Timp4 (TIMP metallopeptidase inhibitor 4)

Gene: Timp4 (TIMP metallopeptidase inhibitor 4) Rattus norvegicus

Analyze

Symbol:

Timp4

Name:

TIMP metallopeptidase inhibitor 4

RGD ID:

69077

Description:

Predicted to enable metalloendopeptidase inhibitor activity; protease binding activity; and zinc ion binding activity. Involved in several processes, including ovulation cycle; response to lipopolysaccharide; and response to peptide hormone. Located in extracellular space and sarcomere. Biomarker of abdominal aortic aneurysm; congestive heart failure; and renal hypertension. Human ortholog(s) of this gene implicated in nephroblastoma. Orthologous to human TIMP4 (TIMP metallopeptidase inhibitor 4); INTERACTS WITH (S)-nicotine; 17beta-estradiol; 2,2',5,5'-tetrachlorobiphenyl.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC680130; metalloproteinase inhibitor 4; similar to Metalloproteinase inhibitor 4 precursor (TIMP-4) (Tissue inhibitor of metalloproteinases-4); TIMP-4; Timp4_mapped; tissue inhibitor of metalloproteinase 4; tissue inhibitor of metalloproteinase 4 (mapped); tissue inhibitor of metalloproteinases 4

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	149,978,667 - 149,985,350 (-)	NCBI		GRCr8
mRatBN7.2	4	148,306,021 - 148,312,558 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	148,304,490 - 148,312,558 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	154,531,322 - 154,537,832 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	150,314,411 - 150,320,921 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	148,938,223 - 148,944,733 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	147,156,948 - 147,163,467 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	147,156,948 - 147,163,467 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	210,445,694 - 210,452,213 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	151,375,072 - 151,381,591 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	4	137,199,851 - 137,206,370 (-)	NCBI		Celera
Cytogenetic Map	4	q42	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

abdominal aortic aneurysm (IEP)

Arteriovenous Fistula (IEP)

Breast Neoplasms (ISO)

Cardiomegaly (IEP)

cervical cancer (ISO)

congestive heart failure (IEP)

COVID-19 (ISO)

ductal carcinoma in situ (ISO)

endometrial cancer (ISO)

endometrial carcinoma (ISO)

Experimental Arthritis (IMP)

genetic disease (ISO)

Lymphatic Metastasis (ISO)

Myocardial Reperfusion Injury (IEP)

nephroblastoma (ISO)

ovarian carcinoma (ISO)

prostate carcinoma in situ (ISO)

Prostatic Neoplasms (ISO)

renal cell carcinoma (ISO)

renal hypertension (IEP)

Wounds and Injuries (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-nicotine (EXP,ISO)

1,2-dimethylhydrazine (ISO)

1-O-palmitoyl-2-O-(5-oxovaleryl)-sn-glycero-3-phosphocholine (ISO)

17beta-estradiol (EXP,ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2-acetyl-1-alkyl-sn-glycero-3-phosphocholine (ISO)

3,4-methylenedioxymethamphetamine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3-Nitrobenzanthrone (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cantharidin (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chloroprene (ISO)

cisplatin (ISO)

clobetasol (ISO)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

coumarin (ISO)

Cuprizon (EXP)

dexamethasone (ISO)

dioxygen (EXP)

dorsomorphin (ISO)

elemental selenium (ISO)

endosulfan (EXP)

entinostat (ISO)

ethanol (ISO)

folic acid (ISO)

fonofos (ISO)

indometacin (ISO)

isoprenaline (ISO)

ketoconazole (EXP)

lead(0) (ISO)

lipopolysaccharide (ISO)

mercury dichloride (EXP)

methamphetamine (ISO)

monodansylcadaverine (ISO)

nickel atom (ISO)

nicotine (EXP,ISO)

oxaliplatin (EXP)

paclitaxel (ISO)

paracetamol (ISO)

parathion (ISO)

PCB138 (ISO)

pentane-2,3-dione (EXP)

ramipril (EXP)

resveratrol (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

selenium atom (ISO)

sodium arsenite (ISO)

sulforaphane (ISO)

temozolomide (ISO)

terbufos (ISO)

titanium dioxide (ISO)

topotecan (EXP)

triadimefon (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

negative regulation of membrane protein ectodomain proteolysis (IBA,IEA)

Notch signaling pathway (ISO)

ovulation cycle (IEP)

response to cytokine (IBA,IEA,IEP)

response to hormone (IBA,IEA,IEP)

response to lipopolysaccharide (IEP)

response to peptide hormone (IEP)

response to xenobiotic stimulus (IEP)

Cellular Component

extracellular matrix (IBA,IEA)

extracellular space (IBA,IDA,IEA)

sarcomere (IDA)

Molecular Function

metal ion binding (IEA)

metalloendopeptidase inhibitor activity (IBA,IEA)

protease binding (IBA,IEA)

zinc ion binding (ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Mechanism of matrix accumulation and glomerulosclerosis in spontaneously hypertensive rats.	Camp TM, etal., J Hypertens 2003 Sep;21(9):1719-27.
2.	Inhibition of adjuvant-induced arthritis by systemic tissue inhibitor of metalloproteinases 4 gene delivery.	Celiker MY, etal., Arthritis Rheum. 2002 Dec;46(12):3361-8.
3.	Inhibition of Wilms' tumor growth by intramuscular administration of tissue inhibitor of metalloproteinases-4 plasmid DNA.	Celiker MY, etal., Oncogene. 2001 Jul 19;20(32):4337-43.
4.	Remodeling of experimental arteriovenous fistula with increased matrix metalloproteinase expression in rats.	Chan CY, etal., J Vasc Surg. 2007 Apr;45(4):804-11.
5.	Erythropoietin protects post-ischemic hearts by preventing extracellular matrix degradation: role of Jak2-ERK pathway.	Chan CY, etal., Life Sci. 2007 Aug 9;81(9):717-23. Epub 2007 Jul 26.
6.	TIMP-4 is regulated by vascular injury in rats.	Dollery CM, etal., Circ Res. 1999 Mar 19;84(5):498-504.
7.	Differential spatial distribution and temporal regulation of tissue inhibitor of metalloproteinase mRNA expression during rat central nervous system development.	Fager N and Jaworski DM, Mech Dev. 2000 Nov;98(1-2):105-9.
8.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
9.	Thyroid hormone induces myocardial matrix degradation by activating matrix metalloproteinase-1.	Ghose Roy S, etal., Matrix Biol. 2007 May;26(4):269-79. Epub 2006 Dec 29.
10.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
11.	mRNA expression of matrix metalloproteases and their inhibitors differs in subtypes of renal cell carcinomas.	Hagemann T, etal., Eur J Cancer. 2001 Oct;37(15):1839-46.
12.	Zhonghua wai ke za zhi [Chinese journal of surgery]	Jiang X, etal., Zhonghua Wai Ke Za Zhi. 2000 Apr;38(4):291-3, 19.
13.	Genetic kininogen deficiency contributes to aortic aneurysm formation but not to atherosclerosis.	Kaschina E, etal., Physiol Genomics 2004 Sep 16;19(1):41-9. Epub 2004 Jul 06.
14.	Matrix metalloproteinases contribute to endotoxin and interleukin-1beta induced vascular dysfunction.	Lalu MM, etal., Br J Pharmacol. 2006 Sep;149(1):31-42. Epub 2006 Jul 31.
15.	Coordinated peak expression of MMP-26 and TIMP-4 in preinvasive human prostate tumor.	Lee S, etal., Cell Res. 2006 Sep;16(9):750-8.
16.	MMP/TIMP expression in spontaneously hypertensive heart failure rats: the effect of ACE- and MMP-inhibition.	Li H, etal., Cardiovasc Res. 2000 May;46(2):298-306.
17.	Proinflammatory cytokines regulate tissue inhibitors of metalloproteinases and disintegrin metalloproteinase in cardiac cells.	Li YY, etal., Cardiovasc Res. 1999 Apr;42(1):162-72.
18.	Tissue inhibitor of metalloproteinases-4 is expressed in cervical cancer patients.	Lizarraga F, etal., Anticancer Res. 2005 Jan-Feb;25(1B):623-7.
19.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
20.	Temporal regulation of extracellular matrix components in transition from compensatory hypertrophy to decompensatory heart failure.	Mujumdar VS and Tyagi SC, J Hypertens. 1999 Feb;17(2):261-70.
21.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
22.	Endometrial TIMP-4 mRNA is high at midcycle and in hyperplasia, but down-regulated in malignant tumours. Coordinated expression with MMP-26.	Pilka R, etal., Mol Hum Reprod. 2004 Sep;10(9):641-50. Epub 2004 Jul 23.
23.	GOA pipeline	RGD automated data pipeline
24.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
25.	Comprehensive gene review and curation	RGD comprehensive gene curation
26.	Expression of matrix metalloproteinase-26 and tissue inhibitors of metalloproteinase-3 and -4 in normal ovary and ovarian carcinoma.	Ripley D, etal., Int J Gynecol Cancer. 2006 Sep-Oct;16(5):1794-800.
27.	Imbalance between tissue inhibitor of metalloproteinase-4 and matrix metalloproteinases during acute myocardial ischemia-reperfusion injury.	Schulze CJ, etal., Circulation. 2003 May 20;107(19):2487-92. Epub 2003 Apr 21.
28.	Effect of ramipril and furosemide treatment on interstitial remodeling in post-infarction heart failure rat hearts.	Seeland U, etal., J Mol Cell Cardiol. 2002 Feb;34(2):151-63.
29.	Localization and expression of tissue inhibitor of metalloproteinase-4 in the immature gonadotropin-stimulated and adult rat ovary.	Simpson KS, etal., Biol Reprod 2003 Jan;68(1):214-21.
30.	Localization of 54 rat genes, and definition of new synteny groups conserved in the human and the rat.	Szpirer C, etal., Mamm Genome 2000 Sep;11(9):729-35
31.	Expression of matrix metalloproteinase-26 and tissue inhibitors of metalloproteinases TIMP-3 and -4 in benign endometrium and endometrial cancer.	Tunuguntla R, etal., Gynecol Oncol. 2003 Jun;89(3):453-9.
32.	Inhibition of tumor growth and metastasis of human breast cancer cells transfected with tissue inhibitor of metalloproteinase 4.	Wang M, etal., Oncogene. 1997 Jun 12;14(23):2767-74.
33.	Endometase/matrilysin-2 in human breast ductal carcinoma in situ and its inhibition by tissue inhibitors of metalloproteinases-2 and -4: a putative role in the initiation of breast cancer invasion.	Zhao YG, etal., Cancer Res. 2004 Jan 15;64(2):590-8.

Additional References at PubMed

PMID:9503367	PMID:15057822	PMID:23117660	PMID:23427085	PMID:24126801	PMID:25028660	PMID:38069250

Genomics

Comparative Map Data

Timp4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	149,978,667 - 149,985,350 (-)	NCBI		GRCr8
mRatBN7.2	4	148,306,021 - 148,312,558 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	148,304,490 - 148,312,558 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	154,531,322 - 154,537,832 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	150,314,411 - 150,320,921 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	148,938,223 - 148,944,733 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	147,156,948 - 147,163,467 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	147,156,948 - 147,163,467 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	210,445,694 - 210,452,213 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	151,375,072 - 151,381,591 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	4	137,199,851 - 137,206,370 (-)	NCBI		Celera
Cytogenetic Map	4	q42	NCBI

TIMP4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	12,153,068 - 12,158,912 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	12,153,068 - 12,158,912 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	12,194,568 - 12,200,412 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	12,169,568 - 12,175,647 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	3	12,169,569 - 12,175,647	NCBI
Celera	3	12,132,043 - 12,138,067 (-)	NCBI		Celera
Cytogenetic Map	3	p25.2	NCBI
HuRef	3	12,128,374 - 12,134,601 (-)	NCBI		HuRef
CHM1_1	3	12,144,898 - 12,151,125 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	12,151,357 - 12,157,146 (-)	NCBI		T2T-CHM13v2.0

Timp4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	115,221,405 - 115,229,166 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	115,218,853 - 115,229,166 (-)	Ensembl		GRCm39 Ensembl
GRCm38	6	115,244,444 - 115,252,205 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	115,241,892 - 115,252,205 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	115,195,634 - 115,201,867 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	115,211,438 - 115,217,467 (-)	NCBI		MGSCv36	mm8
Celera	6	117,084,697 - 117,090,930 (-)	NCBI		Celera
Cytogenetic Map	6	E3	NCBI
cM Map	6	53.29	NCBI

Timp4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955429	14,685,031 - 14,693,211 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955429	14,689,016 - 14,693,211 (-)	NCBI	ChiLan1.0	ChiLan1.0

TIMP4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	12,141,127 - 12,149,262 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	12,144,168 - 12,154,025 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	12,079,195 - 12,087,485 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	12,425,429 - 12,433,192 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	12,425,429 - 12,433,192 (-)	Ensembl	panpan1.1		panPan2

TIMP4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	6,399,522 - 6,405,089 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	6,399,522 - 6,405,089 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	6,435,643 - 6,441,210 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	6,428,241 - 6,462,722 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	6,428,701 - 6,439,507 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	6,146,856 - 6,152,424 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	6,497,799 - 6,503,367 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	6,473,392 - 6,478,960 (+)	NCBI		UU_Cfam_GSD_1.0

Timp4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404942	17,413,957 - 17,420,254 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936602	1,489,545 - 1,495,478 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936602	1,488,993 - 1,496,108 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TIMP4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	68,179,806 - 68,190,942 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	68,179,803 - 68,191,199 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	75,371,793 - 75,377,933 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TIMP4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	48,134,133 - 48,140,870 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	22	48,134,637 - 48,140,600 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	118,360,254 - 118,370,994 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Timp4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624956	330,327 - 337,299 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624956	331,275 - 341,561 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Timp4
18 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	334
Count of miRNA genes:	192
Interacting mature miRNAs:	228
Transcripts:	ENSRNOT00000010748
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	44463720	155883716	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	56647873	149491524	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	59948935	154902892	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	64528739	157573521	Rat
70177	Xhs1	X-ray hypersensitivity QTL 1	25.1		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	82798864	152731274	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	83428419	177635233	Rat
12798523	Anxrr56	Anxiety related response QTL 56	2.83	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	85253748	150276390	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	85379421	167139601	Rat
634335	Anxrr16	Anxiety related response QTL 16	7.22		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	93308457	167139447	Rat
2302049	Pia32	Pristane induced arthritis QTL 32	5.1	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112)	4	105789505	150789505	Rat
731165	Uae21	Urinary albumin excretion QTL 21	2.4	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	4	106649412	151649412	Rat
61406	Scwia1	Streptococcal cell wall induced arthritis QTL 1	2.3		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	4	106805662	151805662	Rat
7207480	Bss105	Bone structure and strength QTL 105	8.1		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	4	109827074	154827074	Rat
1549832	Bss3	Bone structure and strength QTL 3	11		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	4	109827074	154827074	Rat
737821	Hcar9	Hepatocarcinoma resistance QTL 9	3.7		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	109866907	167139601	Rat
1331759	Hrtrt13	Heart rate QTL 13	3.54628		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	110275411	168266883	Rat
6478760	Anxrr45	Anxiety related response QTL 45		0.06717	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	110870972	155870972	Rat
6478763	Anxrr46	Anxiety related response QTL 46		0.07428	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	110870972	155870972	Rat
12798519	Anxrr54	Anxiety related response QTL 54	2.54	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	114627026	159627026	Rat
1300116	Hrtrt5	Heart rate QTL 5	3.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	116179486	151161268	Rat
724535	Cm18	Cardiac mass QTL 18	2.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	4	118856416	163856416	Rat
1331802	Srn5	Serum renin concentration QTL 5	3.045		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	4	119428175	157578333	Rat
634347	Hcar8	Hepatocarcinoma resistance QTL 8	5.8		liver integrity trait (VT:0010547)	liver tumorous lesion area to total liver area ratio (CMO:0001075)	4	123143783	168143783	Rat
631683	Bp116	Blood pressure QTL 116		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	124303370	169303370	Rat
6478778	Anxrr51	Anxiety related response QTL 51		0.25384	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	124778595	169778595	Rat
7411558	Bw133	Body weight QTL 133	13.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	125590636	170590636	Rat
61451	Ciaa4	CIA Autoantibody QTL 4	3.1		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	4	126395976	167139601	Rat
737978	Pia23	Pristane induced arthritis QTL 23	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	131730738	167139601	Rat
631511	Pia7	Pristane induced arthritis QTL 7	4.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	131730738	167139601	Rat
1549827	Scl46	Serum cholesterol level QTL 46	3.5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	4	132396220	177396220	Rat
724558	Plsm2	Polydactyly-luxate syndrome (PLS) morphotypes QTL 2		0.0003	hindlimb integrity trait (VT:0010563)	hind foot phalanges count (CMO:0001949)	4	132422778	177422778	Rat
61422	Cia13	Collagen induced arthritis QTL 13	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	132642577	167139601	Rat
2303623	Vencon2	Ventilatory control QTL 2	3.8		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	4	135204660	180204660	Rat
1578674	Bmd12	Bone mineral density QTL 12	3.8		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	4	135699135	180699135	Rat
2293659	Bmd35	Bone mineral density QTL 35	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	4	137755016	181392681	Rat
61362	Oia2	Oil induced arthritis QTL 2		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	138503169	173369699	Rat
1298524	Oia8	Oil induced arthritis QTL 8			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	138503169	173369699	Rat
1331738	Bp209	Blood pressure QTL 209	2.979		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	138503169	179293946	Rat
6478718	Anxrr34	Anxiety related response QTL 34		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
6478748	Anxrr42	Anxiety related response QTL 42		0.28008	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
6478754	Anxrr43	Anxiety related response QTL 43		0.14035	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	144639524	182687754	Rat
6478693	Anxrr32	Anxiety related response QTL 32		0.00092	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	144639524	182687754	Rat
6478700	Anxrr33	Anxiety related response QTL 33		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
10401796	Kidm48	Kidney mass QTL 48			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	145568712	182687754	Rat
634342	Cia24	Collagen induced arthritis QTL 24	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	146565735	175236377	Rat
12798525	Anxrr57	Anxiety related response QTL 57	3.21	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	147278504	167139601	Rat
1582237	Kidm34	Kidney mass QTL 34	4	0.0001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	4	148090542	168069246	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium		14	5		2		1	3	30		2		1
Low	3	29	22	11	6	11	7	8	30	35	39	11	7
Below cutoff			28	28	11	28			12

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001109393	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039108336	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063286672	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC128901	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473964	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213131	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214060	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000010748 ⟹ ENSRNOP00000010748

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	148,304,490 - 148,312,558 (-)	Ensembl
Rnor_6.0 Ensembl	4	147,156,948 - 147,163,467 (-)	Ensembl

RefSeq Acc Id:

NM_001109393 ⟹ NP_001102863

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	149,978,685 - 149,985,204 (-)	NCBI
mRatBN7.2	4	148,306,039 - 148,312,558 (-)	NCBI
Rnor_6.0	4	147,156,948 - 147,163,467 (-)	NCBI
Rnor_5.0	4	210,445,694 - 210,452,213 (-)	NCBI
RGSC_v3.4	4	151,375,072 - 151,381,591 (-)	RGD
Celera	4	137,199,851 - 137,206,370 (-)	RGD

Sequence:

show sequence

TTGCTCTTGCTCTTAATGCTGGAGCCCCAAACCCTCATCTTTCTGCCTTTTCTAGTCTCTTCAC
TGGTTTTTGCTTTTCTCTCTCTGCCCCTAGCGCCCAGTCTTCCTCTACTTCTAGGCTCTTTTCG
GAAATCTGCATGTTTCCCTCTGCGTTGACTGGGTCTTGTTGGTCTGGTCAGGAGGGCCTCAGGT
CCTGCGGCTGTGGGTGGCCGGGCGCCAAAGGAGGGAGGAGCCCATGGGGGCGGGATTGGCCCTA
AAGCCACCTCATAAAGACTGGGACTGACAAGCTTTCTGGAGGAGTCCTGGAGGGGCTGTTTGTT
TCGACAGGCAGACCCCACGAGCTCAGCTGGGGCTCTGCAGTGTCATGCCCTGGAGTCCCCTGGC
TGCGCTGAGCTGGGCGCTGGTGCTGAGGCTGCTGGCTTTGCTGTGGCCCCCTGGACGGGGTGAG
GCGTGCAGCTGCGCGCCTGCGCACCCCCAGCAGCACGTCTGCCACTCTGCTTTAGTAATACGGG
CCAAAATATCCAGTGAGAAGGTAGTCCCTGCCAGTGAAGACCCCGCTGACACTCAAAAAATGAT
CCGGTATGAAATCAAACAGATAAAGATGTTTAAAGGGTTCGAGAAGGCCAAGGATATTCAGTAT
GTCTACACGCCATTTGACTCTTCTCTCTGTGGTGTGAAACTAGAAACCAACAGTCAGAAGCAGT
ATCTGTTGACTGGCCAGATTCTCAGTGATGGAAAAGTCTTCATCCATCTGTGCAACTACATTGA
GCCCTGGGAGGACCTGTCCTTGGTGCAGAGGGAGAGCCTGAATCATCACTACCACCAGAACTGT
GGCTGCCAAATCACCACTTGCTATGCAGTGCCGTGTACCATCTCAGCCCCCGATGAGTGTCTCT
GGACAGACTGGCTGCTGGAACGGAAGCTCTATGGGTACCAGGCCCAGCACTATGTCTGCATGAA
GCATGTTGATGGCATCTGCAGCTGGTACCGAGGACACCTACACCTCCGGAAGGAGTACGTTGAC
ATCGTCCAGCCCTAGAAGGGACCGGCAACCATATCCTTGGAAGAGTTCTGAAGACCAAGCCAGT
TCTCTGTGGTACTCTGATCACCACCACTTGCCATGTTGCTGCCAGATAATGAGAAGTGACAAGT
GGATGGCCTGGCCAGTAAATTGGAGGCTGTGGGGCATGTGGCAGCCTGGGTCTGCTGTTCACAT
CTCCAGCTCACAACCTGTCAAGGGTTGGGAAGGAAGTATCTTATCTGCCTTGCCCTCAGCCCCT
CTCCCCTGTCTCCCAAACCTTGTTAGTCTAGCTTATACCCATTACTCAGTTTTTATTCTGGCTT
TGTTTAACTGGCTTTTCTTAACTCGTAAGGGAGAAGCTGTGACTGTCATAAAATGGTACAGCCT
TGCGATGTGCGCTATGGAAGGTGGGCTGACTATATCCTGAGTGGGCTGGTTGGCTGAAAGGAAA
AGATTGCCTAAAGCTCCATTATCTCCTACTCCCACTGTCTCAACTTAGCCTAATCCTCTGACAC
ACTTTTATCTGCTTGAAGGACGCAGTGGGAGCTGAACAGCACACTCTTCCTTGGTGTCCTGCAA
GTCTTCTGATACTTGTCCTGGCAGAAGGTCTGGCCCAGTTGGCATACATCTTTGGAAAAGAAAA
CTTACATACTAGAACACGCATTTTCCCCTCCAGGTTA

hide sequence

RefSeq Acc Id:

XM_039108336 ⟹ XP_038964264

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	149,978,667 - 149,985,350 (-)	NCBI
mRatBN7.2	4	148,306,021 - 148,312,308 (-)	NCBI

RefSeq Acc Id:

XM_063286672 ⟹ XP_063142742

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	149,978,667 - 149,983,524 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001102863	(Get FASTA)	NCBI Sequence Viewer
	XP_038964264	(Get FASTA)	NCBI Sequence Viewer
	XP_063142742	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM02160	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000010748
	ENSRNOP00000010748.3
GenBank Protein	P81556	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001102863 ⟸ NM_001109393
- Peptide Label:	precursor
- UniProtKB:	P81556 (UniProtKB/Swiss-Prot), A6IKY2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MPWSPLAALSWALVLRLLALLWPPGRGEACSCAPAHPQQHVCHSALVIRAKISSEKVVPASEDP ADTQKMIRYEIKQIKMFKGFEKAKDIQYVYTPFDSSLCGVKLETNSQKQYLLTGQILSDGKVFI HLCNYIEPWEDLSLVQRESLNHHYHQNCGCQITTCYAVPCTISAPDECLWTDWLLERKLYGYQA QHYVCMKHVDGICSWYRGHLHLRKEYVDIVQP hide sequence

RefSeq Acc Id:

ENSRNOP00000010748 ⟸ ENSRNOT00000010748

RefSeq Acc Id:	XP_038964264 ⟸ XM_039108336
- Peptide Label:	isoform X1
- UniProtKB:	A0A8L2Q5Q1 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063142742 ⟸ XM_063286672
- Peptide Label:	isoform X2

Protein Domains

NTR

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P81556-F1-model_v2	AlphaFold	P81556	1-224	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:69077	AgrOrtholog
BioCyc Gene	G2FUF-43325	BioCyc
Ensembl Genes	ENSRNOG00000007955	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000010748.4	UniProtKB/TrEMBL
Gene3D-CATH	2.40.50.120	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	3.90.370.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Netrin_domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TIMP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TIMP-like_OB-fold	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TIMP_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TIMP_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:680130	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	Timp4	ENTREZGENE
PANTHER	PTHR11844	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11844:SF26	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	TIMP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Timp4	PhenoGen
PROSITE	NTR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TIMP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000007955	RatGTEx
SMART	NTR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF50242	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8L2Q5Q1	ENTREZGENE, UniProtKB/TrEMBL
	A6IKY2	ENTREZGENE, UniProtKB/TrEMBL
	P81556	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-04-05	Timp4	TIMP metallopeptidase inhibitor 4	Timp4	tissue inhibitor of metalloproteinase 4	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-25	Timp4	tissue inhibitor of metalloproteinase 4	Timp4_mapped	tissue inhibitor of metalloproteinase 4 (mapped)	Symbol and Name updated	1299863	APPROVED
2008-04-25	Timp4_mapped	tissue inhibitor of metalloproteinase 4 (mapped)	LOC680130	similar to Metalloproteinase inhibitor 4 precursor (TIMP-4) (Tissue inhibitor of metalloproteinases-4)	Data merged from RGD:1595493	737654	APPROVED
2008-01-09	LOC680130	similar to Metalloproteinase inhibitor 4 precursor (TIMP-4) (Tissue inhibitor of metalloproteinases-4)	LOC678834	similar to Metalloproteinase inhibitor 4 precursor (TIMP-4) (Tissue inhibitor of metalloproteinases-4)	Data merged from RGD:1595583	1643240	APPROVED
2006-11-20	LOC680130	similar to Metalloproteinase inhibitor 4 precursor (TIMP-4) (Tissue inhibitor of metalloproteinases-4)			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-20	LOC678834	similar to Metalloproteinase inhibitor 4 precursor (TIMP-4) (Tissue inhibitor of metalloproteinases-4)			Symbol and Name status set to provisional	70820	PROVISIONAL
2005-11-17	Timp4_mapped	tissue inhibitor of metalloproteinase 4 (mapped)	Timp4	tissue inhibitor of metalloproteinase 4	Symbol and Name updated	1556543	APPROVED
2004-09-10	Timp4	tissue inhibitor of metalloproteinase 4		tissue inhibitor of metalloproteinase 4	Name updated	1299863	APPROVED
2002-06-10	Timp4	tissue inhibitor of metalloproteinase 4			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_disease	may have a role in hypertensive remodeling of the cortex and medulla in the SHR rat	1302333

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD