Advanced Search (OLGA)

Gene: Aplp1 (amyloid beta precursor like protein 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Aplp1

Name:

amyloid beta precursor like protein 1

RGD ID:

69257

Description:

Predicted to enable adrenergic receptor binding activity and identical protein binding activity. Predicted to be involved in cellular response to norepinephrine stimulus; negative regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway; and nervous system development. Predicted to act upstream of or within several processes, including cytosolic mRNA polyadenylation; extracellular matrix organization; and regulation of translation. Predicted to be located in membrane; nucleoplasm; and perinuclear region of cytoplasm. Predicted to be active in Golgi apparatus and plasma membrane. Orthologous to human APLP1 (amyloid beta precursor like protein 1); INTERACTS WITH (+)-pilocarpine; 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

amyloid beta (A4) precursor-like protein 1; amyloid beta (A4) precursor-like protein 1 (mapped); amyloid-like protein 1; Aplp1_mapped; Aplp1_retired; LOC502317; RGD1561211; similar to Amyloid beta (A4) precursor-like protein 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	APLP1 (amyloid beta precursor like protein 1)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Aplp1 (amyloid beta precursor like protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Aplp1 (amyloid beta precursor like protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	APLP1 (amyloid beta precursor like protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	APLP1 (amyloid beta precursor like protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Aplp1 (amyloid beta precursor like protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	APLP1 (amyloid beta precursor like protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	APLP1 (amyloid beta precursor like protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Aplp1 (amyloid beta precursor like protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	NUP88 (nucleoporin 88)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	APLP1 (amyloid beta precursor like protein 1)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Aplp1 (amyloid beta precursor like protein 1)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	aplp1 (amyloid beta (A4) precursor-like protein 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Appl	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	apl-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	aplp1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	94,824,330 - 94,834,705 (-)	NCBI		GRCr8
mRatBN7.2	1	85,696,880 - 85,707,215 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	85,696,882 - 85,707,155 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	91,113,388 - 91,123,714 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	99,579,915 - 99,590,199 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	92,871,656 - 92,881,982 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	88,897,525 - 88,908,750 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	88,897,532 - 88,908,750 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	90,053,390 - 90,063,110 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	85,390,217 - 85,401,952 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	80,069,348 - 80,079,276 (-)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Aplp1	Rat	Brugada syndrome 5		ISO	APLP1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Brugada syndrome 5	ClinVar	PMID:28492532
Aplp1	Rat	hereditary spastic paraplegia 75		ISO	APLP1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hereditary spastic paraplegia 75	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Aplp1	Rat	(+)-pilocarpine	decreases expression	EXP		6480464	Pilocarpine results in decreased expression of APLP1 mRNA	CTD	PMID:19448684
Aplp1	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Aplp1 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of APLP1 mRNA	CTD	PMID:22206623
Aplp1	Rat	17alpha-ethynylestradiol	multiple interactions	ISO	Aplp1 (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of APLP1 mRNA	CTD	PMID:17942748
Aplp1	Rat	17alpha-ethynylestradiol	affects expression	ISO	Aplp1 (Mus musculus)	6480464	Ethinyl Estradiol affects the expression of APLP1 mRNA	CTD	PMID:17555576
Aplp1	Rat	17alpha-ethynylestradiol	increases expression	ISO	Aplp1 (Mus musculus)	6480464	Ethinyl Estradiol results in increased expression of APLP1 mRNA	CTD	PMID:17942748
Aplp1	Rat	17beta-estradiol	increases expression	ISO	Aplp1 (Mus musculus)	6480464	Estradiol results in increased expression of APLP1 mRNA	CTD	PMID:22467019
Aplp1	Rat	17beta-estradiol	multiple interactions	ISO	APLP1 (Homo sapiens)	6480464	[Estradiol co-treated with TGFB1 protein] results in increased expression of APLP1 mRNA	CTD	PMID:30165855
Aplp1	Rat	2,2',4,4'-Tetrabromodiphenyl ether	decreases expression	EXP		6480464	2 more ...	CTD	PMID:21394737
Aplp1	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	Aplp1 (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of APLP1 mRNA	CTD	PMID:17942748
Aplp1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of APLP1 mRNA	CTD	PMID:32109520 and PMID:33387578
Aplp1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Aplp1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in increased expression of APLP1 mRNA	CTD	PMID:17942748
Aplp1	Rat	3,4-methylenedioxymethamphetamine	increases expression	ISO	Aplp1 (Mus musculus)	6480464	N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of APLP1 mRNA	CTD	PMID:20188158
Aplp1	Rat	4,4'-sulfonyldiphenol	decreases methylation	ISO	Aplp1 (Mus musculus)	6480464	bisphenol S results in decreased methylation of APLP1 exon	CTD	PMID:33297965
Aplp1	Rat	4,4'-sulfonyldiphenol	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of APLP1 mRNA	CTD	PMID:36041667
Aplp1	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of APLP1 mRNA	CTD	PMID:36843608
Aplp1	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of APLP1 mRNA	CTD	PMID:30047161
Aplp1	Rat	acetamide	decreases expression	EXP		6480464	acetamide results in decreased expression of APLP1 mRNA	CTD	PMID:31881176
Aplp1	Rat	actinomycin D	multiple interactions	ISO	APLP1 (Homo sapiens)	6480464	[Dactinomycin co-treated with nutlin 3] results in increased expression of APLP1 mRNA	CTD	PMID:38460933
Aplp1	Rat	aflatoxin B1	affects expression	ISO	APLP1 (Homo sapiens)	6480464	Aflatoxin B1 affects the expression of APLP1 protein	CTD	PMID:20106945
Aplp1	Rat	aflatoxin B1	decreases expression	EXP		6480464	Aflatoxin B1 results in decreased expression of APLP1 mRNA	CTD	PMID:33354967
Aplp1	Rat	aflatoxin B1	increases expression	ISO	APLP1 (Homo sapiens)	6480464	Aflatoxin B1 results in increased expression of APLP1 mRNA	CTD	PMID:21632981
Aplp1	Rat	all-trans-retinoic acid	increases expression	ISO	APLP1 (Homo sapiens)	6480464	Tretinoin results in increased expression of APLP1 protein	CTD	PMID:16150056
Aplp1	Rat	all-trans-retinoic acid	increases N-linked glycosylation	ISO	APLP1 (Homo sapiens)	6480464	Tretinoin results in increased N-linked glycosylation of APLP1 protein	CTD	PMID:16150056
Aplp1	Rat	all-trans-retinoic acid	multiple interactions	ISO	APLP1 (Homo sapiens)	6480464	BDNF protein inhibits the reaction [Tretinoin results in increased N-linked glycosylation of APLP1 protein]	CTD	PMID:16150056
Aplp1	Rat	amitrole	decreases expression	EXP		6480464	Amitrole results in decreased expression of APLP1 mRNA	CTD	PMID:30047161
Aplp1	Rat	antimycin A	decreases expression	ISO	APLP1 (Homo sapiens)	6480464	Antimycin A results in decreased expression of APLP1 mRNA	CTD	PMID:33512557
Aplp1	Rat	aristolochic acid A	increases expression	ISO	APLP1 (Homo sapiens)	6480464	aristolochic acid I results in increased expression of APLP1 mRNA	CTD	PMID:33212167
Aplp1	Rat	arsane	affects methylation	ISO	APLP1 (Homo sapiens)	6480464	Arsenic affects the methylation of APLP1 gene	CTD	PMID:25304211
Aplp1	Rat	arsenic atom	affects methylation	ISO	APLP1 (Homo sapiens)	6480464	Arsenic affects the methylation of APLP1 gene	CTD	PMID:25304211
Aplp1	Rat	atrazine	increases expression	ISO	APLP1 (Homo sapiens)	6480464	Atrazine results in increased expression of APLP1 mRNA	CTD	PMID:22378314
Aplp1	Rat	azoxystrobin	decreases expression	ISO	APLP1 (Homo sapiens)	6480464	azoxystrobin results in decreased expression of APLP1 mRNA	CTD	PMID:33512557
Aplp1	Rat	benzo[a]pyrene	increases expression	ISO	Aplp1 (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of APLP1 mRNA	CTD	PMID:22228805
Aplp1	Rat	benzo[a]pyrene	increases methylation	ISO	APLP1 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of APLP1 promoter	CTD	PMID:27901495
Aplp1	Rat	benzo[a]pyrene	increases expression	ISO	APLP1 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased expression of APLP1 mRNA	CTD	PMID:20106945 and PMID:21632981
Aplp1	Rat	bis(2-ethylhexyl) phthalate	multiple interactions	ISO	Aplp1 (Mus musculus)	6480464	[diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of APLP1 mRNA	CTD	PMID:39150890
Aplp1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of APLP1 mRNA	CTD	PMID:25181051 more ...
Aplp1	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of APLP1 mRNA	CTD	PMID:36041667
Aplp1	Rat	bisphenol F	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of APLP1 mRNA	CTD	PMID:36041667
Aplp1	Rat	Butylbenzyl phthalate	multiple interactions	ISO	Aplp1 (Mus musculus)	6480464	[diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of APLP1 mRNA	CTD	PMID:39150890
Aplp1	Rat	butyric acid	increases expression	ISO	APLP1 (Homo sapiens)	6480464	Butyric Acid results in increased expression of APLP1 mRNA	CTD	PMID:34581912
Aplp1	Rat	cisplatin	multiple interactions	ISO	APLP1 (Homo sapiens)	6480464	[Cisplatin co-treated with jinfukang] results in increased expression of APLP1 mRNA	CTD	PMID:27392435
Aplp1	Rat	cisplatin	increases expression	ISO	APLP1 (Homo sapiens)	6480464	Cisplatin results in increased expression of APLP1 mRNA	CTD	PMID:27392435
Aplp1	Rat	copper atom	increases expression	ISO	Aplp1 (Mus musculus)	6480464	Copper results in increased expression of APLP1 mRNA	CTD	PMID:16629173
Aplp1	Rat	copper atom	affects localization	ISO	APLP1 (Homo sapiens)	6480464	Copper affects the localization of APLP1 protein	CTD	PMID:24855651
Aplp1	Rat	copper atom	affects binding	ISO	APLP1 (Homo sapiens)	6480464	APLP1 protein binds to Copper	CTD	PMID:24855651
Aplp1	Rat	copper(0)	increases expression	ISO	Aplp1 (Mus musculus)	6480464	Copper results in increased expression of APLP1 mRNA	CTD	PMID:16629173
Aplp1	Rat	copper(0)	affects localization	ISO	APLP1 (Homo sapiens)	6480464	Copper affects the localization of APLP1 protein	CTD	PMID:24855651
Aplp1	Rat	copper(0)	affects binding	ISO	APLP1 (Homo sapiens)	6480464	APLP1 protein binds to Copper	CTD	PMID:24855651
Aplp1	Rat	crocidolite asbestos	increases expression	ISO	Aplp1 (Mus musculus)	6480464	Asbestos and Crocidolite results in increased expression of APLP1 mRNA	CTD	PMID:29279043
Aplp1	Rat	cyclosporin A	decreases expression	ISO	APLP1 (Homo sapiens)	6480464	Cyclosporine results in decreased expression of APLP1 mRNA	CTD	PMID:27989131
Aplp1	Rat	deguelin	decreases expression	ISO	APLP1 (Homo sapiens)	6480464	deguelin results in decreased expression of APLP1 mRNA	CTD	PMID:33512557
Aplp1	Rat	dibenzofurans	decreases expression	ISO	Aplp1 (Mus musculus)	6480464	Dibenzofurans results in decreased expression of APLP1 mRNA	CTD	PMID:34254344
Aplp1	Rat	dibutyl phthalate	multiple interactions	ISO	Aplp1 (Mus musculus)	6480464	[diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of APLP1 mRNA	CTD	PMID:39150890
Aplp1	Rat	dieldrin	affects expression	EXP		6480464	Dieldrin affects the expression of APLP1 mRNA	CTD	PMID:22546817
Aplp1	Rat	diethyl maleate	decreases expression	ISO	Aplp1 (Mus musculus)	6480464	diethyl maleate results in decreased expression of APLP1 mRNA	CTD	PMID:25270620
Aplp1	Rat	diethyl phthalate	multiple interactions	ISO	Aplp1 (Mus musculus)	6480464	[diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of APLP1 mRNA	CTD	PMID:39150890
Aplp1	Rat	diisobutyl phthalate	multiple interactions	ISO	Aplp1 (Mus musculus)	6480464	[diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of APLP1 mRNA	CTD	PMID:39150890
Aplp1	Rat	diisononyl phthalate	multiple interactions	ISO	Aplp1 (Mus musculus)	6480464	[diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of APLP1 mRNA	CTD	PMID:39150890
Aplp1	Rat	doxorubicin	increases expression	ISO	APLP1 (Homo sapiens)	6480464	Doxorubicin results in increased expression of APLP1 mRNA	CTD	PMID:29803840 more ...
Aplp1	Rat	endosulfan	increases expression	EXP		6480464	Endosulfan results in increased expression of APLP1 mRNA	CTD	PMID:29391264
Aplp1	Rat	ethanol	affects splicing	ISO	Aplp1 (Mus musculus)	6480464	Ethanol affects the splicing of APLP1 mRNA	CTD	PMID:30319688
Aplp1	Rat	ethylenediaminetetraacetic acid	multiple interactions	ISO	APLP1 (Homo sapiens)	6480464	Edetic Acid inhibits the reaction [Zinc affects the localization of APLP1 protein]	CTD	PMID:24855651
Aplp1	Rat	etoposide	decreases expression	ISO	Aplp1 (Mus musculus)	6480464	Etoposide results in decreased expression of APLP1 mRNA	CTD	PMID:25270620
Aplp1	Rat	folic acid	multiple interactions	ISO	Aplp1 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of APLP1 mRNA	CTD	PMID:22206623
Aplp1	Rat	genistein	increases expression	ISO	Aplp1 (Mus musculus)	6480464	Genistein results in increased expression of APLP1 mRNA	CTD	PMID:32186404
Aplp1	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of APLP1 mRNA	CTD	PMID:33387578
Aplp1	Rat	Heptachlor epoxide	increases expression	ISO	Aplp1 (Mus musculus)	6480464	Heptachlor Epoxide results in increased expression of APLP1 mRNA	CTD	PMID:25270620
Aplp1	Rat	hydrazine	decreases expression	ISO	Aplp1 (Mus musculus)	6480464	hydrazine results in decreased expression of APLP1 mRNA	CTD	PMID:15282401
Aplp1	Rat	lipopolysaccharide	increases expression	ISO	Aplp1 (Mus musculus)	6480464	Lipopolysaccharides results in increased expression of APLP1 mRNA	CTD	PMID:15919760
Aplp1	Rat	methimazole	decreases expression	EXP		6480464	Methimazole results in decreased expression of APLP1 mRNA	CTD	PMID:30047161
Aplp1	Rat	methotrexate	affects expression	ISO	Aplp1 (Mus musculus)	6480464	Methotrexate affects the expression of APLP1 mRNA	CTD	PMID:18502557
Aplp1	Rat	methylmercury chloride	decreases expression	ISO	APLP1 (Homo sapiens)	6480464	methylmercuric chloride results in decreased expression of APLP1 mRNA	CTD	PMID:28001369
Aplp1	Rat	mono(2-ethylhexyl) phthalate	decreases expression	ISO	APLP1 (Homo sapiens)	6480464	mono-(2-ethylhexyl)phthalate results in decreased expression of APLP1 mRNA	CTD	PMID:38685446
Aplp1	Rat	Nutlin-3	multiple interactions	ISO	APLP1 (Homo sapiens)	6480464	[Dactinomycin co-treated with nutlin 3] results in increased expression of APLP1 mRNA	CTD	PMID:38460933
Aplp1	Rat	paracetamol	increases expression	ISO	APLP1 (Homo sapiens)	6480464	Acetaminophen results in increased expression of APLP1 mRNA	CTD	PMID:22230336
Aplp1	Rat	picoxystrobin	decreases expression	ISO	APLP1 (Homo sapiens)	6480464	picoxystrobin results in decreased expression of APLP1 mRNA	CTD	PMID:33512557
Aplp1	Rat	pirinixic acid	decreases expression	ISO	Aplp1 (Mus musculus)	6480464	pirinixic acid results in decreased expression of APLP1 mRNA	CTD	PMID:17426115
Aplp1	Rat	pirinixic acid	increases expression	ISO	Aplp1 (Mus musculus)	6480464	pirinixic acid results in increased expression of APLP1 mRNA	CTD	PMID:23811191
Aplp1	Rat	pyrimidifen	decreases expression	ISO	APLP1 (Homo sapiens)	6480464	pyrimidifen results in decreased expression of APLP1 mRNA	CTD	PMID:33512557
Aplp1	Rat	quercetin	increases expression	ISO	APLP1 (Homo sapiens)	6480464	Quercetin results in increased expression of APLP1 mRNA	CTD	PMID:21632981
Aplp1	Rat	rotenone	decreases expression	ISO	APLP1 (Homo sapiens)	6480464	Rotenone results in decreased expression of APLP1 mRNA	CTD	PMID:33512557
Aplp1	Rat	sarin	increases expression	ISO	APLP1 (Homo sapiens)	6480464	Sarin results in increased expression of APLP1 mRNA	CTD	PMID:19522546
Aplp1	Rat	silicon dioxide	decreases expression	ISO	APLP1 (Homo sapiens)	6480464	Silicon Dioxide analog results in decreased expression of APLP1 mRNA	CTD	PMID:25895662
Aplp1	Rat	sodium arsenite	increases expression	ISO	APLP1 (Homo sapiens)	6480464	sodium arsenite results in increased expression of APLP1 mRNA	CTD	PMID:34032870
Aplp1	Rat	sulfadimethoxine	decreases expression	EXP		6480464	Sulfadimethoxine results in decreased expression of APLP1 mRNA	CTD	PMID:30047161
Aplp1	Rat	sulforaphane	decreases expression	ISO	APLP1 (Homo sapiens)	6480464	sulforaphane results in decreased expression of APLP1 mRNA	CTD	PMID:31838189
Aplp1	Rat	tamoxifen	affects expression	ISO	Aplp1 (Mus musculus)	6480464	Tamoxifen affects the expression of APLP1 mRNA	CTD	PMID:17555576
Aplp1	Rat	temozolomide	decreases expression	ISO	APLP1 (Homo sapiens)	6480464	Temozolomide results in decreased expression of APLP1 mRNA	CTD	PMID:31758290
Aplp1	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of APLP1 mRNA	CTD	PMID:23411599
Aplp1	Rat	titanium dioxide	decreases expression	ISO	Aplp1 (Mus musculus)	6480464	titanium dioxide results in decreased expression of APLP1 mRNA	CTD	PMID:23557971
Aplp1	Rat	titanium dioxide	increases expression	ISO	Aplp1 (Mus musculus)	6480464	titanium dioxide results in increased expression of APLP1 mRNA	CTD	PMID:29264374
Aplp1	Rat	triptonide	increases expression	ISO	Aplp1 (Mus musculus)	6480464	triptonide results in increased expression of APLP1 mRNA	CTD	PMID:33045310
Aplp1	Rat	valproic acid	increases expression	ISO	APLP1 (Homo sapiens)	6480464	Valproic Acid results in increased expression of APLP1 mRNA	CTD	PMID:23179753 and PMID:29154799
Aplp1	Rat	valproic acid	affects expression	ISO	APLP1 (Homo sapiens)	6480464	Valproic Acid affects the expression of APLP1 mRNA	CTD	PMID:25979313
Aplp1	Rat	vinclozolin	decreases expression	EXP		6480464	vinclozolin results in decreased expression of APLP1 mRNA	CTD	PMID:23034163
Aplp1	Rat	zinc atom	affects localization	ISO	APLP1 (Homo sapiens)	6480464	Zinc affects the localization of APLP1 protein	CTD	PMID:24855651
Aplp1	Rat	zinc atom	multiple interactions	ISO	APLP1 (Homo sapiens)	6480464	Edetic Acid inhibits the reaction [Zinc affects the localization of APLP1 protein] more ...	CTD	PMID:24855651
Aplp1	Rat	zinc atom	affects binding	ISO	APLP1 (Homo sapiens)	6480464	APLP1 protein binds to Zinc	CTD	PMID:24855651
Aplp1	Rat	zinc(0)	affects localization	ISO	APLP1 (Homo sapiens)	6480464	Zinc affects the localization of APLP1 protein	CTD	PMID:24855651
Aplp1	Rat	zinc(0)	affects binding	ISO	APLP1 (Homo sapiens)	6480464	APLP1 protein binds to Zinc	CTD	PMID:24855651
Aplp1	Rat	zinc(0)	multiple interactions	ISO	APLP1 (Homo sapiens)	6480464	Edetic Acid inhibits the reaction [Zinc affects the localization of APLP1 protein] more ...	CTD	PMID:24855651

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Aplp1	Rat	axonogenesis	involved_in	IBA	MGI:88059 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Aplp1	Rat	cellular response to norepinephrine stimulus	involved_in	ISO	APLP1 (Homo sapiens)	1624291	PMID:16531006	RGD	PMID:16531006
Aplp1	Rat	cellular response to norepinephrine stimulus	involved_in	IEA	UniProtKB:P51693 and ensembl:ENSP00000221891	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Aplp1	Rat	central nervous system development	involved_in	IBA	FB:FBgn0000108 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Aplp1	Rat	cytosolic mRNA polyadenylation	acts_upstream_of_or_within	ISO	Aplp1 (Mus musculus)	1624291	PMID:16314516	RGD	PMID:16314516
Aplp1	Rat	cytosolic mRNA polyadenylation	acts_upstream_of_or_within	IEA	UniProtKB:Q03157 and ensembl:ENSMUSP00000006828	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Aplp1	Rat	extracellular matrix organization	acts_upstream_of_or_within	ISO	Aplp1 (Mus musculus)	1624291	MGI:88047 more ...	RGD	PMID:15385965
Aplp1	Rat	extracellular matrix organization	acts_upstream_of_or_within	IEA	UniProtKB:Q03157 and ensembl:ENSMUSP00000006828	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Aplp1	Rat	forebrain development	acts_upstream_of_or_within	ISO	Aplp1 (Mus musculus)	1624291	MGI:88047 more ...	RGD	PMID:15385965
Aplp1	Rat	forebrain development	acts_upstream_of_or_within	IEA	UniProtKB:Q03157 and ensembl:ENSMUSP00000006828	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Aplp1	Rat	negative regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway	involved_in	ISO	APLP1 (Homo sapiens)	1624291	PMID:16531006	RGD	PMID:16531006
Aplp1	Rat	negative regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway	involved_in	IEA	UniProtKB:P51693 and ensembl:ENSP00000221891	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Aplp1	Rat	regulation of translation	acts_upstream_of_or_within	ISO	Aplp1 (Mus musculus)	1624291	PMID:16314516	RGD	PMID:16314516
Aplp1	Rat	regulation of translation	acts_upstream_of_or_within	IEA	UniProtKB:Q03157 and ensembl:ENSMUSP00000006828	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Aplp1	Rat	endomembrane system	located_in	IEA	ARBA:ARBA00028953	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Aplp1	Rat	Golgi apparatus	located_in	ISO	APLP1 (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Aplp1	Rat	Golgi apparatus	located_in	IEA	UniProtKB:P51693 and ensembl:ENSP00000221891	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Aplp1	Rat	Golgi apparatus	located_in	IEA	UniProtKB:Q03157 and ensembl:ENSMUSP00000006828	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Aplp1	Rat	Golgi apparatus	is_active_in	IBA	MGI:88046 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Aplp1	Rat	Golgi apparatus	located_in	ISO	Aplp1 (Mus musculus)	1624291	PMID:1279693	RGD	PMID:1279693
Aplp1	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Aplp1	Rat	membrane	located_in	ISO	Aplp1 (Mus musculus)	1624291	PMID:16314516	RGD	PMID:16314516
Aplp1	Rat	membrane	located_in	IEA	UniProtKB:Q03157 and ensembl:ENSMUSP00000006828	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Aplp1	Rat	membrane	located_in	IEA	UniProtKB-SubCell:SL-0162	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Aplp1	Rat	membrane	located_in	IEA	InterPro:IPR008155	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Aplp1	Rat	nucleoplasm	located_in	IEA	UniProtKB:P51693 and ensembl:ENSP00000221891	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Aplp1	Rat	nucleoplasm	located_in	ISO	APLP1 (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Aplp1	Rat	perinuclear region of cytoplasm	located_in	ISO	APLP1 (Homo sapiens)	1624291	PMID:16531006	RGD	PMID:16531006
Aplp1	Rat	perinuclear region of cytoplasm	located_in	IEA	UniProtKB:P51693 and ensembl:ENSP00000221891	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Aplp1	Rat	plasma membrane	located_in	ISO	APLP1 (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Aplp1	Rat	plasma membrane	is_active_in	IBA	PANTHER:PTN002749597 and UniProtKB:P51693	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Aplp1	Rat	plasma membrane	located_in	IEA	UniProtKB:P51693 and ensembl:ENSP00000221891	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Aplp1	Rat	plasma membrane	located_in	ISO	APLP1 (Homo sapiens)	1624291	PMID:16531006	RGD	PMID:16531006

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Aplp1	Rat	alpha-2A adrenergic receptor binding	enables	ISO	APLP1 (Homo sapiens)	1624291	UniProtKB:P08913 and PMID:16531006	RGD	PMID:16531006
Aplp1	Rat	alpha-2A adrenergic receptor binding	enables	IBA	PANTHER:PTN002749597 and UniProtKB:P51693	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Aplp1	Rat	alpha-2A adrenergic receptor binding	enables	IEA	UniProtKB:P51693 and ensembl:ENSP00000221891	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Aplp1	Rat	alpha-2B adrenergic receptor binding	enables	ISO	APLP1 (Homo sapiens)	1624291	UniProtKB:P18089 and PMID:16531006	RGD	PMID:16531006
Aplp1	Rat	alpha-2B adrenergic receptor binding	enables	IEA	UniProtKB:P51693 and ensembl:ENSP00000221891	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Aplp1	Rat	alpha-2B adrenergic receptor binding	enables	IBA	PANTHER:PTN002749597 and UniProtKB:P51693	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Aplp1	Rat	alpha-2C adrenergic receptor binding	enables	ISO	APLP1 (Homo sapiens)	1624291	UniProtKB:P18825 and PMID:16531006	RGD	PMID:16531006
Aplp1	Rat	alpha-2C adrenergic receptor binding	enables	IBA	PANTHER:PTN002749597 and UniProtKB:P51693	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Aplp1	Rat	alpha-2C adrenergic receptor binding	enables	IEA	UniProtKB:P51693 and ensembl:ENSP00000221891	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Aplp1	Rat	heparin binding	enables	IEA	UniRule:UR000976770	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Aplp1	Rat	heparin binding	enables	IEA	InterPro:IPR015849 and InterPro:IPR036454	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Aplp1	Rat	identical protein binding	enables	ISO	APLP1 (Homo sapiens)	1624291	UniProtKB:P51693 more ...	RGD	PMID:16193067 and PMID:21930949
Aplp1	Rat	identical protein binding	enables	IEA	UniProtKB:P51693 and ensembl:ENSP00000221891	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Aplp1	Rat	protein binding		IPI	Apbb1 (Rattus norvegicus)	634556		RGD
Aplp1	Rat	protein binding	enables	ISO	Aplp1 (Mus musculus)	1624291	PR:P70166 more ...	RGD	PMID:10460257 more ...
Aplp1	Rat	protein binding	enables	ISO	APLP1 (Homo sapiens)	1624291	UniProtKB:P05067-4 more ...	RGD	PMID:16169070 more ...
Aplp1	Rat	protein binding		IPI	Apbb3 (Rattus norvegicus)	634556		RGD
Aplp1	Rat	transition metal ion binding	enables	IEA	InterPro:IPR011178 and InterPro:IPR036669	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

#	Reference Title	Reference Citation
1.	Fe65L2: a new member of the Fe65 protein family interacting with the intracellular domain of the Alzheimer's beta-amyloid precursor protein.	Duilio A, etal., Biochem J 1998 Feb 15;330 ( Pt 1):513-9.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Comparative expressed-sequence-tag analysis of differential gene expression profiles in PC-12 cells before and after nerve growth factor treatment.	Lee NH, etal., Proc Natl Acad Sci U S A 1995 Aug 29;92(18):8303-7.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:1279693	PMID:12477932	PMID:15385965	PMID:16193067	PMID:16314516	PMID:16531006	PMID:21930949	PMID:25683482

Aplp1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	94,824,330 - 94,834,705 (-)	NCBI		GRCr8
mRatBN7.2	1	85,696,880 - 85,707,215 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	85,696,882 - 85,707,155 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	91,113,388 - 91,123,714 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	99,579,915 - 99,590,199 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	92,871,656 - 92,881,982 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	88,897,525 - 88,908,750 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	88,897,532 - 88,908,750 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	90,053,390 - 90,063,110 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	85,390,217 - 85,401,952 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	80,069,348 - 80,079,276 (-)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

APLP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	35,868,574 - 35,879,792 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	35,867,899 - 35,879,803 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	36,359,476 - 36,370,694 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	41,051,241 - 41,062,539 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	41,051,309 - 41,062,530	NCBI
Celera	19	33,073,585 - 33,084,883 (+)	NCBI		Celera
Cytogenetic Map	19	q13.12	NCBI
HuRef	19	32,864,721 - 32,875,938 (+)	NCBI		HuRef
CHM1_1	19	36,360,683 - 36,371,980 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	38,414,328 - 38,425,546 (+)	NCBI		T2T-CHM13v2.0

Aplp1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	30,134,405 - 30,144,960 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	30,134,407 - 30,144,960 (-)	Ensembl		GRCm39 Ensembl
GRCm38	7	30,434,980 - 30,445,582 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	30,434,982 - 30,445,535 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	31,220,001 - 31,230,580 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	30,143,742 - 30,154,321 (-)	NCBI		MGSCv36	mm8
Celera	7	25,026,598 - 25,037,193 (-)	NCBI		Celera
Cytogenetic Map	7	B1	NCBI
cM Map	7	18.32	NCBI

Aplp1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955468	2,694,591 - 2,703,656 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955468	2,694,286 - 2,703,658 (-)	NCBI	ChiLan1.0	ChiLan1.0

APLP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	41,867,959 - 41,879,251 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	43,852,723 - 43,864,012 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	32,786,362 - 32,797,728 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	41,534,776 - 41,545,908 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	41,534,569 - 41,545,906 (+)	Ensembl	panpan1.1		panPan2

APLP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	116,774,392 - 116,783,101 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	116,728,529 - 116,783,046 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	116,179,958 - 116,188,648 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	117,377,571 - 117,386,261 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	117,377,575 - 117,386,219 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	116,941,125 - 116,949,814 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	116,564,643 - 116,573,333 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	117,620,429 - 117,629,122 (-)	NCBI		UU_Cfam_GSD_1.0

Aplp1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	11,161,610 - 11,170,431 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936570	474,902 - 484,188 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936570	475,446 - 484,379 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

APLP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	45,285,718 - 45,295,350 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	45,285,698 - 45,295,355 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	40,669,837 - 40,672,028 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

APLP1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	30,780,112 - 30,791,582 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	30,780,085 - 30,791,636 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666073	8,572,301 - 8,583,860 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Aplp1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624794	10,148,522 - 10,167,543 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624794	10,148,575 - 10,158,101 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Aplp1
70 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	238
Count of miRNA genes:	142
Interacting mature miRNAs:	149
Transcripts:	ENSRNOT00000028297
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	49393172	94393172	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	78479925	123479925	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
2300324	Fetw1	Fetal weight QTL 1	12.1	0.005	fetal growth trait (VT:0004201)	fetal body weight (CMO:0002080)	1	85424647	100358001	Rat
2302059	Pia36	Pristane induced arthritis QTL 36	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	43333002	88333002	Rat
1300121	Hrtrt1	Heart rate QTL 1	3.7		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	65789093	115540829	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	66023617	118608521	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	72197680	90508767	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	77876254	106047988	Rat
2313083	Bmd74	Bone mineral density QTL 74	4	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	82174743	118944897	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
4889494	Scort2	Serum corticosterone level QTL 2	4.2		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	80592172	125592172	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	56732668	98773277	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	32737273	90665040	Rat
61344	Bp29	Blood pressure QTL 29	7.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	78350581	123350581	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	77494165	122494165	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	53863041	90532583	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	56949932	101949932	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
738022	Anxrr13	Anxiety related response QTL 13	4.6	0.00039	locomotor behavior trait (VT:0001392)	number of 20 x 20 cm floor squares crossed into, out of or within a discrete space in an experimental apparatus (CMO:0001514)	1	83547917	128547917	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	50343510	99980958	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	77857876	122857876	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	78430536	123430536	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat
61433	Cia2	Collagen induced arthritis QTL 2	5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	78430754	91209302	Rat

D1Bda13

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	85,697,170 - 85,697,453 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	88,897,814 - 88,898,096	NCBI	Rnor6.0
Rnor_5.0	1	90,053,673 - 90,053,955	UniSTS	Rnor5.0
RGSC_v3.4	1	85,390,508 - 85,390,790	UniSTS	RGSC3.4
Celera	1	80,069,631 - 80,069,913	UniSTS
Cytogenetic Map	1	q21	UniSTS

RH135017

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	85,697,011 - 85,697,196 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	88,897,655 - 88,897,839	NCBI	Rnor6.0
Rnor_5.0	1	90,053,514 - 90,053,698	UniSTS	Rnor5.0
RGSC_v3.4	1	85,390,349 - 85,390,533	UniSTS	RGSC3.4
Celera	1	80,069,472 - 80,069,656	UniSTS
RH 3.4 Map	1	848.9	UniSTS
Cytogenetic Map	1	q21	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001100802	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001399814	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008759179	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088308	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC161904	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ462463	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212221	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213451	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000028297 ⟹ ENSRNOP00000028297

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	85,696,882 - 85,707,155 (-)	Ensembl
Rnor_6.0 Ensembl	1	88,897,532 - 88,908,750 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000106909 ⟹ ENSRNOP00000092071

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	85,696,882 - 85,707,155 (-)	Ensembl

RefSeq Acc Id:

NM_001100802 ⟹ NP_001094272

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	94,824,330 - 94,834,610 (-)	NCBI
mRatBN7.2	1	85,696,880 - 85,707,160 (-)	NCBI
Rnor_6.0	1	88,897,531 - 88,908,750 (-)	NCBI
Celera	1	80,069,348 - 80,079,276 (-)	NCBI

Sequence:

show sequence

GGGCAGGGCCGGGCGGGAGCGCAGGGGACCTGAGGGCCCGAGGCCCGGACATGGGGCCCTCCAGCCCCACCACTCGCGGTCAGGGTCGCCGCCGGGGCCCGCCGCCGCTGCCGCTGTTGCTACCACTG
TCGCTGCTGCTTCTGCGCGCGCAGCTCGCCGTCGGGAACCTGGCTGGTGGGAGCCCCAGCGCGGCCGAGGCTCCGGGGTCGGCTCAAGTGGCTGGACTATGTGGGCGTCTCACCCTTCACCGAGACCT
GCGCACCGGCCGCTGGGAACCAGACCCACAGCGATCACGACGCTGTCTTCTGGACCCGCAGCGCGTGCTGGAGTACTGCAGACAGATGTACCCAGAGCTGCACATAGCTCGTGTGGAGCAGGCTGCAC
AGGCCATCCCGATGGAGCGCTGGTGTGGGGGTACCCGAAGTGGCAGATGTGCCCACCCCCACCATGAGGTTGTGCCCTTCCATTGCCTGCCTGGCGAATTCGTGAGTGAAGCCCTGCTGGTGCCCGAA
GGCTGTAGGTTCTTGCACCAGGAGCGAATGGACCAATGTGAGAGTTCAACCAGGAGGCACCAGGAGGCTCAAGAGGCCTGCAGCTCCCAGGGCCTCATCCTGCACGGTTCTGGTATGCTTTTGCCCTG
TGGCTCTGATCGGTTCCGAGGTGTGGAGTATGTATGCTGTCCACCTCCCGCAACTCCCAACCCATCTGGGATGGCAGTTGGTGACCCCTCTACCCGGTCCTGGCCCCTGGGGGGCAGAGCAGAGGGAG
GTGAGGATGAAGAGGAGGTGGAATCCTTCCCTCAGCCAGTAGACGATTACTTCGTAGAGCCCCCTCAGGCCGAAGAAGAAGAGGAAGAAGAGGAGGAAAGGGCCCCACCTCCCAGCTCCCACACCCCT
GTCATGGTCAGCAGAGTCACTCCCACCCCGAGACCCACTGATGGTGTGGATGTTTACTTTGGCATGCCTGGGGAGATCAGCGAGCACGAGGGTTTCCTGAGGGCCAAGATGGACCTGGAGGAACGTAG
GATGCGTCAGATTAATGAGGTGATGCGTGAGTGGGCCATGGCTGACAGCCAATCTAAGAACCTGCCAAAAGCCGACAGGCAGGCCCTGAATGAGCACTTCCAGTCCATTCTGCAGACCCTGGAAGAAC
AAGTGTCTGGTGAGCGACAGCGCCTGGTGGAGACCCACGCCACCAGAGTCATCGCTCTGATCAACGACCAGCGCCGAGCTGCCCTGGAAGGTTTCCTGGCAGCATTACAGGGCGATCCGCCTCAGGCT
GAGAGAGTTCTGATGGCCCTGAGGCGCTACCTGCGAGCGGAGCAGAAGGAGCAGAGGCACACCCTGAGGCACTACCAGCACGTGGCCGCCGTGGACCCTGAGAAGGCCCAGCAGATGCGCTTTCAGGT
CCAGACCCACCTTCAGGTGGTTCAAGAACGAATGAATCAGAGCCTGGGGCTGCTCGACCAGAACCCTCACCTGGCTCAGGAGCTGCGGCCACAGATCCAGGAGCTTCTCCATGCGGAACACTTGGGAC
CTAGTGAACTGGAAGCCTCTGTGCCCGGGAGCAGCAGTGAGGACAAAGATGCCCCAGTGACCCTTCCAAAAGGGTCCACAGATCAAGAGTCTTCCTCCTCTGGGAGAGAGAAGCTAACCCCACTGGAG
CAATATGAGCAAAAGGTGAATGCATCTGCCCCAAGGGGGTTTCCCTTCCACTCATCAGATATTCAGCGGGATGAACTGGCACCAGCTGGGACTGGAGTGTCCCGAGAGGCCTTGTCAGGTCTGCTGAT
CATGGGAGCTGGAGGAGGCTCCCTCATTGTCCTATCCTTGCTGCTTCTGCGCAAGAAGAAACCCTATGGCACTATCAGCCATGGAGTGGTGGAGGTGGACCCCATGCTGACCCTGGAGGAGCAGCAGC
TCCGGGAACTTCAGAGGCATGGCTATGAGAACCCCACCTACCGCTTCCTGGAAGAACGACCTTGACCCCAACCCTAGCTGCCTTCAGCTGAACCCTACTGCCCTTCTTCCGGTCCCCTAATCCCAACT
CCCAGCTTCCGGTGGGGGAGGGAGATCTTGACAAATTCATTCCAAATTCCACCCCCTTAGAAATTCCCAGTTCCTGCCCCACCAGGGACCTTCTCACCTTAATTTATTTTACGTTAATTTATTGCTCC
TTAAGGTGACCACCATCTGGGTCCCAGTGTATGTCACCCCCTGGAATTCACCGTCCCACGTTTCTTCACTAACATCCCAATAAAGTCCTCTTCCCCAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

NM_001399814 ⟹ NP_001386743

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	94,824,330 - 94,834,610 (-)	NCBI
mRatBN7.2	1	85,696,880 - 85,707,160 (-)	NCBI

RefSeq Acc Id:

XM_039088308 ⟹ XP_038944236

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	94,824,332 - 94,834,705 (-)	NCBI
mRatBN7.2	1	85,696,880 - 85,707,215 (-)	NCBI


Protein RefSeqs	NP_001094272	(Get FASTA)	NCBI Sequence Viewer
	NP_001386743	(Get FASTA)	NCBI Sequence Viewer
	XP_038944236	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI61904	(Get FASTA)	NCBI Sequence Viewer
	ABE73148	(Get FASTA)	NCBI Sequence Viewer
	EDM07760	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000028297
	ENSRNOP00000028297.5
	ENSRNOP00000092071
	ENSRNOP00000092071.1

RefSeq Acc Id:	NP_001094272 ⟸ NM_001100802
- Peptide Label:	isoform 2 precursor
- UniProtKB:	B1WBV6 (UniProtKB/TrEMBL), F1LRS5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGPSSPTTRGQGRRRGPPPLPLLLPLSLLLLRAQLAVGNLAGGSPSAAEAPGSAQVAGLCGRLTLHRDLRTGRWEPDPQRSRRCLLDPQRVLEYCRQMYPELHIARVEQAAQAIPMERWCGGTRSGRC AHPHHEVVPFHCLPGEFVSEALLVPEGCRFLHQERMDQCESSTRRHQEAQEACSSQGLILHGSGMLLPCGSDRFRGVEYVCCPPPATPNPSGMAVGDPSTRSWPLGGRAEGGEDEEEVESFPQPVDDY FVEPPQAEEEEEEEEERAPPPSSHTPVMVSRVTPTPRPTDGVDVYFGMPGEISEHEGFLRAKMDLEERRMRQINEVMREWAMADSQSKNLPKADRQALNEHFQSILQTLEEQVSGERQRLVETHATRV IALINDQRRAALEGFLAALQGDPPQAERVLMALRRYLRAEQKEQRHTLRHYQHVAAVDPEKAQQMRFQVQTHLQVVQERMNQSLGLLDQNPHLAQELRPQIQELLHAEHLGPSELEASVPGSSSEDKD APVTLPKGSTDQESSSSGREKLTPLEQYEQKVNASAPRGFPFHSSDIQRDELAPAGTGVSREALSGLLIMGAGGGSLIVLSLLLLRKKKPYGTISHGVVEVDPMLTLEEQQLRELQRHGYENPTYRFL EERP hide sequence

Ensembl Acc Id:

ENSRNOP00000028297 ⟸ ENSRNOT00000028297

RefSeq Acc Id:	XP_038944236 ⟸ XM_039088308
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6AD03 (UniProtKB/TrEMBL), F1LRS5 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000092071 ⟸ ENSRNOT00000106909

RefSeq Acc Id:	NP_001386743 ⟸ NM_001399814
- Peptide Label:	isoform 1 precursor
- UniProtKB:	A6J9X4 (UniProtKB/TrEMBL), F1LRS5 (UniProtKB/TrEMBL)

Protein Domains

Beta-amyloid precursor protein C-terminal E1 E2

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1LRS5-F1-model_v2	AlphaFold	F1LRS5	1-639	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13689917

Promoter ID:

EPDNEW_R440

Type:

single initiation site

Name:

Aplp1_1

Description:

amyloid beta precursor like protein 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	88,908,776 - 88,908,836	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-60110	BioCyc
Ensembl Genes	ENSRNOG00000020851	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000028297	ENTREZGENE
	ENSRNOT00000028297.6	UniProtKB/TrEMBL
	ENSRNOT00000106909	ENTREZGENE
	ENSRNOT00000106909.1	UniProtKB/TrEMBL
Gene3D-CATH	1.20.120.770	UniProtKB/TrEMBL
	3.30.1490.140	UniProtKB/TrEMBL
	3.90.570.10	UniProtKB/TrEMBL
InterPro	Amyloid_Cu-bd_sf	UniProtKB/TrEMBL
	Amyloid_glyco	UniProtKB/TrEMBL
	Amyloid_glyco_Cu-bd	UniProtKB/TrEMBL
	Amyloid_glyco_E2_domain	UniProtKB/TrEMBL
	Amyloid_glyco_extra	UniProtKB/TrEMBL
	Amyloid_glyco_extracell_CS	UniProtKB/TrEMBL
	Amyloid_glyco_heparin-bd	UniProtKB/TrEMBL
	Amyloid_glyco_heparin-bd_sf	UniProtKB/TrEMBL
	Amyloid_glyco_intracell_CS	UniProtKB/TrEMBL
	APP_amyloid	UniProtKB/TrEMBL
	E2_sf	UniProtKB/TrEMBL
KEGG Report	rno:502317	UniProtKB/TrEMBL
NCBI Gene	Aplp1	ENTREZGENE
PANTHER	AMYLOID-LIKE PROTEIN 1	UniProtKB/TrEMBL
	PTHR23103	UniProtKB/TrEMBL
Pfam	APP_amyloid	UniProtKB/TrEMBL
	APP_Cu_bd	UniProtKB/TrEMBL
	APP_E2	UniProtKB/TrEMBL
	APP_N	UniProtKB/TrEMBL
PhenoGen	Aplp1	PhenoGen
PRINTS	AMYLOIDA4	UniProtKB/TrEMBL
PROSITE	A4_EXTRA	UniProtKB/TrEMBL
	A4_INTRA	UniProtKB/TrEMBL
	APP_E1	UniProtKB/TrEMBL
	APP_E2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000020851	RatGTEx
SMART	A4_EXTRA	UniProtKB/TrEMBL
Superfamily-SCOP	A4_extra	UniProtKB/TrEMBL
	Amyloid_glyco_Cu-bd	UniProtKB/TrEMBL
	SSF109843	UniProtKB/TrEMBL
UniProt	A0A8I6AD03	ENTREZGENE, UniProtKB/TrEMBL
	A6J9X4	ENTREZGENE, UniProtKB/TrEMBL
	B1WBV6	ENTREZGENE, UniProtKB/TrEMBL
	F1LRS5	ENTREZGENE, UniProtKB/TrEMBL
	Q1P9T9_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-01-27	Aplp1	amyloid beta precursor like protein 1	Aplp1	amyloid beta (A4) precursor-like protein 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-04	Aplp1	amyloid beta (A4) precursor-like protein 1	RGD1561211	similar to Amyloid beta (A4) precursor-like protein 1	Data merged from RGD:1561211	737654	APPROVED
2008-04-30	RGD1561211	similar to Amyloid beta (A4) precursor-like protein 1	RGD1561211_predicted	similar to Amyloid beta (A4) precursor-like protein 1 (predicted)	'predicted' is removed	2292626	APPROVED
2007-04-13		amyloid beta (A4) precursor-like protein 1	Aplp1	amyloid beta (A4) precursor-like protein 1 (mapped)	Name updated	737654	APPROVED
2007-04-10	Aplp1		Aplp1_mapped	amyloid beta (A4) precursor-like protein 1 (mapped)	Symbol updated	737654	APPROVED
2006-11-19	Aplp1_mapped	amyloid beta (A4) precursor-like protein 1(mapped)	Aplp1	amyloid beta (A4) precursor-like protein 1	Symbol set to symbol_mapped, name set to name (mapped)	1582166	APPROVED
2006-11-19	Aplp1	amyloid beta (A4) precursor-like protein 1			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-03-07	RGD1561211_predicted	similar to Amyloid beta (A4) precursor-like protein 1 (predicted)	LOC502317	similar to Amyloid beta (A4) precursor-like protein 1	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC502317	similar to Amyloid beta (A4) precursor-like protein 1			Symbol and Name status set to provisional	70820	PROVISIONAL
2002-06-10	Aplp1	amyloid beta (A4) precursor-like protein 1			Name updated	70584	APPROVED

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar