129,842,580 - 129,884,528 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	132,818,397 - 132,858,861 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	132,818,397 - 132,858,861 (+)	Ensembl			panPan2	panpan1.1

CCN4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	13	29,648,720 - 29,683,822 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	13	29,648,639 - 29,679,732 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	13	29,622,701 - 29,661,265 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	13	30,004,803 - 30,043,373 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	13	30,004,755 - 30,039,284 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	13	29,731,434 - 29,769,975 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	13	29,830,792 - 29,869,352 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	13	30,180,453 - 30,219,020 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ccn4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	8,682,581 - 8,708,143 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936470	16,110,497 - 16,134,065 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936470	16,110,492 - 16,134,065 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CCN4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	8,079,755 - 8,110,700 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	4	8,078,163 - 8,110,906 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	8,188,614 - 8,216,061 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CCN4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	127,620,635 - 127,658,132 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	127,642,598 - 127,661,462 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666039	12,440,154 - 12,481,049 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ccn4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624735	22,788,475 - 22,819,648 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624735	22,789,784 - 22,819,527 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Ccn4
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	241,006,003 - 241,034,648 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Ccn4
171 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	71
Count of miRNA genes:	55
Interacting mature miRNAs:	67
Transcripts:	ENSRNOT00000009673
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	92388565	119280177	Rat
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	82111245	123048330	Rat
2317035	Aia16	Adjuvant induced arthritis QTL 16	2.71		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	7	71103011	106126789	Rat
1358361	Sradr5	Stress Responsive Adrenal Weight QTL 5	5.55		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	7	31770293	110435881	Rat
70159	Bp61	Blood pressure QTL 61		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	73618702	118618702	Rat
631687	Hcas1	Hepatocarcinoma susceptibility QTL 1	3.9	0.001	liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	7	93302009	131686183	Rat
1298525	Cm1	Cardiac mass QTL 1	2.7		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	7	56625161	101625161	Rat
1357338	Stl17	Serum triglyceride level QTL 17	3.23		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	71621154	114982716	Rat
61397	Bw17	Body weight QTL 17	6.3		body mass (VT:0001259)	body weight (CMO:0000012)	7	95485047	137014596	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	46307490	127866166	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	85043242	130043242	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	85497398	130497398	Rat
1549899	Stresp8	Stress response QTL 8	4.37	0.0008	stress-related behavior trait (VT:0010451)	defensive burying duration (CMO:0001961)	7	92362341	137014596	Rat
1331723	Bw25	Body weight QTL 25	3.348		body mass (VT:0001259)	body weight (CMO:0000012)	7	96700404	111672180	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	83626689	128626689	Rat
631529	Tls2	T-lymphoma susceptibility QTL 2	0	0.001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	7	82111382	132099989	Rat
731176	Glom5	Glomerulus QTL 5	2.5	0.0035	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	7	98549867	137014596	Rat
1559283	Emca4	Estrogen-induced mammary cancer QTL 4	3.7		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	7	63889858	108889858	Rat
1300151	Bp181	Blood pressure QTL 181	3.36		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	7	55498584	105834451	Rat
1300149	Cm6	Cardiac mass QTL 6	4.09		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	7	1	104117804	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	77807807	122807807	Rat
631201	Panci1	Pancreas inflammation QTL 1	0	0.001	pancreas integrity trait (VT:0010560)	percentage of study population displaying chronic pancreatitis at a point in time (CMO:0001214)	7	73557047	118557047	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	1509236	116977875	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	82111245	123048330	Rat
2313102	Bmd79	Bone mineral density QTL 79	2.3	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	7	96700404	118618702	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	40540077	123682549	Rat
2316947	Rf58	Renal function QTL 58	7.8		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	7	49682832	115766396	Rat
10450862	Kidm55	Kidney mass QTL 55	4.9		kidney mass (VT:0002707)	kidney weight (CMO:0000081)	7	72725037	117725037	Rat
1298528	Bp169	Blood pressure QTL 169		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	62963207	107963207	Rat
61428	Scl3	Serum cholesterol level QTL 3	3.2		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	7	100548246	137014596	Rat
1331746	Kidm9	Kidney mass QTL 9	3.934		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	7	82111245	134948181	Rat
1576303	Ept7	Estrogen-induced pituitary tumorigenesis QTL 7	3.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	7	63889858	108889858	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	77807807	122807807	Rat
10450856	Livw4	Liver weight QTL 4	3.8		liver mass (VT:0003402)	liver weight (CMO:0000092)	7	72725037	117725037	Rat
2316955	Stl24	Serum triglyceride level QTL 24	7.1		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	7	49682832	115766396	Rat
10402855	Bp379	Blood pressure QTL 379		0.21	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	78682549	123682549	Rat
2316952	Pur22	Proteinuria QTL 22	5.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	7	49682832	115766396	Rat
631540	Bw9	Body weight QTL 9	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	7	71621154	119349044	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	71827901	136544683	Rat

Markers in Region

BE117857

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	98,673,862 - 98,674,012 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	107,723,549 - 107,723,698	NCBI	Rnor6.0
Rnor_5.0	7	107,673,298 - 107,673,447	UniSTS	Rnor5.0
RGSC_v3.4	7	104,291,411 - 104,291,560	UniSTS	RGSC3.4
Celera	7	95,224,827 - 95,224,976	UniSTS
RH 3.4 Map	7	681.1	UniSTS
Cytogenetic Map	7	q33	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	65	150	70	69	38	36	38	6	272	134	11	129	76	88	31	12	12

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031716	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039079864	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC091481	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF228049	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ236871	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC078787	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000009673 ⟹ ENSRNOP00000009673

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	98,645,610 - 98,677,248 (+)	Ensembl
Rnor_6.0 Ensembl	7	107,695,227 - 107,723,764 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000093628 ⟹ ENSRNOP00000076326

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	100,534,505 - 100,563,094 (+)	Ensembl
mRatBN7.2 Ensembl	7	98,645,623 - 98,674,090 (+)	Ensembl
Rnor_6.0 Ensembl	7	107,695,215 - 107,723,772 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000104468 ⟹ ENSRNOP00000084936

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	98,645,615 - 98,676,229 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000108383 ⟹ ENSRNOP00000085026

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	100,534,505 - 100,562,306 (+)	Ensembl
mRatBN7.2 Ensembl	7	98,645,182 - 98,673,272 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000110857 ⟹ ENSRNOP00000090079

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	98,645,617 - 98,661,880 (+)	Ensembl

RefSeq Acc Id:

NM_031716 ⟹ NP_113904

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	100,534,578 - 100,563,107 (+)	NCBI
mRatBN7.2	7	98,645,542 - 98,674,073 (+)	NCBI
Rnor_6.0	7	107,695,227 - 107,723,759 (+)	NCBI
Rnor_5.0	7	107,644,976 - 107,673,508 (+)	NCBI
RGSC_v3.4	7	104,263,089 - 104,291,621 (+)	RGD
Celera	7	95,196,524 - 95,225,037 (+)	RGD

Sequence:

show sequence

GGCACGAGGCCTGACGTCAGATGTCGCTTTGACAAACGCCCCCGGGGGCTGAGGAAGGCTCTCC
GCTGCTCTGATGGGCCAGCCCAGTCGTGGCCCAGCTCCCTGGAGAGGCACCGGCATCCTCTGGG
CTGAGCTGTAGCTCCTGTGACGCTGACTTCCAGGCATGAGGTGGCTCCTGCCCTGGACGCTGGC
AGCCGTGGCAGTCCTGATGGTGGGCAACATCCTGGCCACGGCCCTCTCTCCAACCCCCACAACC
ATGACCTTCACCCCAGCACCACTGGAGGAAACGATTACACGGCCGGAATTCTGCAAGTGGCCGT
GTGAGTGCCCACAAGCCCCACCTCGCTGCCCACTGGGTGTCAGCCTAATCACAGATGGCTGTGA
ATGCTGTAAGATATGTGCCCAGCAGCTTGGGGACAACTGCACAGAGGCTGCCGTCTGTGACCCA
CACCGGGGCCTCTACTGCGATTACAGTGGGGACCGCCCGAGGTACGCAATAGGAGTGTGTGCAC
AGGTGGTCGGTGTGGGCTGTGTCCTGGATGGCGTGCGCTACACCAATGGAGAGTCCTTCCAACC
CAACTGCAGGTACAACTGCACCTGTATTGATGGCACCGTGGGCTGCACACCACTGTGCCTGAGC
CCCAGGCCCCCACGCCTCTGGTGCCGCCAGCCCCGTCACGTGAGAGTCCCTGGCCAGTGCTGTG
AACAATGGGTATGTGATGATGATGCCAGGAGGCCACGCCAGACTGCACTGCTGGACACCAGAGC
CTTTGCAGCTTCGGGTGCAGTGGAGCAACGGTATGAGAACTGCATAGCCTACACTAGCCCCTGG
AGTCCCTGCTCAACAACCTGTGGCCTAGGTATCTCGACTCGCATCTCTAATGTCAATGCGCGGT
GCTGGCCAGAGCAGGAAAGTCGCCTCTGCAACCTGCGGCCATGTGATGTGGACATCCGACCACA
CATCAAGGCAGGGAAGAAATGCCTGGCTGTGTACCAGCCAGAGGAGGCCACGAACTTCACTCTC
GCAGGCTGTGTCAGCACACGCACCTACCGACCCAAGTACTGTGGAGTCTGTACTGACAATAGGT
GTTGCATCCCCTACAAGTCTAAGACCATCAGTGTTGATTTCCAGTGTCCAGAGGGGCCGGGTTT
CTCTCGGCAGGTCCTATGGATTAATGCTTGCTTCTGCAACCTGAGCTGCAGGAATCCTAATGAT
ATCTTTGCTGACTTGGAATCTTACCCTGACTTTGCAGAGATTGCCAACTAGGTAGGTGTGTGGC
TTGGAGAACAGCTCCATGTTGCAAAGCAGTCAGCCCTCTGTGGCCCAGGACTTCACAATTGAGC
CTTATTTCATCTACTTCCTCCTCAATTCTGCATTCCCTGACCCTGACCCTCAGTTTCTGTTCCT
ATTTTGACCGTTCCAATGGCCCAGGAAAGTGCTGCTCAGGCTCAGACAATGGGTCCCTCCTTTG
GGACATTCTATATCACTCCAAGGAAAACACCTCTCTGAACTGTTCACAATGAAAGCCAAGCCTG
ACCCCAGCCAGTCTGGCTCCAACCTGTGCAAGTTGTCAGAAATCCTAATGGGACAGTCCAAGGA
AAAAACAGCAACTGAAGAACCAGAATCACAGACTCCCTCTTCAGATGCCCAGCCTGAGGATGTT
GAGATCCTTTCAGACACATGGATGGGATTGGGGGAACGGGAATAAGCTATCATCCCTTACCAAA
TGATACTATCCTGGGAATTTCTGCCCACAACATACCAAAAGTGCTCTTATTCCAAAGATCTATG
TATCACAAGTCACCAAACATGTTCTAGGTGAGGAAAATACTTGCACCATTTTGATTTGAAATTG
AAAATCATATTTAAAAGAAGAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039079864 ⟹ XP_038935792

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	100,549,780 - 100,566,287 (+)	NCBI
mRatBN7.2	7	98,645,238 - 98,677,253 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_113904	(Get FASTA)	NCBI Sequence Viewer
	XP_038935792	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH78787	(Get FASTA)	NCBI Sequence Viewer
	AAK00729	(Get FASTA)	NCBI Sequence Viewer
	CAB41995	(Get FASTA)	NCBI Sequence Viewer
	EDM16148	(Get FASTA)	NCBI Sequence Viewer
	EDM16149	(Get FASTA)	NCBI Sequence Viewer
	EDM16150	(Get FASTA)	NCBI Sequence Viewer
	EDM16151	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000076326
GenBank Protein	Q99PP0	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_113904 ⟸ NM_031716
- Peptide Label:	precursor
- UniProtKB:	Q9WUW4 (UniProtKB/Swiss-Prot), Q99PP0 (UniProtKB/Swiss-Prot), A0A1W2Q6N9 (UniProtKB/TrEMBL), A6HRS2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MRWLLPWTLAAVAVLMVGNILATALSPTPTTMTFTPAPLEETITRPEFCKWPCECPQAPPRCPL GVSLITDGCECCKICAQQLGDNCTEAAVCDPHRGLYCDYSGDRPRYAIGVCAQVVGVGCVLDGV RYTNGESFQPNCRYNCTCIDGTVGCTPLCLSPRPPRLWCRQPRHVRVPGQCCEQWVCDDDARRP RQTALLDTRAFAASGAVEQRYENCIAYTSPWSPCSTTCGLGISTRISNVNARCWPEQESRLCNL RPCDVDIRPHIKAGKKCLAVYQPEEATNFTLAGCVSTRTYRPKYCGVCTDNRCCIPYKSKTISV DFQCPEGPGFSRQVLWINACFCNLSCRNPNDIFADLESYPDFAEIAN hide sequence

Ensembl Acc Id:

ENSRNOP00000076326 ⟸ ENSRNOT00000093628

Ensembl Acc Id:

ENSRNOP00000009673 ⟸ ENSRNOT00000009673

RefSeq Acc Id:	XP_038935792 ⟸ XM_039079864
- Peptide Label:	isoform X1
- UniProtKB:	Q6AZ22 (UniProtKB/TrEMBL), G3V6X0 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000090079 ⟸ ENSRNOT00000110857

Ensembl Acc Id:

ENSRNOP00000085026 ⟸ ENSRNOT00000108383

Ensembl Acc Id:

ENSRNOP00000084936 ⟸ ENSRNOT00000104468

Protein Domains

CTCK IGFBP N-terminal TSP type-1 VWFC

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q99PP0-F1-model_v2	AlphaFold	Q99PP0	1-367	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695365

Promoter ID:

EPDNEW_R5890

Type:

initiation region

Name:

Wisp1_1

Description:

WNT1 inducible signaling pathway protein 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	107,695,305 - 107,695,365	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:69431	AgrOrtholog
BioCyc Gene	G2FUF-33119	BioCyc
Ensembl Genes	ENSRNOG00000007078	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000093628	ENTREZGENE
Gene3D-CATH	2.20.100.10	UniProtKB/Swiss-Prot
	Complement Module, domain 1	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7131232	IMAGE-MGC_LOAD
InterPro	CCN	UniProtKB/Swiss-Prot
	Cys_knot_C	UniProtKB/Swiss-Prot
	Glyco_hormone_CN	UniProtKB/Swiss-Prot
	Growth_fac_rcpt_cys_sf	UniProtKB/Swiss-Prot
	IGFBP-like	UniProtKB/Swiss-Prot
	IGFBP_CNN	UniProtKB/Swiss-Prot
	Insulin_GF-bd_Cys-rich_CS	UniProtKB/Swiss-Prot
	TSP1_CCN	UniProtKB/Swiss-Prot
	TSP1_rpt	UniProtKB/Swiss-Prot
	TSP1_rpt_sf	UniProtKB/Swiss-Prot
	VWF_dom	UniProtKB/Swiss-Prot
KEGG Report	rno:65154	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:93340	IMAGE-MGC_LOAD
NCBI Gene	65154	ENTREZGENE
PANTHER	CCN FAMILY MEMBER 4	UniProtKB/Swiss-Prot
	CONNECTIVE TISSUE GROWTH FACTOR-RELATED	UniProtKB/Swiss-Prot
Pfam	Cys_knot	UniProtKB/Swiss-Prot
	IGFBP	UniProtKB/Swiss-Prot
	TSP1_CCN	UniProtKB/Swiss-Prot
	VWC	UniProtKB/Swiss-Prot
PhenoGen	Ccn4	PhenoGen
PIRSF	IGFBP_rP_CNN	UniProtKB/Swiss-Prot
PROSITE	CTCK_1	UniProtKB/Swiss-Prot
	CTCK_2	UniProtKB/Swiss-Prot
	IGFBP_N_1	UniProtKB/Swiss-Prot
	IGFBP_N_2	UniProtKB/Swiss-Prot
	TSP1	UniProtKB/Swiss-Prot
	VWFC_1	UniProtKB/Swiss-Prot
	VWFC_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000007078	RatGTEx
SMART	SM00041	UniProtKB/Swiss-Prot
	SM00121	UniProtKB/Swiss-Prot
	TSP1	UniProtKB/Swiss-Prot
	VWC	UniProtKB/Swiss-Prot
Superfamily-SCOP	FnI-like domain	UniProtKB/Swiss-Prot
	SSF57184	UniProtKB/Swiss-Prot
	SSF82895	UniProtKB/Swiss-Prot
TIGR	TC206062
UniProt	A0A1W2Q6N9	ENTREZGENE
	A0A8I6A2C3_RAT	UniProtKB/TrEMBL
	A6HRS2	ENTREZGENE, UniProtKB/TrEMBL
	G3V6X0	ENTREZGENE, UniProtKB/TrEMBL
	Q6AZ22	ENTREZGENE
	Q99PP0	ENTREZGENE
	Q9WUW4	ENTREZGENE
	WISP1_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	Q9WUW4	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-10-23	Ccn4	cellular communication network factor 4	Wisp1	WNT1 inducible signaling pathway protein 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Wisp1	WNT1 inducible signaling pathway protein 1			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD