Advanced Search (OLGA)

Gene: Snap91 (synaptosome associated protein 91) Rattus norvegicus

Analyze

Symbol:

Snap91

Name:

synaptosome associated protein 91

RGD ID:

69276

Description:

Enables several functions, including SH2 domain binding activity; clathrin adaptor activity; and phospholipase inhibitor activity. Involved in several processes, including positive regulation of cellular component organization; positive regulation of synaptic vesicle clustering; and regulation of terminal button organization. Located in several cellular components, including cytoplasmic vesicle; postsynaptic density; and presynaptic active zone membrane. Is active in Schaffer collateral - CA1 synapse; parallel fiber to Purkinje cell synapse; and postsynaptic membrane. Is extrinsic component of presynaptic endocytic zone membrane. Biomarker of middle cerebral artery infarction. Orthologous to human SNAP91 (synaptosome associated protein 91); PARTICIPATES IN clathrin-dependent synaptic vesicle endocytosis; INTERACTS WITH 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

91 kDa synaptosomal-associated protein; Ap180; AP3; assembly protein 180 (AP180); clathrin assembly protein 3; clathrin coat assembly protein AP180; clathrin coat-associated protein AP180; synaptosomal-associated protein 91; synaptosomal-associated protein 91 kDa; synaptosomal-associated protein, 91 kDa; synaptosomal-associated protein, 91kDa homolog; synaptosomal-associated protein, 91kDa homolog (mouse)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SNAP91 (synaptosome associated protein 91)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Snap91 (synaptosomal-associated protein 91)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Snap91 (synaptosome associated protein 91)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SNAP91 (synaptosome associated protein 91)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SNAP91 (synaptosome associated protein 91)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Snap91 (synaptosome associated protein 91)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SNAP91 (synaptosome associated protein 91)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SNAP91 (synaptosome associated protein 91)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Snap91 (synaptosome associated protein 91)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Snap91 (synaptosome associated protein 91)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	MOXD1 (monooxygenase DBH like 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	SNAP91 (synaptosome associated protein 91)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Snap91 (synaptosomal-associated protein 91)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	snap91a (synaptosome associated protein 91a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	snap91b (synaptosome associated protein 91b)	Alliance	DIOPT (Ensembl Compara\|OMA\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	snap91b (synaptosome associated protein 91b)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	YAP1801	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	lap	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	lap	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	unc-11	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	unc-11	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	YAP1802	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	YAP1802	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	snap91	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	96,618,039 - 96,732,763 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	96,618,041 - 96,732,507 (-)	Ensembl				GRCr8
mRatBN7.2	8	87,738,056 - 87,852,690 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	87,738,824 - 87,852,367 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	93,418,568 - 93,525,116 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	91,617,774 - 91,724,331 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	89,459,489 - 89,566,103 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	8	97,536,608 - 97,645,096 (-)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	8	99,644,884 - 99,751,499 (-)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	8	98,134,152 - 98,240,771 (-)	NCBI		Lyon_Hypertensive
F344_StmMcwi	8	89,578,925 - 89,687,387 (-)	NCBI		F344_StmMcwi
Rnor_6.0	8	94,447,558 - 94,564,772 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	94,447,550 - 94,564,525 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	93,958,152 - 94,074,269 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	92,033,425 - 92,147,091 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	87,338,970 - 87,446,775 (-)	NCBI		Celera
RGSC_v3.1	8	92,052,879 - 92,166,546 (-)	NCBI
Cytogenetic Map	8	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Alzheimer's disease (ISO)

middle cerebral artery infarction (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1-naphthyl isothiocyanate (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

all-trans-retinoic acid (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

cantharidin (ISO)

CGP 52608 (ISO)

chlordecone (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

cocaine (EXP)

cytarabine (ISO)

dibutyl phthalate (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

ethanol (ISO)

fenvalerate (EXP)

gentamycin (EXP)

GW 4064 (ISO)

ivermectin (ISO)

lead(0) (ISO)

mercury dibromide (ISO)

methylmercury chloride (ISO)

Moniliformin (ISO)

paracetamol (EXP)

pirinixic acid (ISO)

SB 431542 (ISO)

silver atom (ISO)

silver(0) (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triclosan (ISO)

trimellitic anhydride (ISO)

uranium atom (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

axonogenesis (IMP)

chemical synaptic transmission (ISO)

clathrin coat assembly (IDA,IEA,ISO)

clathrin-dependent endocytosis (IBA,IEA)

establishment or maintenance of cell polarity (IMP)

neuron development (IMP)

neurotransmitter secretion (ISO)

positive regulation of axonogenesis (IEA,IMP)

positive regulation of clathrin coat assembly (IMP)

positive regulation of synaptic vesicle clustering (IEA,IMP)

positive regulation of synaptic vesicle endocytosis (IEA,IMP)

protein transport (IEA)

regulation of clathrin-dependent endocytosis (ISO)

regulation of endocytosis (IMP)

regulation of protein transport (IMP)

regulation of synaptic vesicle endocytosis (IMP)

regulation of terminal button organization (IEA,IMP)

synaptic vesicle endocytosis (IDA,IEA,IMP)

vesicle budding from membrane (IBA)

Cellular Component

axon terminus (IDA)

clathrin-coated pit (IBA,IEA)

clathrin-coated vesicle (IBA,IDA,IEA)

cytosol (IDA)

extrinsic component of presynaptic endocytic zone membrane (IBA,IDA,IEA)

membrane (IEA)

neuronal cell body (IDA)

parallel fiber to Purkinje cell synapse (IDA)

plasma membrane (IDA,IEA)

postsynaptic density (IDA)

postsynaptic membrane (IDA)

presynaptic active zone membrane (IDA)

presynaptic membrane (IDA)

Schaffer collateral - CA1 synapse (IDA)

synaptic vesicle (IBA,IDA)

terminal bouton (HDA)

Molecular Function

1-phosphatidylinositol binding (IBA,IEA,ISO)

clathrin adaptor activity (IMP)

clathrin binding (IEA,IPI)

clathrin heavy chain binding (IBA,IEA,IPI,ISO)

inositol hexakisphosphate binding (IDA)

molecular adaptor activity (IEA,ISO)

phosphatidylinositol-4,5-bisphosphate binding (IBA)

phospholipase binding (IPI)

phospholipase C inhibitor activity (IDA)

phospholipase D inhibitor activity (IDA)

phospholipid binding (IEA)

protein binding (IPI,ISO)

protein kinase binding (ISO)

SH2 domain binding (IPI)

SNARE binding (IBA,IPI)

Molecular Pathway Annotations Click to see Annotation Detail View

clathrin-dependent synaptic vesicle endocytosis (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	A-single spermatogonia heterogeneity and cell cycles synchronize with rat seminiferous epithelium stages VIII-IX.	Abid SN, etal., Biol Reprod. 2014 Feb 13;90(2):32. doi: 10.1095/biolreprod.113.113555. Print 2014 Feb.
2.	Accessory protein recruitment motifs in clathrin-mediated endocytosis.	Brett TJ, etal., Structure. 2002 Jun;10(6):797-809.
3.	Clathrin assembly protein AP180 and CALM differentially control axogenesis and dendrite outgrowth in embryonic hippocampal neurons.	Bushlin I, etal., J Neurosci. 2008 Oct 8;28(41):10257-71. doi: 10.1523/JNEUROSCI.2471-08.2008.
4.	Changed clathrin regulatory proteins in the brains of Alzheimer's disease patients and animal models.	Cao Y, etal., J Alzheimers Dis. 2010;22(1):329-42. doi: 10.3233/JAD-2010-100162.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	AP180 binds to the C-terminal SH2 domain of phospholipase C-gamma1 and inhibits its enzymatic activity.	Han SJ, etal., Biochem Biophys Res Commun 2002 Jan 11;290(1):35-41.
7.	Unusual structural organization of the endocytic proteins AP180 and epsin 1.	Kalthoff C, etal., J Biol Chem. 2002 Mar 8;277(10):8209-16. Epub 2001 Dec 26.
8.	SNARE motif-mediated sorting of synaptobrevin by the endocytic adaptors clathrin assembly lymphoid myeloid leukemia (CALM) and AP180 at synapses.	Koo SJ, etal., Proc Natl Acad Sci U S A. 2011 Aug 16;108(33):13540-5. doi: 10.1073/pnas.1107067108. Epub 2011 Aug 1.
9.	Inhibition of phospholipase D by clathrin assembly protein 3 (AP3).	Lee C, etal., J Biol Chem. 1997 Jun 20;272(25):15986-92.
10.	Cloning and expression of a novel member of the low voltage-activated T-type calcium channel family.	Lee JH, etal., J Neurosci 1999 Mar 15;19(6):1912-21.
11.	Clathrin assembly protein AP180: primary structure, domain organization and identification of a clathrin binding site.	Morris SA, etal., EMBO J 1993 Feb;12(2):667-75.
12.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
13.	Inositol hexakisphosphate binds to clathrin assembly protein 3 (AP-3/AP180) and inhibits clathrin cage assembly in vitro.	Norris FA, etal., J Biol Chem. 1995 Jan 6;270(1):214-7.
14.	AP180 and CALM in the developing hippocampus: expression at the nascent synapse and localization to trafficking organelles.	Petralia RS and Yao PJ, J Comp Neurol. 2007 Sep 20;504(3):314-27.
15.	Reduction of AP180 and CALM produces defects in synaptic vesicle size and density.	Petralia RS, etal., Neuromolecular Med. 2013 Mar;15(1):49-60. doi: 10.1007/s12017-012-8194-x. Epub 2012 Aug 1.
16.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
17.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
18.	The NECAP PHear domain increases clathrin accessory protein binding potential.	Ritter B, etal., EMBO J. 2007 Sep 19;26(18):4066-77. Epub 2007 Aug 30.
19.	Calpain hydrolysis of alpha- and beta2-adaptins decreases clathrin-dependent endocytosis and may promote neurodegeneration.	Rudinskiy N, etal., J Biol Chem. 2009 May 1;284(18):12447-58. doi: 10.1074/jbc.M804740200. Epub 2009 Feb 24.
20.	Synaptic vesicle endocytosis.	Saheki Y and De Camilli P, Cold Spring Harb Perspect Biol. 2012 Sep 1;4(9):a005645. doi: 10.1101/cshperspect.a005645.
21.	Clathrin assembly proteins AP180 and CALM in the embryonic rat brain.	Schwartz CM, etal., J Comp Neurol. 2010 Sep 15;518(18):3803-18. doi: 10.1002/cne.22425.
22.	Crystal structure of the alpha appendage of AP-2 reveals a recruitment platform for clathrin-coat assembly.	Traub LM, etal., Proc Natl Acad Sci U S A. 1999 Aug 3;96(16):8907-12.
23.	Composition of isolated synaptic boutons reveals the amounts of vesicle trafficking proteins.	Wilhelm BG, etal., Science. 2014 May 30;344(6187):1023-8. doi: 10.1126/science.1252884.
24.	High-resolution localization of clathrin assembly protein AP180 in the presynaptic terminals of mammalian neurons.	Yao PJ, etal., J Comp Neurol 2002 May 27;447(2):152-62.
25.	Synaptic distribution of the endocytic accessory proteins AP180 and CALM.	Yao PJ, etal., J Comp Neurol. 2005 Jan 3;481(1):58-69.

Additional References at PubMed

PMID:9045662	PMID:10428863	PMID:11102472	PMID:16025302	PMID:16254249	PMID:16903783	PMID:20937255	PMID:21307259	PMID:21500857	PMID:22871113	PMID:26412491	PMID:28131823
PMID:29476059	PMID:32357304

Genomics

Comparative Map Data

Snap91
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	96,618,039 - 96,732,763 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	96,618,041 - 96,732,507 (-)	Ensembl				GRCr8
mRatBN7.2	8	87,738,056 - 87,852,690 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	87,738,824 - 87,852,367 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	93,418,568 - 93,525,116 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	91,617,774 - 91,724,331 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	89,459,489 - 89,566,103 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	8	97,536,608 - 97,645,096 (-)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	8	99,644,884 - 99,751,499 (-)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	8	98,134,152 - 98,240,771 (-)	NCBI		Lyon_Hypertensive
F344_StmMcwi	8	89,578,925 - 89,687,387 (-)	NCBI		F344_StmMcwi
Rnor_6.0	8	94,447,558 - 94,564,772 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	94,447,550 - 94,564,525 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	93,958,152 - 94,074,269 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	92,033,425 - 92,147,091 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	87,338,970 - 87,446,775 (-)	NCBI		Celera
RGSC_v3.1	8	92,052,879 - 92,166,546 (-)	NCBI
Cytogenetic Map	8	q31	NCBI

SNAP91
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	83,552,885 - 83,709,393 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	83,552,880 - 83,709,691 (-)	Ensembl			hg38	GRCh38
GRCh37	6	84,262,604 - 84,419,112 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	84,319,332 - 84,475,495 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	6	84,319,331 - 84,475,495	NCBI
Celera	6	84,695,893 - 84,852,438 (-)	NCBI		Celera
Cytogenetic Map	6	q14.2	NCBI
HuRef	6	81,492,256 - 81,648,799 (-)	NCBI		HuRef
CHM1_1	6	84,360,208 - 84,516,740 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	84,776,120 - 84,932,636 (-)	NCBI		T2T-CHM13v2.0

Snap91
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	86,647,976 - 86,762,766 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	86,647,976 - 86,762,707 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	9	86,765,923 - 86,880,734 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	86,765,923 - 86,880,654 (-)	Ensembl			mm10	GRCm38
MGSCv37	9	86,659,239 - 86,775,207 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	9	86,562,350 - 86,678,320 (-)	NCBI		MGSCv36	mm8
Celera	9	83,843,031 - 83,967,649 (-)	NCBI		Celera
Cytogenetic Map	9	E3.1	NCBI
cM Map	9	46.58	NCBI

Snap91
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955411	11,175,525 - 11,300,950 (-)	Ensembl
ChiLan1.0	NW_004955411	11,175,587 - 11,301,145 (-)	NCBI	ChiLan1.0	ChiLan1.0

SNAP91
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	103,646,352 - 103,805,054 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	101,542,959 - 101,701,653 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	81,441,792 - 81,600,505 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	84,717,271 - 84,875,561 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	84,720,850 - 84,874,407 (-)	Ensembl			panPan2	panpan1.1

SNAP91
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	43,919,925 - 44,058,315 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	12	43,919,925 - 44,058,616 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	43,734,660 - 43,872,902 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	44,689,016 - 44,828,781 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	12	44,689,023 - 44,828,948 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	12	44,027,843 - 44,166,268 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	43,961,559 - 44,100,121 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	44,138,511 - 44,276,836 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Snap91
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	79,125,757 - 79,248,750 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936510	7,223,757 - 7,343,742 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936510	7,222,200 - 7,345,138 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SNAP91
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	82,541,018 - 82,698,633 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	1	82,540,998 - 82,698,652 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	92,790,018 - 92,949,958 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SNAP91
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	13	8,221,601 - 8,374,205 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666040	184,439,639 - 184,590,396 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Snap91
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624799	10,915,477 - 11,060,312 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624799	10,913,834 - 11,060,185 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Snap91
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	8	80,822,835 - 80,929,370 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Snap91
748 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	21
Count of miRNA genes:	18
Interacting mature miRNAs:	20
Transcripts:	ENSRNOT00000032792
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
12879878	Bw183	Body weight QTL 183		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	62848139	107848139	Rat
1300177	Cm2	Cardiac mass QTL 2	3.65		heart mass (VT:0007028)	heart weight (CMO:0000017)	8	63141536	109261840	Rat
1549909	Stresp11	Stress response QTL 11	6.83	0.0019	stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	8	82352698	127352698	Rat
1549908	Neudeg1	Neurodegradation QTL 1	5.5	0	nervous system integrity trait (VT:0010566)	logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986)	8	58337123	103337123	Rat
12879879	Cm99	Cardiac mass QTL 99		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	62848139	107848139	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	49849908	118871671	Rat
9590292	Uminl3	Urine mineral level QTL 3	3.62	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	8	80768445	125768445	Rat
1331804	Cm30	Cardiac mass QTL 30	3.77443		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	8	62970527	107970527	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	39106363	103375781	Rat
12879880	Cm100	Cardiac mass QTL 100		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	62848139	107848139	Rat
12879881	Cm101	Cardiac mass QTL 101		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	8	62848139	107848139	Rat
12879882	Am8	Aortic mass QTL 8		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	62848139	107848139	Rat
12879883	Kidm65	Kidney mass QTL 65		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	62848139	107848139	Rat
70161	Bp62	Blood pressure QTL 62	2.9	0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	51589699	99045312	Rat
71120	Niddm21	Non-insulin dependent diabetes mellitus QTL 21	3.73		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	8	66992095	111992095	Rat
1358912	Bw51	Body weight QTL 51	2.95		body mass (VT:0001259)	body weight (CMO:0000012)	8	60248093	105248093	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	39106363	103375781	Rat
634332	Pia18	Pristane induced arthritis QTL 18	4		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	84192326	132782436	Rat
1300171	Bp184	Blood pressure QTL 184	3.66		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	8	79394435	132782436	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	39106258	103375958	Rat
631210	Bw3	Body weight QTL3	5.9		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	8	61019838	121662124	Rat
2293697	Bmd39	Bone mineral density QTL 39			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	8	62848139	107848139	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	63404444	108404444	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	35464071	107982864	Rat
1331837	Bw23	Body weight QTL 23	4.19	0.00007	body mass (VT:0001259)	body weight (CMO:0000012)	8	55428416	107963099	Rat
1331838	Niddm61	Non-insulin dependent diabetes mellitus QTL 61	3.53	0.0004	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	62963099	107963099	Rat
8694446	Bw170	Body weight QTL 170	12.07	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	8	80768445	125768445	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	70041301	121080908	Rat
1331769	Rf39	Renal function QTL 39	3.871		urine output (VT:0003620)	timed urine volume (CMO:0000260)	8	50763951	107970527	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	68690349	119799881	Rat
10450865	Bw175	Body weight QTL 175	4.1		total fat pad mass (VT:0015008)	adipose tissue molecular composition measurement (CMO:0000484)	8	84192326	129192326	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	35464071	107982864	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	55428333	127966348	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	39106363	114525825	Rat
2300181	Bmd55	Bone mineral density QTL 55	5.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	85348065	130348065	Rat
724540	Uae8	Urinary albumin excretion QTL 8	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	8	39106258	103375958	Rat
10402857	Bp380	Blood pressure QTL 380		0.95	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	62848139	107848139	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	35464071	107982864	Rat
2301402	Bp316	Blood pressure QTL 316		0.005	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	62848139	107848139	Rat
631664	Hcar3	Hepatocarcinoma resistance QTL 3	2.9	0.0005	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	8	62982864	107982864	Rat
8694200	Abfw4	Abdominal fat weight QTL 4	9.07	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	8	80768445	125768445	Rat
8694392	Bw161	Body weight QTL 161	8.06	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	8	80768445	125768445	Rat
61437	Cia6	Collagen induced arthritis QTL 6			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	91340911	131690273	Rat

Markers in Region

RH138297

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	87,770,977 - 87,771,142 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	94,483,139 - 94,483,303	NCBI	Rnor6.0
Rnor_5.0	8	93,992,946 - 93,993,110	UniSTS	Rnor5.0
RGSC_v3.4	8	92,065,627 - 92,065,791	UniSTS	RGSC3.4
Celera	8	87,371,070 - 87,371,234	UniSTS
RH 3.4 Map	8	1020.8	UniSTS
Cytogenetic Map	8	q31	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	10	67	159	75	74	43	37	43	6	279	132	8	141	80	90	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031728	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008766455	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017595901	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017595902	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017595903	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017595904	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063266089	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063266090	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063266091	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063266092	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063266093	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063266094	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063266095	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063266096	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063266097	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063266099	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063266100	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063266101	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063266102	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC117045	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473954	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212839	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X68877	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X68878	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000032792 ⟹ ENSRNOP00000030821

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	96,619,265 - 96,732,342 (-)	Ensembl
mRatBN7.2 Ensembl	8	87,739,282 - 87,852,367 (-)	Ensembl
Rnor_6.0 Ensembl	8	94,453,483 - 94,563,760 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000084437 ⟹ ENSRNOP00000071379

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	96,619,265 - 96,732,342 (-)	Ensembl
mRatBN7.2 Ensembl	8	87,739,282 - 87,852,367 (-)	Ensembl
Rnor_6.0 Ensembl	8	94,447,550 - 94,564,525 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000100136 ⟹ ENSRNOP00000088200

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	96,619,265 - 96,732,342 (-)	Ensembl
mRatBN7.2 Ensembl	8	87,739,282 - 87,852,367 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000107255 ⟹ ENSRNOP00000079009

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	96,619,265 - 96,732,342 (-)	Ensembl
mRatBN7.2 Ensembl	8	87,739,282 - 87,852,367 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112856 ⟹ ENSRNOP00000095111

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	96,618,413 - 96,732,342 (-)	Ensembl
mRatBN7.2 Ensembl	8	87,739,282 - 87,852,367 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000113065 ⟹ ENSRNOP00000076368

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	96,618,041 - 96,732,507 (-)	Ensembl
mRatBN7.2 Ensembl	8	87,739,282 - 87,852,367 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000116531 ⟹ ENSRNOP00000076740

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	96,618,413 - 96,732,507 (-)	Ensembl
mRatBN7.2 Ensembl	8	87,738,824 - 87,852,367 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000149302 ⟹ ENSRNOP00000103892

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	96,618,041 - 96,732,507 (-)	Ensembl

RefSeq Acc Id:

NM_031728 ⟹ NP_113916

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	96,618,041 - 96,732,507 (-)	NCBI
mRatBN7.2	8	87,738,058 - 87,852,532 (-)	NCBI
Dahl_SR_JrHsd	8	97,536,608 - 97,645,096 (-)	NCBI
Lyon_Normotensive	8	99,644,884 - 99,751,499 (-)	NCBI
Lyon_Hypertensive	8	98,134,152 - 98,240,771 (-)	NCBI
F344_StmMcwi	8	89,578,925 - 89,687,387 (-)	NCBI
Rnor_6.0	8	94,448,370 - 94,564,497 (-)	NCBI
Rnor_5.0	8	93,958,152 - 94,074,269 (-)	NCBI
RGSC_v3.4	8	92,033,425 - 92,147,091 (-)	RGD
Celera	8	87,338,970 - 87,446,775 (-)	RGD

Sequence:

show sequence

CCGGGCTGCGGTGCTCCTGGGGCGGGAAGAGGAGGCGGTAGACGCGACCGGTGAAGATGTCGGG
CCAAACGCTCACGGATCGGATCGCTGCCGCTCAGTACAGCGTGACTGGCTCTGCTGTAGCAAGA
GCCGTCTGCAAAGCCACCACTCATGAGGTGATGGGCCCCAAGAAGAAGCACCTGGACTATTTGA
TCCAGGCTACCAACGAGACCAATGTCAATATTCCTCAGATGGCGGATACCCTCTTTGAGCGGGC
GACAAACAGCAGCTGGGTGGTGGTATTTAAAGCTTTAGTGACCACACACCACCTCATGGTGCAC
GGAAATGAGAGATTTATTCAGTATTTGGCCTCTAGAAATACGCTGTTCAACCTGAGCAACTTTC
TAGATAAGAGTGGATCCCACGGTTATGATATGTCCACGTTCATACGACGTTATAGTAGATACTT
GAATGAGAAGGCTTTCTCCTACAGACAGATGGCATTCGACTTTGCCAGAGTGAAGAAAGGGGCC
GACGGTGTAATGAGGACAATGGTTCCTGAAAAGTTGCTGAAGAGCATGCCAATCCTGCAGGGGC
AGATCGACGCACTGCTGGAGTTCGATGTGCATCCAAATGAGCTAACAAATGGTGTCATAAATGC
TGCATTTATGCTTCTTTTCAAAGATCTTATCAAACTGTTTGCTTGCTACAATGACGGCGTCATT
AACTTACTTGAAAAATTTTTTGAGATGAAGAAAGGTCAATGCAAAGACGCGCTAGAAATTTACA
AACGATTTCTAACTAGAATGACTCGAGTCTCCGAATTCCTCAAGGTCGCGGACGAAGTTGGTAT
TGATAAAGGTGACATTCCCGACCTCACACAGGCTCCCAGCAGTCTTATGGAGACCCTTGAACAA
CATCTAAATACCCTAGAAGGAAAGAAACCTGGAAACAATGAAGGATCTGGTGCTCCCTCTCCAT
TAAGTAAGTCTTCTCCAGCCACAACTGTTACATCTCCTAATTCTACACCAGCTAAAACTATCGA
CACGTCCCCACCAGTCGACATCTTTGCAACAGCATCCGCGGCTGCCCCAGTCAGCTCTGCTAAG
CCATCAAGCGATCTCCTTGATCTTCAGCCAGACTTCTCCGGAGCACGTGCGGGGGCAGCAGCGC
CTGTACCACCACCTACTGGGGGAGCCACTGCGTGGGGAGACCTTTTGGGAGAGGATTCCTTGGC
TGCACTTTCCTCTGTTCCCTCTGAAGCACCGATTTCTGACCCATTTGCACCAGAACCTTCCCCT
CCTACTACAACCACTGAACCTGCTTCAGCTTCTGCCTCAGCCACCACAGCTGTGACAGCTGCCA
CTACAGAAGTGGATCTCTTTGGAGATGCCTTTGCAGCTTCTCCTGGGGAGGCCCCTGCAGCATC
CGAAGGGGCCACGGCACCAGCTACCCCGGCCCCGGTGGCTGCAGCTCTTGATGCATGCTCAGGA
AATGACCCTTTTGCCCCATCTGAAGGTAGCGCAGAGGCTGCACCTGAGCTCGACCTCTTTGCAA
TGAAGCCACCTGAGACCAGCGCTCCTGTAGTTACCCCTACAGCTAGCACAGCCCCTCCAGTTCC
CGCAACTGCTCCTTCTCCTGCTCCCACGGCTGTGGCAGCCACTGCTGCCACCACCACCGCCGCC
GCTGCAGCTACCACCACTGCCACCACCTCTGCTGCTGCTGCCACCACCGCCGCTGCTCCTCCTG
CTCTAGATATCTTTGGTGATTTGTTTGATTCTGCTCCTGAAGTTGCTGCGGCATCTAAGCCGGA
CGTGGCTCCTAGCATAGACCTGTTTGGCACAGACGCTTTCTCCTCCCCACCACGAGGGGCCTCT
CCGGTGCCTGAGAGTTCTCTCACTGCTGACCTCTTATCCGGGTCTGGGTTTCACTGTGCTGAGG
ATGACCGTCATGTTCCCCTGTTCTTCACTGCTGTGGACGCGTTTGCAGCGCCGTCGCCTGCATC
CACTGCCTCTCCTGCAAAGGCGGAGTCCTCGGGTGTCATAGACCTTTTTGGGGATGCGTTTGGA
AGTAGTGCTTCTGAAACCCAGCCAGCACCACAGGCTGTTTCTAGTTCATCAGCATCGGCAGATC
TACTGGCTGGATTTGGGGGTTCTTTCATGGCCCCTTCTACAACACCTGTGACTCCAGCTCAGAA
TAACCTGCTGCAACCCAATTTTGAGGCAGCTTTTGGAACAACGCCTTCGACTTCAAGCAGCAGC
TCCTTCGACCCATCAGGCGATCTTCTGATGCCAACCATGGCACCGTCCGGGCAGCCTGCCCCTG
TCTCAATGGTCCCACCCAGTCCTGCAATGTCAGCCAGCAAAGGCCTTGGAAGTGACCTTGACTC
GTCTCTGGCCAGCTTAGTAGGCAATCTTGGGATTTCTGGTACCACATCAAAAAAGGGAGATCTC
CAGTGGAATGCTGGGGAGAAGAAGTTGACCGGTGGAGCCAACTGGCAACCAAAAGTCACTCCGG
CCACATGGTCAGCAGGCGTTCCACCGCAAGGCACTGTTCCTCCAACCAGCTCAGTCCCTCCGGG
TGCCGGCGCCCCGTCTGTTGGGCAACCTGGAGCAGGATATGGAATGCCTCCTGCGGGGACAGGC
ATGACCATGATGCCTCAGCAGCCAGTCATGTTTGCACAGCCCATGATGAGGCCACCCTTTGGAG
CTGCAGCTGTGCCCGGCACACAGCTTTCTCCAAGCCCTACACCTGCCACTCAGAGTCCCAAGAA
ACCTCCAGCCAAGGACCCGTTAGCGGATCTTAACATCAAGGATTTCTTGTAAACAATTTAAGCT
GCAATTTTTGTGACTGAATAGGAAAAAACTAAGCTGAGTTTGGAAACGTCAGATAAGATTGATG
CTCAGTTTCAAAGTGAGCCACCAGTACCAAACCCAGTGTGACGCGTAACTTCCTCTCCCAAGCA
CACAGGCCAGCTGTGGCAGTGAACATTAGGAATGTGTACTCTTTAGCTGTTACCCTGCTCTTCC
AGCTCGTAGCGTATTCGGGTTCTTTGTGTGTTGTACGAAGTAAACCATGAGTGAATGAATGGTT
CCAATGCCTTTAGTGCTTTTCTGGACGTTGCCCGTGGACGGAGGATGACGCAGCTGTTCTGTGG
TGAGCCATTTGGAAAGATGTGTCTGTGTTTTCGAAAGGTTTCGATGTATATATAACTTTTGGAC
AAACTCAAGTCCTCCCATGAACTTTCTCTTCTCTTCTGTACCTCTGTTACAAGCGTAATGTGAT
ACTATCAGCTAGTGAGACAAACACTCTTAACTATACAAAAACTTTTTCGGTGTGGAGTACATTT
TTCCAATCACAGAAACTTCCAACTTGTTGTGAGAAATGTTTATTTTTGTGCACTGTATATGTTA
AGAAATTTTATTTTAAAAAAAAATGAA

hide sequence

RefSeq Acc Id:

XM_063266089 ⟹ XP_063122159

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	96,621,288 - 96,732,763 (-)	NCBI

RefSeq Acc Id:

XM_063266090 ⟹ XP_063122160

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	96,621,288 - 96,732,665 (-)	NCBI

RefSeq Acc Id:

XM_063266091 ⟹ XP_063122161

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	96,621,288 - 96,732,763 (-)	NCBI

RefSeq Acc Id:

XM_063266092 ⟹ XP_063122162

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	96,621,288 - 96,732,763 (-)	NCBI

RefSeq Acc Id:

XM_063266093 ⟹ XP_063122163

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	96,618,039 - 96,732,763 (-)	NCBI

RefSeq Acc Id:

XM_063266094 ⟹ XP_063122164

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	96,621,288 - 96,732,763 (-)	NCBI

RefSeq Acc Id:

XM_063266095 ⟹ XP_063122165

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	96,621,288 - 96,732,763 (-)	NCBI

RefSeq Acc Id:

XM_063266096 ⟹ XP_063122166

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	96,621,288 - 96,732,763 (-)	NCBI

RefSeq Acc Id:

XM_063266097 ⟹ XP_063122167

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	96,621,288 - 96,732,763 (-)	NCBI

RefSeq Acc Id:

XM_063266099 ⟹ XP_063122169

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	96,621,288 - 96,732,763 (-)	NCBI

RefSeq Acc Id:

XM_063266100 ⟹ XP_063122170

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	96,621,288 - 96,732,763 (-)	NCBI

RefSeq Acc Id:

XM_063266101 ⟹ XP_063122171

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	96,618,039 - 96,732,763 (-)	NCBI

RefSeq Acc Id:

XM_063266102 ⟹ XP_063122172

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	96,618,039 - 96,732,665 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_113916	(Get FASTA)	NCBI Sequence Viewer
	XP_063122159	(Get FASTA)	NCBI Sequence Viewer
	XP_063122160	(Get FASTA)	NCBI Sequence Viewer
	XP_063122161	(Get FASTA)	NCBI Sequence Viewer
	XP_063122162	(Get FASTA)	NCBI Sequence Viewer
	XP_063122163	(Get FASTA)	NCBI Sequence Viewer
	XP_063122164	(Get FASTA)	NCBI Sequence Viewer
	XP_063122165	(Get FASTA)	NCBI Sequence Viewer
	XP_063122166	(Get FASTA)	NCBI Sequence Viewer
	XP_063122167	(Get FASTA)	NCBI Sequence Viewer
	XP_063122169	(Get FASTA)	NCBI Sequence Viewer
	XP_063122170	(Get FASTA)	NCBI Sequence Viewer
	XP_063122171	(Get FASTA)	NCBI Sequence Viewer
	XP_063122172	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAA48748	(Get FASTA)	NCBI Sequence Viewer
	CAA48749	(Get FASTA)	NCBI Sequence Viewer
	EDL77614	(Get FASTA)	NCBI Sequence Viewer
	EDL77615	(Get FASTA)	NCBI Sequence Viewer
	EDL77616	(Get FASTA)	NCBI Sequence Viewer
	EDL77617	(Get FASTA)	NCBI Sequence Viewer
	EDL77618	(Get FASTA)	NCBI Sequence Viewer
	EDL77619	(Get FASTA)	NCBI Sequence Viewer
	EDL77620	(Get FASTA)	NCBI Sequence Viewer
	EDL77621	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000030821
	ENSRNOP00000076740
	ENSRNOP00000079009
	ENSRNOP00000088200
	ENSRNOP00000095111
	ENSRNOP00000103892
GenBank Protein	Q05140	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_113916 ⟸ NM_031728

- UniProtKB:

Q05140 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MSGQTLTDRIAAAQYSVTGSAVARAVCKATTHEVMGPKKKHLDYLIQATNETNVNIPQMADTLF
ERATNSSWVVVFKALVTTHHLMVHGNERFIQYLASRNTLFNLSNFLDKSGSHGYDMSTFIRRYS
RYLNEKAFSYRQMAFDFARVKKGADGVMRTMVPEKLLKSMPILQGQIDALLEFDVHPNELTNGV
INAAFMLLFKDLIKLFACYNDGVINLLEKFFEMKKGQCKDALEIYKRFLTRMTRVSEFLKVADE
VGIDKGDIPDLTQAPSSLMETLEQHLNTLEGKKPGNNEGSGAPSPLSKSSPATTVTSPNSTPAK
TIDTSPPVDIFATASAAAPVSSAKPSSDLLDLQPDFSGARAGAAAPVPPPTGGATAWGDLLGED
SLAALSSVPSEAPISDPFAPEPSPPTTTTEPASASASATTAVTAATTEVDLFGDAFAASPGEAP
AASEGATAPATPAPVAAALDACSGNDPFAPSEGSAEAAPELDLFAMKPPETSAPVVTPTASTAP
PVPATAPSPAPTAVAATAATTTAAAAATTTATTSAAAATTAAAPPALDIFGDLFDSAPEVAAAS
KPDVAPSIDLFGTDAFSSPPRGASPVPESSLTADLLSGSGFHCAEDDRHVPLFFTAVDAFAAPS
PASTASPAKAESSGVIDLFGDAFGSSASETQPAPQAVSSSSASADLLAGFGGSFMAPSTTPVTP
AQNNLLQPNFEAAFGTTPSTSSSSSFDPSGDLLMPTMAPSGQPAPVSMVPPSPAMSASKGLGSD
LDSSLASLVGNLGISGTTSKKGDLQWNAGEKKLTGGANWQPKVTPATWSAGVPPQGTVPPTSSV
PPGAGAPSVGQPGAGYGMPPAGTGMTMMPQQPVMFAQPMMRPPFGAAAVPGTQLSPSPTPATQS
PKKPPAKDPLADLNIKDFL

hide sequence

Ensembl Acc Id:

ENSRNOP00000071379 ⟸ ENSRNOT00000084437

Ensembl Acc Id:

ENSRNOP00000030821 ⟸ ENSRNOT00000032792

Ensembl Acc Id:

ENSRNOP00000076368 ⟸ ENSRNOT00000113065

Ensembl Acc Id:

ENSRNOP00000088200 ⟸ ENSRNOT00000100136

Ensembl Acc Id:

ENSRNOP00000095111 ⟸ ENSRNOT00000112856

Ensembl Acc Id:

ENSRNOP00000076740 ⟸ ENSRNOT00000116531

Ensembl Acc Id:

ENSRNOP00000079009 ⟸ ENSRNOT00000107255

RefSeq Acc Id:	XP_063122171 ⟸ XM_063266101
- Peptide Label:	isoform X11
- UniProtKB:	A0A8I5Y4X7 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063122163 ⟸ XM_063266093
- Peptide Label:	isoform X4
- UniProtKB:	A0A0G2K0B6 (UniProtKB/TrEMBL), A0A8I5ZLY5 (UniProtKB/TrEMBL), A6I1W3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063122172 ⟸ XM_063266102
- Peptide Label:	isoform X11
- UniProtKB:	A0A8I5Y4X7 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063122170 ⟸ XM_063266100
- Peptide Label:	isoform X10

RefSeq Acc Id:	XP_063122165 ⟸ XM_063266095
- Peptide Label:	isoform X6
- UniProtKB:	A0A8I6GL07 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063122162 ⟸ XM_063266092
- Peptide Label:	isoform X3
- UniProtKB:	F1LRK0 (UniProtKB/TrEMBL), A0A0G2K0B6 (UniProtKB/TrEMBL), A0A8I5ZLY5 (UniProtKB/TrEMBL), A6I1W3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063122167 ⟸ XM_063266097
- Peptide Label:	isoform X8
- UniProtKB:	A0A0G2K0B6 (UniProtKB/TrEMBL), A0A8I5ZLY5 (UniProtKB/TrEMBL), A6I1W3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063122166 ⟸ XM_063266096
- Peptide Label:	isoform X7
- UniProtKB:	A0A0G2K0B6 (UniProtKB/TrEMBL), A0A8I5ZLY5 (UniProtKB/TrEMBL), A6I1W3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063122169 ⟸ XM_063266099
- Peptide Label:	isoform X9
- UniProtKB:	A0A0G2K0B6 (UniProtKB/TrEMBL), A0A8I5ZLY5 (UniProtKB/TrEMBL), A6I1W3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063122164 ⟸ XM_063266094
- Peptide Label:	isoform X5
- UniProtKB:	A0A8I6GL07 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063122161 ⟸ XM_063266091
- Peptide Label:	isoform X2
- UniProtKB:	A0A0G2K0B6 (UniProtKB/TrEMBL), A0A8I5ZLY5 (UniProtKB/TrEMBL), A6I1W3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063122159 ⟸ XM_063266089
- Peptide Label:	isoform X1
- UniProtKB:	A6I1V9 (UniProtKB/TrEMBL), A0A0G2K0B6 (UniProtKB/TrEMBL), A0A8I5ZLY5 (UniProtKB/TrEMBL), A6I1W3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063122160 ⟸ XM_063266090
- Peptide Label:	isoform X1
- UniProtKB:	A6I1V9 (UniProtKB/TrEMBL), A0A0G2K0B6 (UniProtKB/TrEMBL), A0A8I5ZLY5 (UniProtKB/TrEMBL), A6I1W3 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000103892 ⟸ ENSRNOT00000149302

Protein Domains

ENTH

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q05140-F1-model_v2	AlphaFold	Q05140	1-915	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:69276	AgrOrtholog
BioCyc Gene	G2FUF-29635	BioCyc
Ensembl Genes	ENSRNOG00000023861	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000032792	ENTREZGENE
	ENSRNOT00000100136	ENTREZGENE
	ENSRNOT00000107255	ENTREZGENE
	ENSRNOT00000112856	ENTREZGENE
	ENSRNOT00000116531	ENTREZGENE
	ENSRNOT00000149302	ENTREZGENE
Gene3D-CATH	1.20.58.150	UniProtKB/Swiss-Prot
	1.25.40.90	UniProtKB/Swiss-Prot
InterPro	ANTH_dom	UniProtKB/Swiss-Prot
	AP180-like	UniProtKB/Swiss-Prot
	Clathrin_AP_dom2	UniProtKB/Swiss-Prot
	ENTH	UniProtKB/Swiss-Prot
	ENTH_VHS	UniProtKB/Swiss-Prot
KEGG Report	rno:65178	UniProtKB/Swiss-Prot
NCBI Gene	65178	ENTREZGENE
PANTHER	PTHR22951	UniProtKB/Swiss-Prot
	PTHR22951:SF4	UniProtKB/Swiss-Prot
Pfam	ANTH	UniProtKB/Swiss-Prot
PhenoGen	Snap91	PhenoGen
PROSITE	ENTH	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000023861	RatGTEx
SMART	ENTH	UniProtKB/Swiss-Prot
Superfamily-SCOP	GAT-like domain	UniProtKB/Swiss-Prot
	SSF48464	UniProtKB/Swiss-Prot
UniProt	A0A0G2K0B6	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5Y4X5_RAT	UniProtKB/TrEMBL
	A0A8I5Y4X7	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5ZLY5	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A7J5_RAT	UniProtKB/TrEMBL
	A0A8I6GL07	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0L3L7_RAT	UniProtKB/TrEMBL
	A6I1V7_RAT	UniProtKB/TrEMBL
	A6I1V9	ENTREZGENE, UniProtKB/TrEMBL
	A6I1W2_RAT	UniProtKB/TrEMBL
	A6I1W3	ENTREZGENE, UniProtKB/TrEMBL
	AP180_RAT	UniProtKB/Swiss-Prot
	F1LRK0	ENTREZGENE, UniProtKB/TrEMBL
	Q05140	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-03-21	Snap91	synaptosome associated protein 91	Snap91	synaptosomal-associated protein 91	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-18	Snap91	synaptosomal-associated protein 91	Snap91	synaptosomal-associated protein, 91kDa homolog (mouse)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Snap91	synaptosomal-associated protein, 91kDa homolog (mouse)		synaptosomal-associated protein, 91 kDa	Name updated	1299863	APPROVED
2002-06-10	Snap91	synaptosomal-associated protein, 91 kDa			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

RGD Manual Annotations