Symbol:
Selenos
Name:
selenoprotein S
RGD ID:
628897
Description:
Predicted to enable ATPase binding activity; antioxidant activity; and ubiquitin-specific protease binding activity. Predicted to be involved in several processes, including intracellular signal transduction; negative regulation of apoptotic process; and negative regulation of cytokine production. Predicted to be located in cytoplasmic microtubule and endoplasmic reticulum membrane. Predicted to be part of endoplasmic reticulum membrane; low-density lipoprotein particle; and very-low-density lipoprotein particle. Orthologous to human SELENOS (selenoprotein S); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; acrylamide; ammonium chloride.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
Ratsg2; Sels; sg2; Tanis; VCP-interacting membrane protein; VCP-interacting membrane selenoprotein; Vimp
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SELENOS (selenoprotein S) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Selenos (selenoprotein S) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Selenos (selenoprotein S) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SELENOS (selenoprotein S) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SELENOS (selenoprotein S) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Selenos (selenoprotein S) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SELENOS (selenoprotein S) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SELENOS (selenoprotein S) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Selenos (selenoprotein S) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
ALDH3A2 (aldehyde dehydrogenase 3 family member A2) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Selenos (selenoprotein S)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
SELENOS (selenoprotein S)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
selenos
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
selenos
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 129,070,240 - 129,080,007 (+) NCBI GRCr8 mRatBN7.2 1 119,659,779 - 119,669,546 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 119,659,751 - 119,669,833 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 127,652,801 - 127,662,498 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 134,824,245 - 134,833,942 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 127,633,662 - 127,643,427 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 126,979,579 - 126,989,344 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 126,979,575 - 126,989,344 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 128,065,929 - 128,075,694 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 120,509,100 - 120,518,867 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 120,587,444 - 120,597,210 (+) NCBI Celera 1 111,871,435 - 111,881,202 (+) NCBI Celera Cytogenetic Map 1 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Selenos Rat 1,2-dimethylhydrazine multiple interactions ISO Selenos (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of SELENOS mRNA CTD PMID:22206623 Selenos Rat 1,2-dimethylhydrazine decreases expression ISO Selenos (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of SELENOS mRNA CTD PMID:22206623 Selenos Rat 17alpha-ethynylestradiol increases expression ISO Selenos (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of SELENOS mRNA CTD PMID:17942748 Selenos Rat 17alpha-ethynylestradiol multiple interactions ISO Selenos (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SELENOS mRNA CTD PMID:17942748 Selenos Rat 17alpha-ethynylestradiol affects expression ISO Selenos (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of SELENOS mRNA CTD PMID:17555576 Selenos Rat 17beta-estradiol increases expression ISO Selenos (Mus musculus) 6480464 Estradiol results in increased expression of SELENOS mRNA CTD PMID:39298647 Selenos Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO SELENOS (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of SELS mRNA CTD PMID:29581250 Selenos Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Selenos (Mus musculus) 6480464 [decitabine co-treated with Tetrachlorodibenzodioxin] results in decreased expression of SELENOS mRNA and [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SELENOS mRNA CTD PMID:15251184 and PMID:17942748 Selenos Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Selenos (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SELENOS mRNA CTD PMID:21570461 Selenos Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of SELENOS mRNA CTD PMID:21215274 and PMID:34747641 Selenos Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Selenos (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of SELENOS mRNA CTD PMID:15251184 Selenos Rat 2-palmitoylglycerol increases expression ISO SELENOS (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of SELENOS mRNA CTD PMID:37199045 Selenos Rat 4,4'-sulfonyldiphenol increases expression ISO Selenos (Mus musculus) 6480464 bisphenol S results in increased expression of SELENOS mRNA CTD PMID:39298647 Selenos Rat 5-aza-2'-deoxycytidine decreases expression ISO Selenos (Mus musculus) 6480464 Decitabine results in decreased expression of SELENOS mRNA CTD PMID:15251184 Selenos Rat 5-aza-2'-deoxycytidine multiple interactions ISO Selenos (Mus musculus) 6480464 [Decitabine co-treated with Tetrachlorodibenzodioxin] results in decreased expression of SELENOS mRNA CTD PMID:15251184 Selenos Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of SELENOS mRNA CTD PMID:28959563 Selenos Rat aldehydo-D-glucose affects expression ISO Selenos (Mus musculus) 6480464 Glucose affects the expression of SELENOS mRNA CTD PMID:18498015 Selenos Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of SELENOS mRNA CTD PMID:16483693 Selenos Rat arsane multiple interactions ISO SELENOS (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SELENOS mRNA CTD PMID:39836092 Selenos Rat arsenic acid decreases expression ISO Selenos (Mus musculus) 6480464 arsenic acid results in decreased expression of SELENOS mRNA CTD PMID:19429247 Selenos Rat arsenic atom multiple interactions ISO SELENOS (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SELENOS mRNA CTD PMID:39836092 Selenos Rat arsenite(3-) decreases expression ISO Selenos (Mus musculus) 6480464 arsenite results in decreased expression of SELENOS mRNA and arsenite results in decreased expression of SELENOS protein CTD PMID:19429247 and PMID:37955338 Selenos Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of SELENOS gene CTD PMID:28931070 Selenos Rat benzo[a]pyrene decreases expression ISO Selenos (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of SELENOS mRNA CTD PMID:25908611 Selenos Rat beta-lapachone increases expression ISO SELENOS (Homo sapiens) 6480464 beta-lapachone results in increased expression of SELENOS mRNA CTD PMID:38218311 Selenos Rat bis(2-ethylhexyl) phthalate increases expression ISO Selenos (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of SELENOS mRNA CTD PMID:33754040 Selenos Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SELS mRNA CTD PMID:25181051 Selenos Rat bisphenol A decreases methylation ISO SELENOS (Homo sapiens) 6480464 bisphenol A results in decreased methylation of SELENOS gene CTD PMID:31601247 Selenos Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SELENOS mRNA CTD PMID:32145629 and PMID:34947998 Selenos Rat bisphenol A decreases expression ISO SELENOS (Homo sapiens) 6480464 bisphenol A results in decreased expression of SELENOS mRNA CTD PMID:29275510 Selenos Rat bisphenol A affects expression ISO SELENOS (Homo sapiens) 6480464 bisphenol A affects the expression of SELENOS mRNA CTD PMID:30903817 Selenos Rat cadmium dichloride increases expression ISO SELENOS (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of SELENOS mRNA CTD PMID:38568856 Selenos Rat carbon nanotube increases expression ISO Selenos (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of SELENOS mRNA CTD PMID:25620056 Selenos Rat CGP 52608 multiple interactions ISO SELENOS (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to SELS gene] CTD PMID:28238834 Selenos Rat chrysene decreases expression ISO Selenos (Mus musculus) 6480464 chrysene results in decreased expression of SELENOS mRNA CTD PMID:26377693 Selenos Rat cisplatin increases expression ISO SELENOS (Homo sapiens) 6480464 Cisplatin results in increased expression of SELENOS mRNA CTD PMID:19561079 and PMID:27594783 Selenos Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of SELENOS mRNA CTD PMID:20187946 Selenos Rat copper(II) sulfate decreases expression ISO SELENOS (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of SELENOS mRNA CTD PMID:19549813 Selenos Rat coumarin increases phosphorylation ISO SELENOS (Homo sapiens) 6480464 coumarin results in increased phosphorylation of SELENOS protein CTD PMID:35688186 Selenos Rat cyclosporin A increases expression ISO Selenos (Mus musculus) 6480464 Cyclosporine results in increased expression of SELENOS mRNA CTD PMID:25270620 Selenos Rat cyclosporin A increases expression ISO SELENOS (Homo sapiens) 6480464 Cyclosporine results in increased expression of SELENOS mRNA CTD PMID:20106945 more ... Selenos Rat cyproconazole increases expression ISO Selenos (Mus musculus) 6480464 cyproconazole results in increased expression of SELENOS mRNA CTD PMID:22334560 Selenos Rat D-glucose affects expression ISO Selenos (Mus musculus) 6480464 Glucose affects the expression of SELENOS mRNA CTD PMID:18498015 Selenos Rat dibenzo[a,l]pyrene decreases expression ISO Selenos (Mus musculus) 6480464 dibenzo(a and l)pyrene results in decreased expression of SELENOS mRNA CTD PMID:25908611 Selenos Rat dicrotophos decreases expression ISO SELENOS (Homo sapiens) 6480464 dicrotophos results in decreased expression of SELENOS mRNA CTD PMID:28302478 Selenos Rat dioxygen affects expression ISO Selenos (Mus musculus) 6480464 Oxygen affects the expression of SELENOS mRNA CTD PMID:18498015 Selenos Rat diuron decreases expression ISO SELENOS (Homo sapiens) 6480464 Diuron results in decreased expression of SELENOS mRNA CTD PMID:35967413 Selenos Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of SELENOS mRNA CTD PMID:29391264 and PMID:31464424 Selenos Rat epoxiconazole increases expression ISO Selenos (Mus musculus) 6480464 epoxiconazole results in increased expression of SELENOS mRNA CTD PMID:22334560 and PMID:35436446 Selenos Rat ethanol affects splicing ISO Selenos (Mus musculus) 6480464 Ethanol affects the splicing of SELENOS mRNA CTD PMID:30319688 Selenos Rat fenpyroximate increases expression ISO SELENOS (Homo sapiens) 6480464 fenpyroximate results in increased expression of SELENOS mRNA CTD PMID:33512557 Selenos Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of SELENOS mRNA CTD PMID:24136188 Selenos Rat folic acid multiple interactions ISO Selenos (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of SELENOS mRNA CTD PMID:22206623 Selenos Rat FR900359 decreases phosphorylation ISO SELENOS (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of SELENOS protein CTD PMID:37730182 Selenos Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of SELENOS mRNA CTD PMID:24136188 Selenos Rat glucose affects expression ISO Selenos (Mus musculus) 6480464 Glucose affects the expression of SELENOS mRNA CTD PMID:18498015 Selenos Rat isobutanol multiple interactions ISO SELENOS (Homo sapiens) 6480464 [[Gasoline co-treated with isobutyl alcohol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of SELS mRNA CTD PMID:29432896 Selenos Rat lycopene increases expression EXP 6480464 Lycopene results in increased expression of SELENOS mRNA CTD PMID:38444079 Selenos Rat manganese atom multiple interactions ISO SELENOS (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SELENOS mRNA CTD PMID:39836092 Selenos Rat manganese(0) multiple interactions ISO SELENOS (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SELENOS mRNA CTD PMID:39836092 Selenos Rat manganese(II) chloride multiple interactions ISO SELENOS (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SELENOS mRNA CTD PMID:39836092 Selenos Rat menadione affects expression ISO SELENOS (Homo sapiens) 6480464 Vitamin K 3 affects the expression of SELENOS mRNA CTD PMID:20044591 Selenos Rat methidathion increases expression ISO Selenos (Mus musculus) 6480464 methidathion results in increased expression of SELENOS mRNA CTD PMID:34813904 Selenos Rat methylmercury chloride increases expression ISO SELENOS (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of SELENOS mRNA CTD PMID:29581082 Selenos Rat N-methyl-4-phenylpyridinium affects expression ISO SELENOS (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium affects the expression of SELENOS mRNA CTD PMID:25234470 Selenos Rat ozone increases expression ISO SELENOS (Homo sapiens) 6480464 Ozone results in increased expression of SELENOS mRNA CTD PMID:27206323 Selenos Rat paracetamol affects expression ISO Selenos (Mus musculus) 6480464 Acetaminophen affects the expression of SELENOS mRNA CTD PMID:17562736 Selenos Rat paracetamol increases expression ISO SELENOS (Homo sapiens) 6480464 Acetaminophen results in increased expression of SELENOS mRNA CTD PMID:29067470 Selenos Rat paraquat decreases expression ISO Selenos (Mus musculus) 6480464 Paraquat results in decreased expression of SELENOS mRNA CTD PMID:21371552 Selenos Rat parathion increases expression ISO Selenos (Mus musculus) 6480464 Parathion results in increased expression of SELENOS mRNA CTD PMID:34813904 Selenos Rat phorbol 13-acetate 12-myristate multiple interactions ISO Selenos (Mus musculus) 6480464 SELENOS affects the reaction [Tetradecanoylphorbol Acetate results in increased secretion of IL6 protein] and SELENOS affects the reaction [Tetradecanoylphorbol Acetate results in increased secretion of TNF protein] CTD PMID:16227999 Selenos Rat picoxystrobin increases expression ISO SELENOS (Homo sapiens) 6480464 picoxystrobin results in increased expression of SELENOS mRNA CTD PMID:33512557 Selenos Rat pinostrobin increases expression ISO SELENOS (Homo sapiens) 6480464 pinostrobin results in increased expression of SELENOS mRNA CTD PMID:37777166 Selenos Rat pirinixic acid multiple interactions ISO Selenos (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of SELENOS mRNA CTD PMID:19710929 Selenos Rat propiconazole increases expression ISO Selenos (Mus musculus) 6480464 propiconazole results in increased expression of SELENOS mRNA CTD PMID:22334560 Selenos Rat quercetin increases expression ISO SELENOS (Homo sapiens) 6480464 Quercetin results in increased expression of SELENOS mRNA CTD PMID:22996356 Selenos Rat rotenone increases expression ISO SELENOS (Homo sapiens) 6480464 Rotenone results in increased expression of SELENOS mRNA CTD PMID:33512557 Selenos Rat sertraline increases expression ISO SELENOS (Homo sapiens) 6480464 Sertraline results in increased expression of SELS mRNA CTD PMID:24865413 Selenos Rat sodium arsenite decreases expression ISO SELENOS (Homo sapiens) 6480464 sodium arsenite results in decreased expression of SELENOS mRNA CTD PMID:28595984 and PMID:34032870 Selenos Rat sodium arsenite multiple interactions ISO SELENOS (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SELENOS mRNA CTD PMID:39836092 Selenos Rat sodium arsenite increases expression ISO SELENOS (Homo sapiens) 6480464 sodium arsenite results in increased expression of SELENOS mRNA CTD PMID:38568856 Selenos Rat sunitinib increases expression ISO SELENOS (Homo sapiens) 6480464 Sunitinib results in increased expression of SELENOS mRNA CTD PMID:31533062 Selenos Rat T-2 toxin increases expression ISO SELENOS (Homo sapiens) 6480464 T-2 Toxin results in increased expression of SELS mRNA CTD PMID:34581912 Selenos Rat tacrolimus hydrate increases expression ISO Selenos (Mus musculus) 6480464 Tacrolimus results in increased expression of SELENOS mRNA CTD PMID:25270620 Selenos Rat tamoxifen affects expression ISO Selenos (Mus musculus) 6480464 Tamoxifen affects the expression of SELENOS mRNA CTD PMID:17555576 Selenos Rat testosterone decreases expression ISO Selenos (Mus musculus) 6480464 Testosterone deficiency results in decreased expression of SELENOS mRNA CTD PMID:33848595 Selenos Rat tetrachloromethane increases expression ISO Selenos (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of SELENOS mRNA CTD PMID:27339419 and PMID:31919559 Selenos Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of SELENOS mRNA CTD PMID:31150632 Selenos Rat thalidomide decreases expression ISO Selenos (Mus musculus) 6480464 Thalidomide results in decreased expression of SELENOS mRNA CTD PMID:26006729 Selenos Rat thapsigargin increases expression ISO SELENOS (Homo sapiens) 6480464 Thapsigargin results in increased expression of SELENOS mRNA and Thapsigargin results in increased expression of SELS mRNA CTD PMID:22378314 and PMID:29453283 Selenos Rat thiram increases expression ISO SELENOS (Homo sapiens) 6480464 Thiram results in increased expression of SELENOS mRNA CTD PMID:38568856 Selenos Rat titanium dioxide decreases methylation ISO Selenos (Mus musculus) 6480464 titanium dioxide results in decreased methylation of SELENOS promoter CTD PMID:35295148 Selenos Rat trichostatin A affects expression ISO SELENOS (Homo sapiens) 6480464 trichostatin A affects the expression of SELENOS mRNA CTD PMID:28542535 Selenos Rat tunicamycin increases expression ISO SELENOS (Homo sapiens) 6480464 Tunicamycin results in increased expression of SELENOS mRNA and Tunicamycin results in increased expression of SELS mRNA CTD PMID:16227999 more ... Selenos Rat valproic acid decreases methylation ISO SELENOS (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of SELENOS gene CTD PMID:29154799 Selenos Rat valproic acid affects expression ISO Selenos (Mus musculus) 6480464 Valproic Acid affects the expression of SELENOS mRNA CTD PMID:17292431
Biological Process
cell redox homeostasis (IEA,ISO) cellular oxidant detoxification (IEA) cellular response to lipopolysaccharide (IEA,ISO) cellular response to oxidative stress (IEA,ISO) endoplasmic reticulum unfolded protein response (IBA,IEA,ISO) ER overload response (IEA,ISO) ERAD pathway (IEA,ISO) intracellular protein transport (IEA) negative regulation of acute inflammatory response to antigenic stimulus (IEA,ISO) negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway (IEA,ISO) negative regulation of interleukin-6 production (IEA,ISO) negative regulation of macrophage apoptotic process (IEA,ISO) negative regulation of tumor necrosis factor production (IEA,ISO) regulation of nitric oxide metabolic process (IEA,ISO) response to glucose (IEA,ISO) response to redox state (IEA,ISO) retrograde protein transport, ER to cytosol (IBA,IEA,ISO)
Cellular Component
cytoplasm (IEA) cytoplasmic microtubule (IEA,ISO,ISS) Derlin-1 retrotranslocation complex (IBA,IEA,ISO) Derlin-1-VIMP complex (IBA,IEA,ISO) endoplasmic reticulum (IEA,ISO) endoplasmic reticulum membrane (IEA,ISO) low-density lipoprotein particle (IEA,ISO) membrane (IEA) very-low-density lipoprotein particle (IEA,ISO)
Selenos Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 129,070,240 - 129,080,007 (+) NCBI GRCr8 mRatBN7.2 1 119,659,779 - 119,669,546 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 119,659,751 - 119,669,833 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 127,652,801 - 127,662,498 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 134,824,245 - 134,833,942 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 127,633,662 - 127,643,427 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 126,979,579 - 126,989,344 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 126,979,575 - 126,989,344 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 128,065,929 - 128,075,694 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 120,509,100 - 120,518,867 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 120,587,444 - 120,597,210 (+) NCBI Celera 1 111,871,435 - 111,881,202 (+) NCBI Celera Cytogenetic Map 1 q22 NCBI
SELENOS Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 15 101,270,809 - 101,277,485 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 15 101,270,531 - 101,277,500 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 15 101,811,014 - 101,817,690 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 15 99,628,737 - 99,635,223 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 15 78,224,059 - 78,230,545 (-) NCBI Celera Cytogenetic Map 15 q26.3 NCBI HuRef 15 77,933,623 - 77,940,109 (-) NCBI HuRef CHM1_1 15 101,652,200 - 101,658,686 (-) NCBI CHM1_1 T2T-CHM13v2.0 15 99,025,841 - 99,032,517 (-) NCBI T2T-CHM13v2.0
Selenos Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 65,729,397 - 65,739,153 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 65,729,397 - 65,739,153 (+) Ensembl GRCm39 Ensembl GRCm38 7 66,079,649 - 66,089,405 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 66,079,649 - 66,089,405 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 73,224,535 - 73,234,291 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 65,958,609 - 65,968,353 (+) NCBI MGSCv36 mm8 Celera 7 63,515,279 - 63,525,171 (+) NCBI Celera Cytogenetic Map 7 C NCBI cM Map 7 35.49 NCBI
Selenos Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955416 28,153,460 - 28,162,095 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955416 28,152,984 - 28,162,173 (-) NCBI ChiLan1.0 ChiLan1.0
SELENOS Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 16 90,861,442 - 90,867,950 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 15 94,561,283 - 94,569,167 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 15 79,995,678 - 80,002,159 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 15 99,279,195 - 99,285,682 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 15 99,279,203 - 99,285,682 (-) Ensembl panpan1.1 panPan2
SELENOS Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 3 39,796,711 - 39,805,654 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 3 39,796,711 - 39,805,591 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 3 42,486,298 - 42,495,243 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 3 40,188,127 - 40,197,076 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 3 40,188,094 - 40,197,506 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 3 39,721,571 - 39,730,515 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 3 39,958,383 - 39,967,333 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 3 40,159,929 - 40,168,876 (+) NCBI UU_Cfam_GSD_1.0
Selenos Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 143,733,962 - 143,744,737 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936483 2,589,828 - 2,599,987 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936483 2,589,773 - 2,600,837 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SELENOS Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 139,828,791 - 139,836,914 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 139,829,002 - 139,836,923 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 156,058,088 - 156,066,010 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SELENOS Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 29 19,727,073 - 19,732,384 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 29 19,726,451 - 19,732,375 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666059 26,808,486 - 26,813,835 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Selenos
.
Predicted Target Of
Count of predictions: 326 Count of miRNA genes: 201 Interacting mature miRNAs: 217 Transcripts: ENSRNOT00000016916 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1582234 Gluco18 Glucose level QTL 18 3.4 0.0003 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 78479925 123479925 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 9590300 Scort16 Serum corticosterone level QTL 16 4.39 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 103111621 148111621 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 631199 Cm23 Cardiac mass QTL 23 4.6 0.0004 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 115585465 172949803 Rat 1302788 Scl19 Serum cholesterol QTL 19 4.6 0.001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 90532338 123479925 Rat 631569 Bp93 Blood pressure QTL 93 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 106047847 121834139 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 152025232 Bw192 Body weight QTL 192 3.93 body mass (VT:0001259) 1 117917486 196963478 Rat 61344 Bp29 Blood pressure QTL 29 7.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 78350581 123350581 Rat 724521 Uae1 Urinary albumin excretion QTL 1 3.8 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 90508614 173018436 Rat 1358902 Bw47 Body weight QTL 47 1.67 body mass (VT:0001259) body weight (CMO:0000012) 1 90508614 180359386 Rat 61346 Rf2 Renal disease susceptibility QTL 2 3.7 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 1 99267916 144267916 Rat 8655649 Arrd1 Age-related retinal degeneration QTL 1 4.89 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 100357752 183970443 Rat 1300153 Bp171 Blood pressure QTL 171 3.37 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 90664883 143200202 Rat 2317833 Alcrsp19 Alcohol response QTL 19 12.4 0.001 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 1 100979852 145979852 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 631205 Bp196 Blood pressure QTL 196 4 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118944897 199050459 Rat 1300158 Bp173 Blood pressure QTL 173 3.48 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 1 115540693 185145286 Rat 1641897 Alcrsp1 Alcohol response QTL 1 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 1 100979852 145979852 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 2293142 Bp314 Blood pressure QTL 314 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 92184926 137184926 Rat 724529 Cm16 Cardiac mass QTL 16 2.7 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 1 87580395 150700247 Rat 61370 Mcs3 Mammary carcinoma susceptibility QTL 3 2.15 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 102268556 147268556 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 631496 Bp97 Blood pressure QTL 97 3.08 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 106047847 151047847 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 2303591 Gluco41 Glucose level QTL 41 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 102168504 147168504 Rat 1331793 Bp200 Blood pressure QTL 200 3.71601 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94494440 172949803 Rat 2313060 Bss71 Bone structure and strength QTL 71 2.6 0.0001 long bone metaphysis morphology trait (VT:0000133) tibia midshaft total cross-sectional area (CMO:0001715) 1 118944747 163944747 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 61399 Tcat1 Tongue tumor resistance QTL 1 3.3 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 5 mm (CMO:0001879) 1 99267916 144267916 Rat 4889494 Scort2 Serum corticosterone level QTL 2 4.2 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 80592172 125592172 Rat 724567 Tcas6 Tongue tumor susceptibility QTL 6 6.85 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 1 92948896 144267916 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 1358192 Ept13 Estrogen-induced pituitary tumorigenesis QTL 13 3.4 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 77494165 122494165 Rat 8694370 Bw154 Body weight QTL 154 8.91 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 1 103111621 148111621 Rat 1354623 Rf46 Renal function QTL 46 3.8 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 1 102813953 151162766 Rat 738022 Anxrr13 Anxiety related response QTL 13 4.6 0.00039 locomotor behavior trait (VT:0001392) number of 20 x 20 cm floor squares crossed into, out of or within a discrete space in an experimental apparatus (CMO:0001514) 1 83547917 128547917 Rat 10054135 Gmadr2 Adrenal mass QTL 2 1.97 0.0129 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 77857876 122857876 Rat 7411712 Strs4 Sensitivity to stroke QTL 4 8.7 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 1 78430536 123430536 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000016916 ⟹ ENSRNOP00000016916
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 119,659,751 - 119,669,833 (+) Ensembl Rnor_6.0 Ensembl 1 126,979,575 - 126,989,338 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000081746 ⟹ ENSRNOP00000074863
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 119,659,751 - 119,667,530 (+) Ensembl Rnor_6.0 Ensembl 1 126,979,579 - 126,989,344 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000116909 ⟹ ENSRNOP00000094148
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 119,659,751 - 119,669,539 (+) Ensembl
RefSeq Acc Id:
NM_173120 ⟹ NP_775143
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 129,070,240 - 129,080,007 (+) NCBI mRatBN7.2 1 119,659,779 - 119,669,546 (+) NCBI Rnor_6.0 1 126,979,579 - 126,989,344 (+) NCBI Rnor_5.0 1 128,065,929 - 128,075,694 (+) NCBI RGSC_v3.4 1 120,509,100 - 120,518,867 (+) RGD Celera 1 111,871,435 - 111,881,202 (+) RGD
Sequence:
GAAGGGCTAGTCGTTGGCGGCCGCAGCCATGGATCGCGGGGAGGAACCTCTGTCCGCGAGGCCGGCGCTGGAGACCGAGAGCCTGCGATTCCTGCACGTCACAGTGGGCTCCCTGCTGGCCAGCTATG
hide sequence
RefSeq Acc Id:
NP_775143 ⟸ NM_173120
- UniProtKB:
A0A8I6AMI0 (UniProtKB/TrEMBL), A6JBP7 (UniProtKB/TrEMBL)
- Sequence:
MDRGEEPLSARPALETESLRFLHVTVGSLLASYGWYILFSCVLLYIVIQKLSLRLRALRQRQLDQAEAVLEPDVVVKRQEALAAARLRMQEDLNAQVEKHKEKLRQLEEEKRRQKIEMWDSMQEGRSY
hide sequence
Ensembl Acc Id:
ENSRNOP00000016916 ⟸ ENSRNOT00000016916
Ensembl Acc Id:
ENSRNOP00000074863 ⟸ ENSRNOT00000081746
Ensembl Acc Id:
ENSRNOP00000094148 ⟸ ENSRNOT00000116909
RGD ID: 13690105 Promoter ID: EPDNEW_R627 Type: multiple initiation site Name: Selenos_1 Description: selenoprotein S SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 126,979,575 - 126,979,635 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-09-28
Selenos
selenoprotein S
Vimp
VCP-interacting membrane selenoprotein
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2015-04-29
Vimp
VCP-interacting membrane selenoprotein
Vimp
VCP-interacting membrane protein
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-10-16
Vimp
VCP-interacting membrane protein
Sels
selenoprotein S
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-07-28
Sels
selenoprotein S
SELS
selenoprotein S
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-25
SELS
selenoprotein S
Ratsg2
Ratsg2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2003-02-27
Ratsg2
Ratsg2
Symbol and Name status set to provisional
70820 PROVISIONAL
