Symbol:
Socs2
Name:
suppressor of cytokine signaling 2
RGD ID:
69273
Description:
Predicted to enable phosphorylation-dependent protein binding activity; signaling receptor binding activity; and ubiquitin-like ligase-substrate adaptor activity. Involved in response to peptide hormone. Predicted to be part of Cul5-RING ubiquitin ligase complex. Predicted to be active in cytoplasm. Human ortholog(s) of this gene implicated in endometrial cancer and ovarian carcinoma. Orthologous to human SOCS2 (suppressor of cytokine signaling 2); PARTICIPATES IN interleukin-2 signaling pathway; Jak-Stat signaling pathway; insulin signaling pathway; INTERACTS WITH 1,3-dinitrobenzene; 1-naphthyl isothiocyanate; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Cish2; cytokine inducible SH2-containing protein 2; cytokine-inducible SH2 protein 2; Socs-2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 31,890,564 - 31,932,092 (-) NCBI GRCr8 mRatBN7.2 7 30,006,360 - 30,045,161 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 30,008,578 - 30,043,548 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 32,027,095 - 32,029,699 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 34,201,426 - 34,204,033 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 33,970,650 - 33,973,258 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 36,495,496 - 36,500,878 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 36,495,480 - 36,499,784 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 36,558,014 - 36,560,623 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 32,605,714 - 32,608,323 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 32,625,999 - 32,628,594 (-) NCBI Celera 7 27,114,252 - 27,116,861 (-) NCBI Celera Cytogenetic Map 7 q13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Socs2 Rat (-)-demecolcine increases expression ISO SOCS2 (Homo sapiens) 6480464 Demecolcine results in increased expression of SOCS2 mRNA CTD PMID:23649840 Socs2 Rat (1->4)-beta-D-glucan multiple interactions ISO Socs2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of SOCS2 mRNA CTD PMID:36331819 Socs2 Rat 1,2-dichloroethane decreases expression ISO Socs2 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of SOCS2 mRNA CTD PMID:28960355 Socs2 Rat 1,2-dimethylhydrazine decreases expression ISO Socs2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of SOCS2 mRNA CTD PMID:22206623 Socs2 Rat 1,3-dinitrobenzene decreases expression EXP 6480464 3-dinitrobenzene results in decreased expression of SOCS2 mRNA CTD PMID:22841810 Socs2 Rat 1-naphthyl isothiocyanate decreases expression EXP 6480464 1-Naphthylisothiocyanate results in decreased expression of SOCS2 mRNA CTD PMID:30723492 Socs2 Rat 17beta-estradiol increases expression ISO Socs2 (Mus musculus) 6480464 Estradiol results in increased expression of SOCS2 mRNA CTD PMID:19484750 and PMID:25210133 Socs2 Rat 17beta-estradiol decreases expression ISO SOCS2 (Homo sapiens) 6480464 Estradiol results in decreased expression of SOCS2 mRNA CTD PMID:31614463 Socs2 Rat 17beta-estradiol affects expression ISO Socs2 (Mus musculus) 6480464 Estradiol affects the expression of SOCS2 mRNA CTD PMID:39298647 Socs2 Rat 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of SOCS2 mRNA CTD PMID:32145629 Socs2 Rat 17beta-estradiol increases expression ISO SOCS2 (Homo sapiens) 6480464 Estradiol results in increased expression of SOCS2 mRNA CTD PMID:17272397 and PMID:21795739 Socs2 Rat 17beta-estradiol multiple interactions ISO SOCS2 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of SOCS2 mRNA CTD PMID:20660070 Socs2 Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one increases expression ISO SOCS2 (Homo sapiens) 6480464 Metribolone results in increased expression of SOCS2 mRNA CTD PMID:16751804 Socs2 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO SOCS2 (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of SOCS2 mRNA CTD PMID:29581250 Socs2 Rat 2,2',4,4',5,5'-hexachlorobiphenyl affects expression ISO Socs2 (Mus musculus) 6480464 2 more ... CTD PMID:24680724 Socs2 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Socs2 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Socs2 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Socs2 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Socs2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Socs2 (Mus musculus) 6480464 AHR protein promotes the reaction [Tetrachlorodibenzodioxin results in increased expression of SOCS2 mRNA] more ... CTD PMID:15371557 Socs2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of SOCS2 mRNA CTD PMID:33387578 Socs2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of SOCS2 mRNA CTD PMID:34747641 Socs2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Socs2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of SOCS2 mRNA CTD PMID:18372398 more ... Socs2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Socs2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SOCS2 mRNA CTD PMID:18343893 and PMID:21570461 Socs2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO SOCS2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of SOCS2 mRNA CTD PMID:19692669 more ... Socs2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO SOCS2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of SOCS2 mRNA CTD PMID:22298810 Socs2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Socs2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of SOCS2 mRNA and Tetrachlorodibenzodioxin results in increased expression of SOCS2 protein CTD PMID:15371557 Socs2 Rat 2,3,7,8-Tetrachlorodibenzofuran affects expression ISO Socs2 (Mus musculus) 6480464 2 more ... CTD PMID:18343893 Socs2 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression ISO Socs2 (Mus musculus) 6480464 3 more ... CTD PMID:15371557 Socs2 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression ISO SOCS2 (Homo sapiens) 6480464 3 more ... CTD PMID:19692669 Socs2 Rat 3-methylcholanthrene multiple interactions ISO Socs2 (Mus musculus) 6480464 [Methylcholanthrene co-treated with Nanotubes and Carbon] results in increased expression of SOCS2 mRNA CTD PMID:25926378 Socs2 Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of SOCS2 mRNA CTD PMID:19162173 Socs2 Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of SOCS2 mRNA CTD PMID:25380136 Socs2 Rat 4,4'-sulfonyldiphenol increases expression ISO Socs2 (Mus musculus) 6480464 bisphenol S results in increased expression of SOCS2 mRNA CTD PMID:39298647 Socs2 Rat 4-hydroxyphenyl retinamide decreases expression ISO Socs2 (Mus musculus) 6480464 Fenretinide results in decreased expression of SOCS2 mRNA CTD PMID:28973697 Socs2 Rat 4-hydroxyphenyl retinamide increases expression ISO Socs2 (Mus musculus) 6480464 Fenretinide results in increased expression of SOCS2 mRNA CTD PMID:28973697 Socs2 Rat 5-aza-2'-deoxycytidine affects expression ISO SOCS2 (Homo sapiens) 6480464 Decitabine affects the expression of SOCS2 mRNA CTD PMID:23300844 Socs2 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of SOCS2 mRNA CTD PMID:25825206 Socs2 Rat 9-cis-retinoic acid increases expression ISO SOCS2 (Homo sapiens) 6480464 Alitretinoin results in increased expression of SOCS2 mRNA CTD PMID:15982314 Socs2 Rat acetylsalicylic acid increases expression ISO Socs2 (Mus musculus) 6480464 Aspirin results in increased expression of SOCS2 mRNA CTD PMID:16415877 Socs2 Rat acetylsalicylic acid multiple interactions ISO Socs2 (Mus musculus) 6480464 butyloxycarbonyl-phenylalanyl-leucyl-phenylalanyl-leucyl-phenylalanine inhibits the reaction [Aspirin results in increased expression of SOCS2 mRNA] and SOCS2 affects the reaction [Aspirin inhibits the reaction [Lipopolysaccharides results in increased secretion of TNF protein]] CTD PMID:16415877 Socs2 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of SOCS2 mRNA CTD PMID:28959563 Socs2 Rat afimoxifene increases expression ISO SOCS2 (Homo sapiens) 6480464 afimoxifene results in increased expression of SOCS2 mRNA CTD PMID:23373633 Socs2 Rat aflatoxin B1 affects expression ISO SOCS2 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of SOCS2 protein CTD PMID:20106945 Socs2 Rat aflatoxin B1 increases expression ISO SOCS2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of SOCS2 mRNA CTD PMID:27153756 Socs2 Rat aldehydo-D-glucose multiple interactions ISO Socs2 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in decreased expression of SOCS2 mRNA CTD PMID:37567420 Socs2 Rat all-trans-4-oxoretinoic acid increases expression ISO SOCS2 (Homo sapiens) 6480464 4-oxoretinoic acid results in increased expression of SOCS2 mRNA CTD PMID:15982314 Socs2 Rat all-trans-retinoic acid decreases expression ISO Socs2 (Mus musculus) 6480464 Tretinoin results in decreased expression of SOCS2 mRNA CTD PMID:16788091 and PMID:36189433 Socs2 Rat all-trans-retinoic acid multiple interactions ISO Socs2 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of SOCS2 mRNA CTD PMID:36189433 Socs2 Rat all-trans-retinoic acid increases expression ISO SOCS2 (Homo sapiens) 6480464 Tretinoin metabolite results in increased expression of SOCS2 mRNA and Tretinoin results in increased expression of SOCS2 mRNA CTD PMID:15982314 and PMID:21934132 Socs2 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of SOCS2 mRNA CTD PMID:30047161 Socs2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of SOCS2 mRNA CTD PMID:16483693 Socs2 Rat antigen multiple interactions ISO Socs2 (Mus musculus) 6480464 deoxynivalenol inhibits the reaction [Antigens results in increased expression of SOCS2 mRNA] and ochratoxin A inhibits the reaction [Antigens results in increased expression of SOCS2 mRNA] CTD PMID:28935500 Socs2 Rat antigen increases expression ISO Socs2 (Mus musculus) 6480464 Antigens results in increased expression of SOCS2 mRNA CTD PMID:28935500 Socs2 Rat antimycin A decreases expression ISO SOCS2 (Homo sapiens) 6480464 Antimycin A results in decreased expression of SOCS2 mRNA CTD PMID:33512557 Socs2 Rat arsane multiple interactions ISO SOCS2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of SOCS2 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of SOCS2 mRNA CTD PMID:39836092 Socs2 Rat arsenic atom multiple interactions ISO SOCS2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of SOCS2 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of SOCS2 mRNA CTD PMID:39836092 Socs2 Rat arsenous acid increases expression ISO Socs2 (Mus musculus) 6480464 Arsenic Trioxide results in increased expression of SOCS2 mRNA CTD PMID:35676786 Socs2 Rat azoxystrobin decreases expression ISO SOCS2 (Homo sapiens) 6480464 azoxystrobin results in decreased expression of SOCS2 mRNA CTD PMID:33512557 Socs2 Rat benzo[a]pyrene decreases expression ISO Socs2 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of SOCS2 mRNA CTD PMID:19770486 and PMID:32417428 Socs2 Rat benzo[a]pyrene decreases methylation ISO SOCS2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of SOCS2 5' UTR CTD PMID:27901495 Socs2 Rat benzo[a]pyrene affects methylation ISO SOCS2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of SOCS2 3' UTR and Benzo(a)pyrene affects the methylation of SOCS2 promoter CTD PMID:27901495 Socs2 Rat benzo[a]pyrene increases expression ISO SOCS2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of SOCS2 mRNA CTD PMID:20106945 more ... Socs2 Rat benzo[a]pyrene increases expression ISO Socs2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of SOCS2 mRNA CTD PMID:21569818 Socs2 Rat benzoates increases expression ISO SOCS2 (Homo sapiens) 6480464 Benzoates analog results in increased expression of SOCS2 mRNA CTD PMID:29472718 Socs2 Rat beta-lapachone increases expression ISO SOCS2 (Homo sapiens) 6480464 beta-lapachone results in increased expression of SOCS2 mRNA CTD PMID:38218311 Socs2 Rat beta-naphthoflavone increases expression ISO Socs2 (Mus musculus) 6480464 beta-Naphthoflavone results in increased expression of SOCS2 mRNA CTD PMID:15371557 Socs2 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Socs2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of SOCS2 mRNA CTD PMID:21318169 Socs2 Rat bis(2-ethylhexyl) phthalate increases expression ISO Socs2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of SOCS2 mRNA CTD PMID:33754040 Socs2 Rat bisphenol A decreases expression ISO SOCS2 (Homo sapiens) 6480464 bisphenol A results in decreased expression of SOCS2 mRNA CTD PMID:16029874 Socs2 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of SOCS2 mRNA CTD PMID:30903817 and PMID:32145629 Socs2 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of SOCS2 gene CTD PMID:28505145 Socs2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SOCS2 mRNA CTD PMID:25181051 Socs2 Rat bisphenol F decreases expression ISO Socs2 (Mus musculus) 6480464 bisphenol F results in decreased expression of SOCS2 mRNA CTD PMID:38685157 Socs2 Rat cadmium atom increases expression ISO SOCS2 (Homo sapiens) 6480464 Cadmium results in increased expression of SOCS2 mRNA CTD PMID:21120746 Socs2 Rat cadmium dichloride decreases expression ISO SOCS2 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of SOCS2 mRNA CTD PMID:38568856 Socs2 Rat cadmium dichloride increases expression ISO SOCS2 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of SOCS2 protein alternative form CTD PMID:33813002 Socs2 Rat calcitriol decreases expression ISO SOCS2 (Homo sapiens) 6480464 Calcitriol results in decreased expression of SOCS2 mRNA CTD PMID:16002434 Socs2 Rat calcitriol multiple interactions ISO SOCS2 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of SOCS2 mRNA CTD PMID:21592394 Socs2 Rat calcitriol increases expression ISO SOCS2 (Homo sapiens) 6480464 Calcitriol results in increased expression of SOCS2 mRNA CTD PMID:21592394 Socs2 Rat carbamazepine affects expression ISO SOCS2 (Homo sapiens) 6480464 Carbamazepine affects the expression of SOCS2 mRNA CTD PMID:25979313 Socs2 Rat carbon nanotube decreases expression ISO Socs2 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Socs2 Rat carbon nanotube multiple interactions ISO Socs2 (Mus musculus) 6480464 [Methylcholanthrene co-treated with Nanotubes and Carbon] results in increased expression of SOCS2 mRNA CTD PMID:25926378 Socs2 Rat carbon nanotube increases expression ISO Socs2 (Mus musculus) 6480464 Nanotubes and Carbon analog results in increased expression of SOCS2 mRNA CTD PMID:25620056 Socs2 Rat chlordecone decreases expression ISO Socs2 (Mus musculus) 6480464 Chlordecone results in decreased expression of SOCS2 mRNA CTD PMID:33711761 Socs2 Rat choline multiple interactions ISO Socs2 (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc] results in decreased expression of SOCS2 mRNA more ... CTD PMID:20938992 and PMID:33549593 Socs2 Rat ciguatoxin CTX1B affects expression ISO Socs2 (Mus musculus) 6480464 Ciguatoxins affects the expression of SOCS2 mRNA CTD PMID:18353800 Socs2 Rat cisplatin affects response to substance ISO SOCS2 (Homo sapiens) 6480464 SOCS2 protein affects the susceptibility to Cisplatin CTD PMID:16217747 Socs2 Rat cisplatin decreases expression ISO SOCS2 (Homo sapiens) 6480464 Cisplatin results in decreased expression of SOCS2 mRNA CTD PMID:27392435 Socs2 Rat cisplatin affects expression ISO SOCS2 (Homo sapiens) 6480464 Cisplatin affects the expression of SOCS2 mRNA CTD PMID:23300844 Socs2 Rat cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of SOCS2 mRNA CTD PMID:22023808 Socs2 Rat clorgyline increases expression ISO SOCS2 (Homo sapiens) 6480464 Clorgyline results in increased expression of SOCS2 mRNA CTD PMID:19691856 Socs2 Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of SOCS2 mRNA CTD PMID:30556269 Socs2 Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of SOCS2 mRNA CTD PMID:30556269 Socs2 Rat copper(II) sulfate increases expression ISO SOCS2 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of SOCS2 mRNA CTD PMID:19549813 Socs2 Rat coumestrol multiple interactions ISO SOCS2 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 more ... CTD PMID:19167446 Socs2 Rat crocidolite asbestos increases expression ISO SOCS2 (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of SOCS2 mRNA CTD PMID:18687144 Socs2 Rat cyanocob(III)alamin multiple interactions ISO Socs2 (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc] results in decreased expression of SOCS2 mRNA CTD PMID:33549593 Socs2 Rat cycloheximide multiple interactions ISO Socs2 (Mus musculus) 6480464 Cycloheximide promotes the reaction [Tetrachlorodibenzodioxin results in increased expression of SOCS2 mRNA] CTD PMID:15371557 Socs2 Rat cycloheximide increases expression ISO Socs2 (Mus musculus) 6480464 Cycloheximide results in increased expression of SOCS2 mRNA CTD PMID:23237828 Socs2 Rat cyclosporin A increases expression ISO SOCS2 (Homo sapiens) 6480464 Cyclosporine results in increased expression of SOCS2 mRNA CTD PMID:20106945 and PMID:25562108 Socs2 Rat cyclosporin A decreases expression ISO SOCS2 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of SOCS2 mRNA CTD PMID:27989131 Socs2 Rat cypermethrin multiple interactions ISO Socs2 (Mus musculus) 6480464 Sodium Selenite inhibits the reaction [cypermethrin results in decreased expression of SOCS2 mRNA] CTD PMID:31659573 Socs2 Rat cypermethrin decreases expression ISO Socs2 (Mus musculus) 6480464 cypermethrin results in decreased expression of SOCS2 mRNA CTD PMID:31659573 Socs2 Rat D-glucose multiple interactions ISO Socs2 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in decreased expression of SOCS2 mRNA CTD PMID:37567420 Socs2 Rat deguelin decreases expression ISO SOCS2 (Homo sapiens) 6480464 deguelin results in decreased expression of SOCS2 mRNA CTD PMID:33512557 Socs2 Rat deoxynivalenol increases expression ISO Socs2 (Mus musculus) 6480464 deoxynivalenol results in increased expression of SOCS2 mRNA CTD PMID:19625342 Socs2 Rat deoxynivalenol multiple interactions ISO Socs2 (Mus musculus) 6480464 deoxynivalenol inhibits the reaction [Antigens results in increased expression of SOCS2 mRNA] CTD PMID:28935500 Socs2 Rat dexamethasone increases expression ISO Socs2 (Mus musculus) 6480464 Dexamethasone results in increased expression of SOCS2 mRNA CTD PMID:22733784 Socs2 Rat diarsenic trioxide increases expression ISO Socs2 (Mus musculus) 6480464 Arsenic Trioxide results in increased expression of SOCS2 mRNA CTD PMID:35676786 Socs2 Rat dibenz[a,h]anthracene increases expression ISO Socs2 (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Socs2 Rat dibutyl phthalate decreases expression ISO Socs2 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of SOCS2 mRNA CTD PMID:17361019 and PMID:21266533 Socs2 Rat dicrotophos decreases expression ISO SOCS2 (Homo sapiens) 6480464 dicrotophos results in decreased expression of SOCS2 mRNA CTD PMID:28302478 Socs2 Rat diethylstilbestrol decreases expression ISO Socs2 (Mus musculus) 6480464 Diethylstilbestrol results in decreased expression of SOCS2 mRNA CTD PMID:15171707 Socs2 Rat disodium selenite multiple interactions ISO Socs2 (Mus musculus) 6480464 Sodium Selenite inhibits the reaction [cypermethrin results in decreased expression of SOCS2 mRNA] CTD PMID:31659573 Socs2 Rat dorsomorphin multiple interactions ISO SOCS2 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Socs2 Rat doxorubicin decreases expression ISO SOCS2 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of SOCS2 mRNA CTD PMID:29803840 Socs2 Rat Enterolactone multiple interactions ISO SOCS2 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of SOCS2 mRNA CTD PMID:19167446 Socs2 Rat entinostat increases expression ISO SOCS2 (Homo sapiens) 6480464 entinostat results in increased expression of SOCS2 mRNA CTD PMID:26272509 Socs2 Rat entinostat multiple interactions ISO SOCS2 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SOCS2 mRNA CTD PMID:27188386 Socs2 Rat enzalutamide decreases expression ISO SOCS2 (Homo sapiens) 6480464 enzalutamide results in decreased expression of SOCS2 mRNA CTD PMID:29581250 Socs2 Rat epoxiconazole affects expression ISO Socs2 (Mus musculus) 6480464 epoxiconazole affects the expression of SOCS2 mRNA CTD PMID:35436446 Socs2 Rat ethanol decreases expression ISO Socs2 (Mus musculus) 6480464 Ethanol results in decreased expression of SOCS2 mRNA CTD PMID:19167417 Socs2 Rat fenpyroximate decreases expression ISO SOCS2 (Homo sapiens) 6480464 fenpyroximate results in decreased expression of SOCS2 mRNA CTD PMID:33512557 Socs2 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of SOCS2 mRNA CTD PMID:24136188 and PMID:24793618 Socs2 Rat folic acid multiple interactions ISO Socs2 (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc] results in decreased expression of SOCS2 mRNA more ... CTD PMID:20938992 and PMID:33549593 Socs2 Rat folic acid decreases expression ISO Socs2 (Mus musculus) 6480464 Folic Acid results in decreased expression of SOCS2 mRNA CTD PMID:25629700 Socs2 Rat folpet decreases expression ISO Socs2 (Mus musculus) 6480464 folpet results in decreased expression of SOCS2 mRNA CTD PMID:31558096 Socs2 Rat formaldehyde increases expression ISO SOCS2 (Homo sapiens) 6480464 Formaldehyde results in increased expression of SOCS2 mRNA CTD PMID:23649840 Socs2 Rat formaldehyde decreases expression ISO SOCS2 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of SOCS2 mRNA CTD PMID:28937961 Socs2 Rat fructose multiple interactions ISO Socs2 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in decreased expression of SOCS2 mRNA CTD PMID:37567420 Socs2 Rat gamma-hexachlorocyclohexane decreases expression EXP 6480464 Hexachlorocyclohexane results in decreased expression of SOCS2 mRNA CTD PMID:17785943 Socs2 Rat gefitinib decreases expression ISO SOCS2 (Homo sapiens) 6480464 Gefitinib results in decreased expression of SOCS2 mRNA CTD PMID:37948135 Socs2 Rat gefitinib multiple interactions ISO SOCS2 (Homo sapiens) 6480464 SOCS2 protein affects the reaction [[MIR578 affects the susceptibility to Gefitinib] which affects the expression of BECN1 protein] more ... CTD PMID:37948135 Socs2 Rat genistein increases expression ISO Socs2 (Mus musculus) 6480464 Genistein results in increased expression of SOCS2 mRNA CTD PMID:32186404 Socs2 Rat glucose multiple interactions ISO Socs2 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in decreased expression of SOCS2 mRNA CTD PMID:37567420 Socs2 Rat glycine betaine multiple interactions ISO Socs2 (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc] results in decreased expression of SOCS2 mRNA CTD PMID:33549593 Socs2 Rat glyphosate decreases expression ISO SOCS2 (Homo sapiens) 6480464 Glyphosate results in decreased expression of SOCS2 mRNA CTD PMID:31295307 Socs2 Rat hexachlorobenzene affects expression EXP 6480464 Hexachlorobenzene affects the expression of SOCS2 mRNA CTD PMID:15159207 Socs2 Rat hexadecanoic acid multiple interactions ISO SOCS2 (Homo sapiens) 6480464 [Palmitic Acid co-treated with Oleic Acid co-treated with TNF protein] results in increased expression of SOCS2 mRNA and [Palmitic Acid co-treated with Oleic Acid] results in increased expression of SOCS2 mRNA CTD PMID:30547786 Socs2 Rat isotretinoin increases expression ISO SOCS2 (Homo sapiens) 6480464 Isotretinoin results in increased expression of SOCS2 mRNA CTD PMID:15982314 Socs2 Rat L-methionine multiple interactions ISO Socs2 (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc] results in decreased expression of SOCS2 mRNA more ... CTD PMID:20938992 and PMID:33549593 Socs2 Rat leflunomide increases expression ISO SOCS2 (Homo sapiens) 6480464 leflunomide results in increased expression of SOCS2 mRNA CTD PMID:28988120 Socs2 Rat leflunomide increases expression ISO Socs2 (Mus musculus) 6480464 leflunomide results in increased expression of SOCS2 mRNA CTD PMID:19751817 Socs2 Rat lipopolysaccharide multiple interactions ISO SOCS2 (Homo sapiens) 6480464 (+)-JQ1 compound inhibits the reaction [Lipopolysaccharides results in increased expression of SOCS2 mRNA] more ... CTD PMID:25725100 and PMID:35811015 Socs2 Rat lipopolysaccharide multiple interactions ISO Socs2 (Mus musculus) 6480464 SOCS2 affects the reaction [Aspirin inhibits the reaction [Lipopolysaccharides results in increased secretion of TNF protein]] CTD PMID:16415877 Socs2 Rat lipopolysaccharide increases expression ISO Socs2 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of SOCS2 mRNA CTD PMID:12057914 and PMID:22169119 Socs2 Rat lipopolysaccharide increases expression ISO SOCS2 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of SOCS2 mRNA CTD PMID:25725100 and PMID:35811015 Socs2 Rat lipoxin A4 multiple interactions ISO Socs2 (Mus musculus) 6480464 AHR affects the reaction [lipoxin A4 results in increased expression of SOCS2 mRNA] and butyloxycarbonyl-phenylalanyl-leucyl-phenylalanyl-leucyl-phenylalanine inhibits the reaction [lipoxin A4 results in increased expression of SOCS2 mRNA] CTD PMID:16415877 Socs2 Rat lipoxin A4 increases expression ISO Socs2 (Mus musculus) 6480464 lipoxin A4 results in increased expression of SOCS2 mRNA and lipoxin A4 results in increased expression of SOCS2 protein CTD PMID:16415877 Socs2 Rat maneb multiple interactions ISO Socs2 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in increased expression of SOCS2 mRNA CTD PMID:36117858 Socs2 Rat manganese atom multiple interactions ISO SOCS2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of SOCS2 mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of SOCS2 mRNA CTD PMID:39836092 Socs2 Rat manganese(0) multiple interactions ISO SOCS2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of SOCS2 mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of SOCS2 mRNA CTD PMID:39836092 Socs2 Rat manganese(II) chloride multiple interactions ISO SOCS2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of SOCS2 mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of SOCS2 mRNA CTD PMID:39836092 Socs2 Rat mercury dibromide increases expression ISO SOCS2 (Homo sapiens) 6480464 mercuric bromide results in increased expression of SOCS2 mRNA CTD PMID:26272509 Socs2 Rat mercury dibromide multiple interactions ISO SOCS2 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SOCS2 mRNA CTD PMID:27188386 Socs2 Rat metacetamol decreases expression ISO Socs2 (Mus musculus) 6480464 3-hydroxyacetanilide results in decreased expression of SOCS2 mRNA CTD PMID:18544908 Socs2 Rat methapyrilene increases expression EXP 6480464 Methapyrilene results in increased expression of SOCS2 mRNA CTD PMID:22484513 Socs2 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of SOCS2 mRNA CTD PMID:30047161 Socs2 Rat methylmercury chloride decreases expression ISO SOCS2 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of SOCS2 mRNA CTD PMID:28001369 Socs2 Rat methylmercury(1+) increases expression EXP 6480464 methylmercury II results in increased expression of SOCS2 mRNA CTD PMID:17905399 Socs2 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Socs2 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of SOCS2 mRNA CTD PMID:36189433 Socs2 Rat monosodium L-glutamate decreases expression EXP 6480464 Sodium Glutamate results in decreased expression of SOCS2 mRNA and Sodium Glutamate results in decreased expression of SOCS2 protein CTD PMID:25697375 Socs2 Rat monosodium L-glutamate multiple interactions EXP 6480464 Sodium Glutamate inhibits the reaction [GH1 protein results in decreased expression of SOCS2 mRNA] more ... CTD PMID:25697375 Socs2 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [3 more ... CTD PMID:27048571 Socs2 Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of SOCS2 mRNA CTD PMID:25380136 Socs2 Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of SOCS2 mRNA CTD PMID:24136188 Socs2 Rat nickel atom increases expression ISO SOCS2 (Homo sapiens) 6480464 Nickel results in increased expression of SOCS2 mRNA CTD PMID:24768652 and PMID:25583101 Socs2 Rat niclosamide increases expression ISO SOCS2 (Homo sapiens) 6480464 Niclosamide results in increased expression of SOCS2 mRNA CTD PMID:36318118 Socs2 Rat obeticholic acid decreases expression ISO SOCS2 (Homo sapiens) 6480464 obeticholic acid results in decreased expression of SOCS2 mRNA CTD PMID:27939613 Socs2 Rat ochratoxin A multiple interactions ISO Socs2 (Mus musculus) 6480464 ochratoxin A inhibits the reaction [Antigens results in increased expression of SOCS2 mRNA] CTD PMID:28935500 Socs2 Rat oleic acid multiple interactions ISO SOCS2 (Homo sapiens) 6480464 [Palmitic Acid co-treated with Oleic Acid co-treated with TNF protein] results in increased expression of SOCS2 mRNA and [Palmitic Acid co-treated with Oleic Acid] results in increased expression of SOCS2 mRNA CTD PMID:30547786 Socs2 Rat panobinostat multiple interactions ISO SOCS2 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SOCS2 mRNA CTD PMID:27188386 Socs2 Rat panobinostat increases expression ISO SOCS2 (Homo sapiens) 6480464 panobinostat results in increased expression of SOCS2 mRNA CTD PMID:26272509 Socs2 Rat paracetamol decreases expression ISO Socs2 (Mus musculus) 6480464 Acetaminophen results in decreased expression of SOCS2 mRNA CTD PMID:18544908 Socs2 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of SOCS2 mRNA CTD PMID:33387578 Socs2 Rat paracetamol decreases expression ISO SOCS2 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of SOCS2 mRNA CTD PMID:21420995 Socs2 Rat paracetamol increases expression ISO Socs2 (Mus musculus) 6480464 Acetaminophen results in increased expression of SOCS2 mRNA CTD PMID:11264010 Socs2 Rat paraquat multiple interactions ISO Socs2 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in increased expression of SOCS2 mRNA CTD PMID:36117858 Socs2 Rat PCB138 multiple interactions ISO Socs2 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Socs2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Socs2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of SOCS2 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of SOCS2 mRNA CTD PMID:36331819 Socs2 Rat perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of SOCS2 mRNA CTD PMID:19162173 and PMID:21318169 Socs2 Rat phenformin decreases expression EXP 6480464 Phenformin results in decreased expression of SOCS2 mRNA CTD PMID:31324951 Socs2 Rat phenobarbital affects expression ISO SOCS2 (Homo sapiens) 6480464 Phenobarbital affects the expression of SOCS2 mRNA CTD PMID:19159669 Socs2 Rat phenobarbital multiple interactions EXP 6480464 [3 more ... CTD PMID:27048571 Socs2 Rat phenylmercury acetate increases expression ISO SOCS2 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of SOCS2 mRNA CTD PMID:26272509 Socs2 Rat phenylmercury acetate multiple interactions ISO SOCS2 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SOCS2 mRNA CTD PMID:27188386 Socs2 Rat phorbol 13-acetate 12-myristate multiple interactions ISO SOCS2 (Homo sapiens) 6480464 [Zinc co-treated with Tetradecanoylphorbol Acetate] affects the expression of SOCS2 mRNA CTD PMID:16979875 Socs2 Rat picoxystrobin decreases expression ISO SOCS2 (Homo sapiens) 6480464 picoxystrobin results in decreased expression of SOCS2 mRNA CTD PMID:33512557 Socs2 Rat pirinixic acid multiple interactions ISO Socs2 (Mus musculus) 6480464 PPARA protein promotes the reaction [pirinixic acid results in decreased expression of SOCS2 mRNA] CTD PMID:20059764 Socs2 Rat pirinixic acid decreases expression ISO Socs2 (Mus musculus) 6480464 pirinixic acid results in decreased expression of SOCS2 mRNA CTD PMID:11798191 more ... Socs2 Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of SOCS2 mRNA CTD PMID:19162173 Socs2 Rat progesterone decreases expression ISO SOCS2 (Homo sapiens) 6480464 Progesterone results in decreased expression of SOCS2 mRNA CTD PMID:21768398 Socs2 Rat progesterone multiple interactions ISO SOCS2 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of SOCS2 mRNA and [Progesterone co-treated with TGFB1 protein] results in decreased expression of SOCS2 mRNA CTD PMID:20660070 and PMID:21768398 Socs2 Rat protein kinase inhibitor multiple interactions ISO SOCS2 (Homo sapiens) 6480464 Protein Kinase Inhibitors inhibits the reaction [gardiquimod results in increased expression of SOCS2 mRNA] CTD PMID:28003376 Socs2 Rat resveratrol decreases expression ISO SOCS2 (Homo sapiens) 6480464 resveratrol results in decreased expression of SOCS2 mRNA CTD PMID:19371625 Socs2 Rat resveratrol multiple interactions ISO SOCS2 (Homo sapiens) 6480464 [Coumestrol co-treated with resveratrol] results in decreased expression of SOCS2 mRNA CTD PMID:19167446 Socs2 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of SOCS2 mRNA CTD PMID:28374803 Socs2 Rat rotenone decreases expression ISO SOCS2 (Homo sapiens) 6480464 Rotenone results in decreased expression of SOCS2 mRNA CTD PMID:33512557 Socs2 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO SOCS2 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of SOCS2 mRNA] CTD PMID:35811015 Socs2 Rat SB 431542 multiple interactions ISO SOCS2 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Socs2 Rat silicon dioxide increases expression ISO SOCS2 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of SOCS2 mRNA CTD PMID:25895662 Socs2 Rat sodium arsenite decreases expression ISO SOCS2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of SOCS2 mRNA CTD PMID:25493608 and PMID:38568856 Socs2 Rat sodium arsenite multiple interactions ISO SOCS2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of SOCS2 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of SOCS2 mRNA CTD PMID:39836092 Socs2 Rat sodium arsenite multiple interactions ISO Socs2 (Mus musculus) 6480464 [Dietary Fats co-treated with sodium arsenite] results in decreased expression of SOCS2 mRNA CTD PMID:28283972 Socs2 Rat sodium arsenite decreases expression ISO Socs2 (Mus musculus) 6480464 sodium arsenite results in decreased expression of SOCS2 mRNA CTD PMID:28283972 Socs2 Rat sodium arsenite increases expression ISO SOCS2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of SOCS2 mRNA CTD PMID:21281968 and PMID:34032870 Socs2 Rat sodium arsenite affects methylation ISO SOCS2 (Homo sapiens) 6480464 sodium arsenite affects the methylation of SOCS2 gene CTD PMID:28589171 Socs2 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of SOCS2 mRNA CTD PMID:25993096 Socs2 Rat sotorasib multiple interactions ISO SOCS2 (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of SOCS2 mRNA CTD PMID:36139627 Socs2 Rat starch multiple interactions EXP 6480464 Starch analog inhibits the reaction [Rapeseed Oil metabolite results in increased expression of SOCS2 mRNA] CTD PMID:27363782 Socs2 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of SOCS2 mRNA CTD PMID:30047161 Socs2 Rat sulfasalazine decreases expression ISO Socs2 (Mus musculus) 6480464 Sulfasalazine results in decreased expression of SOCS2 mRNA CTD PMID:31830553 Socs2 Rat sunitinib increases expression ISO SOCS2 (Homo sapiens) 6480464 Sunitinib results in increased expression of SOCS2 mRNA CTD PMID:31533062 Socs2 Rat tamoxifen affects expression ISO Socs2 (Mus musculus) 6480464 Tamoxifen affects the expression of SOCS2 mRNA CTD PMID:20937368 Socs2 Rat tebufenpyrad decreases expression ISO SOCS2 (Homo sapiens) 6480464 4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in decreased expression of SOCS2 mRNA CTD PMID:33512557 Socs2 Rat temozolomide increases expression ISO SOCS2 (Homo sapiens) 6480464 Temozolomide results in increased expression of SOCS2 mRNA CTD PMID:31758290 Socs2 Rat testosterone decreases expression ISO Socs2 (Mus musculus) 6480464 Testosterone results in decreased expression of SOCS2 mRNA CTD PMID:15788153 Socs2 Rat testosterone increases expression ISO SOCS2 (Homo sapiens) 6480464 Testosterone results in increased expression of SOCS2 mRNA CTD PMID:21592394 Socs2 Rat testosterone multiple interactions ISO SOCS2 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of SOCS2 mRNA CTD PMID:21592394 Socs2 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of SOCS2 mRNA CTD PMID:23411599 Socs2 Rat thiram increases expression ISO SOCS2 (Homo sapiens) 6480464 Thiram results in increased expression of SOCS2 mRNA CTD PMID:38568856 Socs2 Rat titanium dioxide increases methylation ISO Socs2 (Mus musculus) 6480464 titanium dioxide results in increased methylation of SOCS2 promoter CTD PMID:35295148 Socs2 Rat titanium dioxide decreases methylation ISO Socs2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of SOCS2 promoter CTD PMID:35295148 Socs2 Rat trametinib multiple interactions ISO SOCS2 (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of SOCS2 mRNA CTD PMID:36139627 Socs2 Rat trichloroethene increases expression ISO Socs2 (Mus musculus) 6480464 Trichloroethylene results in increased expression of SOCS2 mRNA CTD PMID:28973375 Socs2 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of SOCS2 mRNA CTD PMID:33387578 Socs2 Rat trichostatin A increases expression ISO SOCS2 (Homo sapiens) 6480464 trichostatin A results in increased expression of SOCS2 mRNA CTD PMID:24935251 Socs2 Rat triphenyl phosphate decreases expression EXP 6480464 triphenyl phosphate results in decreased expression of SOCS2 mRNA CTD PMID:30589522 Socs2 Rat triptonide increases expression ISO Socs2 (Mus musculus) 6480464 triptonide results in increased expression of SOCS2 mRNA CTD PMID:33045310 Socs2 Rat trovafloxacin increases expression EXP 6480464 trovafloxacin results in increased expression of SOCS2 mRNA CTD PMID:24136188 Socs2 Rat trovafloxacin multiple interactions ISO Socs2 (Mus musculus) 6480464 [trovafloxacin co-treated with lipopolysaccharide and E coli O55-B5] results in increased expression of SOCS2 mRNA CTD PMID:18930950 Socs2 Rat tunicamycin decreases expression ISO Socs2 (Mus musculus) 6480464 Tunicamycin results in decreased expression of SOCS2 mRNA CTD PMID:17127020 Socs2 Rat tunicamycin increases expression ISO SOCS2 (Homo sapiens) 6480464 Tunicamycin results in increased expression of SOCS2 mRNA CTD PMID:29453283 Socs2 Rat urethane decreases expression ISO SOCS2 (Homo sapiens) 6480464 Urethane results in decreased expression of SOCS2 mRNA CTD PMID:28818685 Socs2 Rat valproic acid affects expression ISO Socs2 (Mus musculus) 6480464 Valproic Acid affects the expression of SOCS2 mRNA CTD PMID:17292431 Socs2 Rat valproic acid decreases expression ISO SOCS2 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of SOCS2 mRNA CTD PMID:29154799 Socs2 Rat valproic acid affects expression ISO SOCS2 (Homo sapiens) 6480464 Valproic Acid affects the expression of SOCS2 mRNA CTD PMID:25979313 Socs2 Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of SOCS2 mRNA CTD PMID:21318169 Socs2 Rat valproic acid decreases expression ISO Socs2 (Mus musculus) 6480464 Valproic Acid results in decreased expression of SOCS2 mRNA CTD PMID:21427059 Socs2 Rat vancomycin decreases expression ISO Socs2 (Mus musculus) 6480464 Vancomycin results in decreased expression of SOCS2 mRNA CTD PMID:18930951 Socs2 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of SOCS2 mRNA CTD PMID:19015723 Socs2 Rat zinc atom multiple interactions ISO SOCS2 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of SOCS2 mRNA and [Zinc co-treated with Tetradecanoylphorbol Acetate] affects the expression of SOCS2 mRNA CTD PMID:16979875 and PMID:18593933 Socs2 Rat zinc atom multiple interactions ISO Socs2 (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc] results in decreased expression of SOCS2 mRNA CTD PMID:33549593 Socs2 Rat zinc atom decreases expression ISO SOCS2 (Homo sapiens) 6480464 Zinc deficiency results in decreased expression of SOCS2 mRNA CTD PMID:22171008 Socs2 Rat zinc sulfate increases expression ISO SOCS2 (Homo sapiens) 6480464 Zinc Sulfate results in increased expression of SOCS2 mRNA CTD PMID:16330358 Socs2 Rat zinc(0) multiple interactions ISO SOCS2 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of SOCS2 mRNA and [Zinc co-treated with Tetradecanoylphorbol Acetate] affects the expression of SOCS2 mRNA CTD PMID:16979875 and PMID:18593933 Socs2 Rat zinc(0) decreases expression ISO SOCS2 (Homo sapiens) 6480464 Zinc deficiency results in decreased expression of SOCS2 mRNA CTD PMID:22171008 Socs2 Rat zinc(0) multiple interactions ISO Socs2 (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc] results in decreased expression of SOCS2 mRNA CTD PMID:33549593
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(-)-demecolcine (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1,3-dinitrobenzene (EXP) 1-naphthyl isothiocyanate (EXP) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3-methylcholanthrene (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) 9-cis-retinoic acid (ISO) acetylsalicylic acid (ISO) acrylamide (EXP) afimoxifene (ISO) aflatoxin B1 (ISO) aldehydo-D-glucose (ISO) all-trans-4-oxoretinoic acid (ISO) all-trans-retinoic acid (ISO) amitrole (EXP) ammonium chloride (EXP) antigen (ISO) antimycin A (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) azoxystrobin (ISO) benzo[a]pyrene (ISO) benzoates (ISO) beta-lapachone (ISO) beta-naphthoflavone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium atom (ISO) cadmium dichloride (ISO) calcitriol (ISO) carbamazepine (ISO) carbon nanotube (ISO) chlordecone (ISO) choline (ISO) ciguatoxin CTX1B (ISO) cisplatin (EXP,ISO) clorgyline (ISO) copper atom (EXP) copper(0) (EXP) copper(II) sulfate (ISO) coumestrol (ISO) crocidolite asbestos (ISO) cyanocob(III)alamin (ISO) cycloheximide (ISO) cyclosporin A (ISO) cypermethrin (ISO) D-glucose (ISO) deguelin (ISO) deoxynivalenol (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) dibenz[a,h]anthracene (ISO) dibutyl phthalate (ISO) dicrotophos (ISO) diethylstilbestrol (ISO) disodium selenite (ISO) dorsomorphin (ISO) doxorubicin (ISO) Enterolactone (ISO) entinostat (ISO) enzalutamide (ISO) epoxiconazole (ISO) ethanol (ISO) fenpyroximate (ISO) flutamide (EXP) folic acid (ISO) folpet (ISO) formaldehyde (ISO) fructose (ISO) gamma-hexachlorocyclohexane (EXP) gefitinib (ISO) genistein (ISO) glucose (ISO) glycine betaine (ISO) glyphosate (ISO) hexachlorobenzene (EXP) hexadecanoic acid (ISO) isotretinoin (ISO) L-methionine (ISO) leflunomide (ISO) lipopolysaccharide (ISO) lipoxin A4 (ISO) maneb (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) mercury dibromide (ISO) metacetamol (ISO) methapyrilene (EXP) methimazole (EXP) methylmercury chloride (ISO) methylmercury(1+) (EXP) mono(2-ethylhexyl) phthalate (ISO) monosodium L-glutamate (EXP) N-nitrosodiethylamine (EXP) N-nitrosodimethylamine (EXP) nefazodone (EXP) nickel atom (ISO) niclosamide (ISO) obeticholic acid (ISO) ochratoxin A (ISO) oleic acid (ISO) panobinostat (ISO) paracetamol (EXP,ISO) paraquat (ISO) PCB138 (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) phenformin (EXP) phenobarbital (EXP,ISO) phenylmercury acetate (ISO) phorbol 13-acetate 12-myristate (ISO) picoxystrobin (ISO) pirinixic acid (ISO) pregnenolone 16alpha-carbonitrile (EXP) progesterone (ISO) protein kinase inhibitor (ISO) resveratrol (ISO) rotenone (EXP,ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium dichromate (EXP) sotorasib (ISO) starch (EXP) sulfadimethoxine (EXP) sulfasalazine (ISO) sunitinib (ISO) tamoxifen (ISO) tebufenpyrad (ISO) temozolomide (ISO) testosterone (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trametinib (ISO) trichloroethene (EXP,ISO) trichostatin A (ISO) triphenyl phosphate (EXP) triptonide (ISO) trovafloxacin (EXP,ISO) tunicamycin (ISO) urethane (ISO) valproic acid (EXP,ISO) vancomycin (ISO) vinclozolin (EXP) zinc atom (ISO) zinc sulfate (ISO) zinc(0) (ISO)
Biological Process
cell surface receptor signaling pathway via JAK-STAT (IEA,ISO) cellular response to hormone stimulus (IEA,ISO) cytokine-mediated signaling pathway (IBA) growth hormone receptor signaling pathway (IEA,ISO) intracellular signal transduction (IEA,ISO) lactation (IEA,ISO) mammary gland alveolus development (IEA,ISO) negative regulation of growth hormone receptor signaling pathway (IEA,ISO,ISS) negative regulation of multicellular organism growth (IEA,ISO) negative regulation of receptor signaling pathway via JAK-STAT (IBA,IEA,ISO) negative regulation of signal transduction (IEA,ISO) positive regulation of neuron differentiation (IEA,ISO) proteasome-mediated ubiquitin-dependent protein catabolic process (IEA,ISO,ISS) protein ubiquitination (IEA) regulation of multicellular organism growth (IEA,ISO) response to estradiol (IEA,ISO) response to peptide hormone (IEP)
1.
Methylated DNA collected by tampons--a new tool to detect endometrial cancer.
Fiegl H, etal., Cancer Epidemiol Biomarkers Prev. 2004 May;13(5):882-8.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
SOCS2 induces neurite outgrowth by regulation of epidermal growth factor receptor activation.
Goldshmit Y, etal., J Biol Chem 2004 Apr 16;279(16):16349-55. Epub 2004 Feb 4.
4.
Aging-sensitive cellular and molecular mechanisms associated with skeletal muscle hypertrophy.
Haddad F and Adams GR, J Appl Physiol. 2006 Apr;100(4):1188-203. Epub 2005 Dec 22.
5.
Favorable prognostic value of SOCS2 and IGF-I in breast cancer.
Haffner MC, etal., BMC Cancer. 2007 Jul 25;7:136.
6.
Evolution of the androgen receptor pathway during progression of prostate cancer.
Hendriksen PJ, etal., Cancer Res. 2006 May 15;66(10):5012-20.
7.
Sepsis-induced muscle growth hormone resistance occurs independently of STAT5 phosphorylation.
Hong-Brown LQ, etal., Am J Physiol Endocrinol Metab. 2003 Jul;285(1):E63-72. Epub 2003 Mar 18.
8.
Differential expression of suppressors of cytokine signalling genes in response to nutrition and growth hormone in the septic rat.
Johnson TS, etal., J Endocrinol 2001 May;169(2):409-15.
9.
Signaling through the JAK/STAT pathway, recent advances and future challenges.
Kisseleva T, etal., Gene 2002 Feb 20;285(1-2):1-24.
10.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
11.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
13.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
14.
Suppressor of cytokine signalling gene expression is elevated in breast carcinoma.
Raccurt M, etal., Br J Cancer. 2003 Aug 4;89(3):524-32.
15.
GOA pipeline
RGD automated data pipeline
16.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
17.
Comprehensive gene review and curation
RGD comprehensive gene curation
18.
GeneChip analysis after acute spinal cord injury in rat.
Song G, etal., J Neurochem. 2001 Nov;79(4):804-15.
19.
Differential hypermethylation of SOCS genes in ovarian and breast carcinomas.
Sutherland KD, etal., Oncogene. 2004 Oct 7;23(46):7726-33.
20.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
Socs2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 31,890,564 - 31,932,092 (-) NCBI GRCr8 mRatBN7.2 7 30,006,360 - 30,045,161 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 30,008,578 - 30,043,548 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 32,027,095 - 32,029,699 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 34,201,426 - 34,204,033 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 33,970,650 - 33,973,258 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 36,495,496 - 36,500,878 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 36,495,480 - 36,499,784 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 36,558,014 - 36,560,623 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 32,605,714 - 32,608,323 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 32,625,999 - 32,628,594 (-) NCBI Celera 7 27,114,252 - 27,116,861 (-) NCBI Celera Cytogenetic Map 7 q13 NCBI
SOCS2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 93,569,969 - 93,626,236 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 93,569,814 - 93,583,487 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 93,963,745 - 93,970,521 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 92,487,729 - 92,494,109 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 92,466,065 - 92,472,446 NCBI Celera 12 93,634,235 - 93,640,615 (+) NCBI Celera Cytogenetic Map 12 q22 NCBI HuRef 12 91,011,433 - 91,037,277 (+) NCBI HuRef CHM1_1 12 93,928,550 - 93,935,473 (+) NCBI CHM1_1 T2T-CHM13v2.0 12 93,551,422 - 93,607,676 (+) NCBI T2T-CHM13v2.0
Socs2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 95,219,765 - 95,253,176 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 95,221,224 - 95,253,042 (-) Ensembl GRCm39 Ensembl GRCm38 10 95,383,903 - 95,417,321 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 95,385,362 - 95,417,180 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 94,874,124 - 94,879,491 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 94,841,730 - 94,846,509 (-) NCBI MGSCv36 mm8 Celera 10 97,386,894 - 97,392,261 (-) NCBI Celera Cytogenetic Map 10 C2 NCBI cM Map 10 49.35 NCBI
Socs2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955405 30,366,866 - 30,375,468 (+) Ensembl ChiLan1.0 ChiLan1.0 Ensembl NW_004955405 30,451,887 - 30,623,230 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955405 30,349,956 - 30,623,849 (+) NCBI ChiLan1.0 ChiLan1.0
SOCS2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 101,615,299 - 101,632,031 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 101,611,649 - 101,628,420 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 91,115,319 - 91,134,191 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 94,514,455 - 94,520,748 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 94,514,455 - 94,520,748 (+) Ensembl panpan1.1 panPan2
SOCS2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 33,761,434 - 33,788,973 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 15 33,785,545 - 33,877,869 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 34,233,462 - 34,239,473 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 34,451,284 - 34,457,258 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 15 34,451,551 - 34,494,605 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 15 33,731,935 - 33,737,949 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 33,821,213 - 33,827,198 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 34,083,449 - 34,089,425 (+) NCBI UU_Cfam_GSD_1.0
Socs2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 26,219,956 - 26,221,450 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936507 10,012,101 - 10,014,456 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936507 10,013,982 - 10,015,480 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SOCS2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 89,581,090 - 89,584,581 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 89,581,081 - 89,587,424 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 93,712,446 - 93,718,768 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SOCS2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 88,964,805 - 88,971,147 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 88,966,940 - 88,971,515 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 156,190,952 - 156,197,857 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Socs2
.
Predicted Target Of
Count of predictions: 22 Count of miRNA genes: 21 Interacting mature miRNAs: 22 Transcripts: ENSRNOT00000011948 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1354644 Spl4 Serum phospholipid level QTL 4 4.9 blood phospholipid amount (VT:0006084) blood phospholipid level (CMO:0001169) 7 19654317 49753746 Rat 7411569 Bw137 Body weight QTL 137 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 21921195 66921195 Rat 9590102 Sffal5 Serum free fatty acids level QTL 5 8.62 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 7 5329019 50329019 Rat 1578652 Bmd15 Bone mineral density QTL 15 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 7 9866467 60460686 Rat 1641885 Alcrsp9 Alcohol response QTL 9 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 7 24099606 69099606 Rat 631503 Bp102 Blood pressure QTL 102 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 1 44822433 Rat 1549840 Bss5 Bone structure and strength QTL 5 9.8 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 24751841 69751841 Rat 10755438 Coatc9 Coat color QTL 9 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 3529280 48529280 Rat 1300127 Srn1 Serum renin concentration QTL 1 3.87 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 7 29409683 84928080 Rat 2298547 Neuinf5 Neuroinflammation QTL 5 3.7 nervous system integrity trait (VT:0010566) spinal cord Cd74 protein level (CMO:0002131) 7 9462246 58265113 Rat 10059592 Kidm45 Kidney mass QTL 45 3.95 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 7573985 52573985 Rat 2317047 Wbc4 White blood cell count QTL 4 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 7 1 35342956 Rat 10755440 Coatc10 Coat color QTL 10 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 7496499 52496499 Rat 1354637 Scl30 Serum cholesterol level QTL 30 3.7 blood cholesterol amount (VT:0000180) blood total cholesterol level (CMO:0000051) 7 19654317 49753746 Rat 724560 Plsm3 Polydactyly-luxate syndrome (PLS) morphotypes QTL 3 0.0003 tibia length (VT:0004357) tibia length (CMO:0000450) 7 1 34000259 Rat 1354639 Spl5 Serum phospholipid level QTL 5 3.9 blood LDL phospholipid amount (VT:0010505) blood low density lipoprotein phospholipid level (CMO:0001568) 7 19654317 52888450 Rat 7411566 Bw136 Body weight QTL 136 10.4 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 1 31962314 Rat 10755451 Coatc11 Coat color QTL 11 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 17944357 62944357 Rat 2317059 Aia15 Adjuvant induced arthritis QTL 15 2.46 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 7 17004598 62004598 Rat 61410 Bw19 Body weight QTL 19 6.2 0.001 body mass (VT:0001259) body weight (CMO:0000012) 7 1 44782185 Rat 1643004 Pain2 Pain QTL 2 1 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 7 9462246 98011544 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 9590142 Scort5 Serum corticosterone level QTL 5 24.4 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 1 31962314 Rat 1582260 Bw72 Body weight QTL 72 3.2 0.0043 body mass (VT:0001259) body weight (CMO:0000012) 7 15795565 38073970 Rat 1582261 Bw69 Body weight QTL 69 3.2 0.0048 body mass (VT:0001259) body weight (CMO:0000012) 7 15795565 38073970 Rat 1582262 Bw75 Body weight QTL 75 3 0.0038 body mass (VT:0001259) body weight (CMO:0000012) 7 15795565 38073970 Rat 70190 Mcs6 Mammary carcinoma susceptibility QTL 6 2.29 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 7 26737401 63902784 Rat 1300132 Bp182 Blood pressure QTL 182 3.49 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 19654317 84928080 Rat 61369 Mcs2 Mammary carcinoma susceptibility QTL 2 3.38 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 7 19032807 35526300 Rat 1300138 Hrtrt9 Heart rate QTL 9 4.72 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 7 29409683 53612950 Rat 10402855 Bp379 Blood pressure QTL 379 0.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 29409683 74409683 Rat 738033 Anxrr6 Anxiety related response QTL 6 4.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 7 15573889 60573889 Rat
D7Wox52
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 7 31,927,841 - 31,927,986 (+) Marker Load Pipeline mRatBN7.2 7 30,040,966 - 30,041,111 (+) MAPPER mRatBN7.2 Rnor_6.0 7 36,496,639 - 36,496,783 NCBI Rnor6.0 Rnor_5.0 7 36,558,042 - 36,558,186 UniSTS Rnor5.0 RGSC_v3.4 7 32,605,742 - 32,605,886 UniSTS RGSC3.4 Celera 7 27,114,280 - 27,114,424 UniSTS Cytogenetic Map 7 q13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000011948 ⟹ ENSRNOP00000011948
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 30,039,830 - 30,043,548 (-) Ensembl Rnor_6.0 Ensembl 7 36,495,480 - 36,499,784 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000103867 ⟹ ENSRNOP00000089730
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 30,008,578 - 30,043,548 (-) Ensembl
RefSeq Acc Id:
NM_058208 ⟹ NP_478115
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 31,927,814 - 31,930,423 (-) NCBI mRatBN7.2 7 30,040,939 - 30,043,548 (-) NCBI Rnor_6.0 7 36,496,611 - 36,499,220 (-) NCBI Rnor_5.0 7 36,558,014 - 36,560,623 (-) NCBI RGSC_v3.4 7 32,605,714 - 32,608,323 (-) RGD Celera 7 27,114,252 - 27,116,861 (-) RGD
Sequence:
GCGATCTGTGGGTGACAGTGTCTGCGAGAGACTTTGCCATACCATTTTGCGGGAATTTGGAGAGAAACAACCAGCTGCTTCCAGTCCCCTCCCCCTCCGCCACCATTTCGGACACCCCGCACAGACTC
hide sequence
RefSeq Acc Id:
XM_017595137 ⟹ XP_017450626
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 31,926,708 - 31,932,075 (-) NCBI mRatBN7.2 7 30,039,832 - 30,045,156 (-) NCBI Rnor_6.0 7 36,495,496 - 36,500,878 (-) NCBI
Sequence:
GGGGGAGCGAGGGAGGCGCGTCGGGCTGGGAAGTCGCGCGCACACTCTGCTCCGGGGACAGACG
hide sequence
RefSeq Acc Id:
XM_039079991 ⟹ XP_038935919
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 31,890,564 - 31,931,805 (-) NCBI mRatBN7.2 7 30,008,522 - 30,044,621 (-) NCBI
RefSeq Acc Id:
XM_039079992 ⟹ XP_038935920
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 31,890,564 - 31,931,098 (-) NCBI mRatBN7.2 7 30,008,522 - 30,044,136 (-) NCBI
RefSeq Acc Id:
XM_039079993 ⟹ XP_038935921
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 31,900,317 - 31,932,075 (-) NCBI mRatBN7.2 7 30,015,301 - 30,045,158 (-) NCBI
RefSeq Acc Id:
XM_063264345 ⟹ XP_063120415
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 31,926,708 - 31,931,805 (-) NCBI
RefSeq Acc Id:
XM_063264346 ⟹ XP_063120416
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 31,926,708 - 31,931,806 (-) NCBI
RefSeq Acc Id:
XM_063264347 ⟹ XP_063120417
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 31,930,281 - 31,932,092 (-) NCBI
RefSeq Acc Id:
NP_478115 ⟸ NM_058208
- UniProtKB:
O88582 (UniProtKB/Swiss-Prot), A6IG33 (UniProtKB/TrEMBL), A6IG31 (UniProtKB/TrEMBL)
- Sequence:
MTLRCLEPSGNGADRTRSQWGTAGSPEDQSPEAARLAKALRELSQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDY
hide sequence
RefSeq Acc Id:
XP_017450626 ⟸ XM_017595137
- Peptide Label:
isoform X2
- UniProtKB:
O88582 (UniProtKB/Swiss-Prot), A6IG33 (UniProtKB/TrEMBL), A6IG31 (UniProtKB/TrEMBL)
- Sequence:
MTLRCLEPSGNGADRTRSQWGTAGSPEDQSPEAARLAKALRELSQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDY
hide sequence
Ensembl Acc Id:
ENSRNOP00000011948 ⟸ ENSRNOT00000011948
RefSeq Acc Id:
XP_038935919 ⟸ XM_039079991
- Peptide Label:
isoform X1
- UniProtKB:
A6IG31 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038935920 ⟸ XM_039079992
- Peptide Label:
isoform X1
- UniProtKB:
A6IG31 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038935921 ⟸ XM_039079993
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6AD64 (UniProtKB/TrEMBL), A6IG31 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000089730 ⟸ ENSRNOT00000103867
RefSeq Acc Id:
XP_063120416 ⟸ XM_063264346
- Peptide Label:
isoform X2
- UniProtKB:
O88582 (UniProtKB/Swiss-Prot), A6IG33 (UniProtKB/TrEMBL), A6IG31 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063120415 ⟸ XM_063264345
- Peptide Label:
isoform X2
- UniProtKB:
O88582 (UniProtKB/Swiss-Prot), A6IG33 (UniProtKB/TrEMBL), A6IG31 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063120417 ⟸ XM_063264347
- Peptide Label:
isoform X4
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Socs2
suppressor of cytokine signaling 2
Cish2
cytokine inducible SH2-containing protein 2
Symbol and Name updated
1299863 APPROVED
2002-06-10
Cish2
cytokine inducible SH2-containing protein 2
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_process
negative regulator of growth hormone (GH) signaling that regulates body growth postnatally and neuronal differentiation during development
1302348
gene_product
member of a family of negative regulators of cytokine signalling
634752
