Wnt5b (Wnt family member 5B) - Rat Genome Database

Name: Wnt5b
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Wnt5b (Wnt family member 5B) Rattus norvegicus

Analyze

Symbol:

Wnt5b

Name:

Wnt family member 5B

RGD ID:

628850

Description:

Predicted to enable cytokine activity and frizzled binding activity. Predicted to be involved in several processes, including canonical Wnt signaling pathway; chondrocyte differentiation; and positive regulation of cell migration. Predicted to act upstream of or within negative regulation of canonical Wnt signaling pathway and positive regulation of fat cell differentiation. Predicted to be located in cell surface and extracellular matrix. Predicted to be active in extracellular space. Orthologous to human WNT5B (Wnt family member 5B); PARTICIPATES IN Wnt signaling pathway; Wnt signaling, canonical pathway; basal cell carcinoma pathway; INTERACTS WITH 1,3-dinitrobenzene; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

wingless-related MMTV integration site 5B; wingless-type MMTV integration site family, member 5B

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	WNT5B (Wnt family member 5B)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Wnt5b (wingless-type MMTV integration site family, member 5B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Wnt5b (Wnt family member 5B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	WNT5B (Wnt family member 5B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	WNT5B (Wnt family member 5B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Wnt5b (Wnt family member 5B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	WNT5B (Wnt family member 5B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	WNT5B (Wnt family member 5B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Wnt5b (Wnt family member 5B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	WNT5A (Wnt family member 5A)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	WNT5B (Wnt family member 5B)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Wnt5b (wingless-type MMTV integration site family, member 5B)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	wnt5b (wingless-type MMTV integration site family, member 5b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	cwn-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Wnt5	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	wnt5b	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	154,281,852 - 154,406,081 (-)	NCBI		GRCr8
mRatBN7.2	4	152,609,566 - 152,733,790 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	152,609,569 - 152,733,407 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	158,871,858 - 158,887,919 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	154,655,571 - 154,671,633 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	153,278,919 - 153,294,983 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	151,500,962 - 151,516,894 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	151,500,957 - 151,516,894 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	217,413,755 - 217,429,687 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	155,747,648 - 155,763,554 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	155,993,769 - 156,005,122 (-)	NCBI
Celera	4	141,470,185 - 141,485,879 (-)	NCBI		Celera
Cytogenetic Map	4	q42	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

adenoid cystic carcinoma (ISO)

Experimental Mammary Neoplasms (ISO)

genetic disease (ISO)

Hyperphosphatemic Familial Tumoral Calcinosis 1 (ISO)

leiomyoma (ISO)

Salivary Gland Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

1,3-dinitrobenzene (EXP)

17beta-estradiol (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-palmitoylglycerol (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

8-Br-cAMP (ISO)

9-cis-retinoic acid (ISO)

acetaldehyde (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

amosite asbestos (ISO)

atrazine (EXP)

belinostat (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

C60 fullerene (EXP)

carbon nanotube (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

clofibrate (ISO)

copper atom (EXP)

copper(0) (EXP)

crocidolite asbestos (ISO)

dexamethasone (ISO)

diuron (EXP)

dorsomorphin (ISO)

elemental selenium (ISO)

entinostat (ISO)

ethanol (ISO)

flusilazole (ISO)

fulvestrant (ISO)

indometacin (ISO)

lipopolysaccharide (ISO)

mercury dibromide (ISO)

methylmercury chloride (ISO)

nickel subsulfide (EXP)

O-methyleugenol (ISO)

p-chloromercuribenzoic acid (ISO)

panobinostat (ISO)

paracetamol (EXP,ISO)

phenobarbital (ISO)

phenylmercury acetate (ISO)

progesterone (ISO)

resveratrol (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

selenium atom (ISO)

serpentine asbestos (ISO)

silicon dioxide (EXP,ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

sodium chloride (EXP)

thalidomide (ISO)

toluene (EXP)

trichloroethene (EXP)

trichostatin A (ISO)

triclosan (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

canonical Wnt signaling pathway (IBA)

cell fate commitment (IBA)

chondrocyte differentiation (ISO)

negative regulation of canonical Wnt signaling pathway (ISO)

neuron differentiation (IBA)

positive regulation of cell migration (ISO)

positive regulation of fat cell differentiation (ISO)

Cellular Component

cell surface (ISO)

extracellular matrix (ISO)

extracellular space (IBA)

Molecular Function

cytokine activity (IBA)

frizzled binding (IBA)

protein binding (ISO)

signaling receptor binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

basal cell carcinoma pathway (IEA)

Hedgehog signaling pathway (IEA)

Wnt signaling pathway (IEA,ISO)

Wnt signaling, canonical pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Expression of Wnt and MMP in epithelial cells during corneal wound healing.	Lyu J and Joo CK, Cornea. 2006 Dec;25(10 Suppl 1):S24-8.
3.	Overexpression of the Wnt5b gene in leiomyoma cells: implications for a role of the Wnt signaling pathway in the uterine benign tumor.	Mangioni S, etal., J Clin Endocrinol Metab. 2005 Sep;90(9):5349-55. Epub 2005 Jun 21.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Comprehensive gene review and curation	RGD comprehensive gene curation
10.	The Wnt Homepage	Roel Nusse - Howard Hughes Medical Institute and the Department of Developmental Biology at Stanford University, California, USA
11.	Transformation by Wnt family proteins correlates with regulation of beta-catenin.	Shimizu H, etal., Cell Growth Differ. 1997 Dec;8(12):1349-58.
12.	The evolutionarily conserved porcupine gene family is involved in the processing of the Wnt family.	Tanaka K, etal., Eur J Biochem 2000 Jul;267(13):4300-11.
13.	Alternative wnt signaling is initiated by distinct receptors.	van Amerongen R, etal., Sci Signal. 2008 Sep 2;1(35):re9.
14.	Differential transformation of mammary epithelial cells by Wnt genes.	Wong GT, etal., Mol Cell Biol. 1994 Sep;14(9):6278-86.
15.	Wnt5a and Wnt5b exhibit distinct activities in coordinating chondrocyte proliferation and differentiation.	Yang Y, etal., Development 2003 Mar;130(5):1003-15.

Additional References at PubMed

PMID:8167409	PMID:12399112	PMID:12477932	PMID:15135146	PMID:15731909	PMID:15796911	PMID:19056867	PMID:19486338	PMID:20093360

Genomics

Comparative Map Data

Wnt5b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	154,281,852 - 154,406,081 (-)	NCBI		GRCr8
mRatBN7.2	4	152,609,566 - 152,733,790 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	152,609,569 - 152,733,407 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	158,871,858 - 158,887,919 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	154,655,571 - 154,671,633 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	153,278,919 - 153,294,983 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	151,500,962 - 151,516,894 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	151,500,957 - 151,516,894 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	217,413,755 - 217,429,687 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	155,747,648 - 155,763,554 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	155,993,769 - 156,005,122 (-)	NCBI
Celera	4	141,470,185 - 141,485,879 (-)	NCBI		Celera
Cytogenetic Map	4	q42	NCBI

WNT5B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	1,617,056 - 1,647,212 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	1,529,891 - 1,647,212 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	1,726,222 - 1,756,378 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	1,596,483 - 1,626,639 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	1,608,672 - 1,626,638	NCBI
Celera	12	3,334,306 - 3,364,399 (+)	NCBI		Celera
Cytogenetic Map	12	p13.33	NCBI
HuRef	12	1,580,178 - 1,611,098 (+)	NCBI		HuRef
CHM1_1	12	1,725,640 - 1,755,783 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	12	1,612,578 - 1,643,573 (+)	NCBI		T2T-CHM13v2.0

Wnt5b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	119,409,493 - 119,521,847 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	119,409,492 - 119,521,308 (-)	Ensembl		GRCm39 Ensembl
GRCm38	6	119,432,531 - 119,544,824 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	119,432,531 - 119,544,347 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	119,382,549 - 119,494,365 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	119,398,152 - 119,432,830 (-)	NCBI		MGSCv36	mm8
Celera	6	121,265,742 - 121,378,088 (-)	NCBI		Celera
Cytogenetic Map	6	F1	NCBI
cM Map	6	56.86	NCBI

Wnt5b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955454	4,178,609 - 4,192,710 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955454	4,158,648 - 4,192,709 (+)	NCBI	ChiLan1.0	ChiLan1.0

WNT5B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	7,061,798 - 7,185,291 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	7,058,557 - 7,182,072 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	1,633,987 - 1,757,431 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	1,690,382 - 1,708,351 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	1,691,097 - 1,708,351 (+)	Ensembl	panpan1.1		panPan2

WNT5B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	27	43,662,482 - 43,679,713 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	27	43,620,284 - 43,677,078 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	27	3,005,866 - 3,114,488 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	27	43,937,616 - 44,046,407 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	27	43,990,960 - 44,044,187 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	27	43,868,749 - 43,977,500 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	27	43,841,172 - 43,950,683 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	27	2,363,801 - 2,472,605 (-)	NCBI		UU_Cfam_GSD_1.0

Wnt5b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	107,329,243 - 107,442,601 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936606	1,838,043 - 1,856,095 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936606	1,741,500 - 1,854,857 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

WNT5B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	68,627,185 - 68,732,265 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	68,627,158 - 68,731,938 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	71,086,581 - 71,088,105 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

WNT5B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	1,571,569 - 1,689,750 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	1,674,245 - 1,690,299 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666063	6,638,682 - 6,758,591 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Wnt5b
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624735	11,223,227 - 11,236,609 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624735	11,222,339 - 11,326,480 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Wnt5b
836 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	314
Count of miRNA genes:	193
Interacting mature miRNAs:	210
Transcripts:	ENSRNOT00000011044
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	44463720	155883716	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	59948935	154902892	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	64528739	157573521	Rat
70177	Xhs1	X-ray hypersensitivity QTL 1	25.1		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	82798864	152731274	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	83428419	177635233	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	85379421	167139601	Rat
634335	Anxrr16	Anxiety related response QTL 16	7.22		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	93308457	167139447	Rat
7207480	Bss105	Bone structure and strength QTL 105	8.1		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	4	109827074	154827074	Rat
1549832	Bss3	Bone structure and strength QTL 3	11		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	4	109827074	154827074	Rat
737821	Hcar9	Hepatocarcinoma resistance QTL 9	3.7		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	109866907	167139601	Rat
1331759	Hrtrt13	Heart rate QTL 13	3.54628		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	110275411	168266883	Rat
6478760	Anxrr45	Anxiety related response QTL 45		0.06717	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	110870972	155870972	Rat
6478763	Anxrr46	Anxiety related response QTL 46		0.07428	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	110870972	155870972	Rat
12798519	Anxrr54	Anxiety related response QTL 54	2.54	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	114627026	159627026	Rat
724535	Cm18	Cardiac mass QTL 18	2.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	4	118856416	163856416	Rat
1331802	Srn5	Serum renin concentration QTL 5	3.045		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	4	119428175	157578333	Rat
634347	Hcar8	Hepatocarcinoma resistance QTL 8	5.8		liver integrity trait (VT:0010547)	liver tumorous lesion area to total liver area ratio (CMO:0001075)	4	123143783	168143783	Rat
631683	Bp116	Blood pressure QTL 116		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	124303370	169303370	Rat
6478778	Anxrr51	Anxiety related response QTL 51		0.25384	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	124778595	169778595	Rat
7411558	Bw133	Body weight QTL 133	13.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	125590636	170590636	Rat
61451	Ciaa4	CIA Autoantibody QTL 4	3.1		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	4	126395976	167139601	Rat
737978	Pia23	Pristane induced arthritis QTL 23	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	131730738	167139601	Rat
631511	Pia7	Pristane induced arthritis QTL 7	4.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	131730738	167139601	Rat
1549827	Scl46	Serum cholesterol level QTL 46	3.5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	4	132396220	177396220	Rat
724558	Plsm2	Polydactyly-luxate syndrome (PLS) morphotypes QTL 2		0.0003	hindlimb integrity trait (VT:0010563)	hind foot phalanges count (CMO:0001949)	4	132422778	177422778	Rat
61422	Cia13	Collagen induced arthritis QTL 13	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	132642577	167139601	Rat
2303623	Vencon2	Ventilatory control QTL 2	3.8		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	4	135204660	180204660	Rat
1578674	Bmd12	Bone mineral density QTL 12	3.8		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	4	135699135	180699135	Rat
2293659	Bmd35	Bone mineral density QTL 35	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	4	137755016	181392681	Rat
61362	Oia2	Oil induced arthritis QTL 2		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	138503169	173369699	Rat
1298524	Oia8	Oil induced arthritis QTL 8			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	138503169	173369699	Rat
1331738	Bp209	Blood pressure QTL 209	2.979		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	138503169	179293946	Rat
6478718	Anxrr34	Anxiety related response QTL 34		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
6478748	Anxrr42	Anxiety related response QTL 42		0.28008	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
6478754	Anxrr43	Anxiety related response QTL 43		0.14035	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	144639524	182687754	Rat
6478693	Anxrr32	Anxiety related response QTL 32		0.00092	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	144639524	182687754	Rat
6478700	Anxrr33	Anxiety related response QTL 33		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
10401796	Kidm48	Kidney mass QTL 48			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	145568712	182687754	Rat
634342	Cia24	Collagen induced arthritis QTL 24	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	146565735	175236377	Rat
12798525	Anxrr57	Anxiety related response QTL 57	3.21	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	147278504	167139601	Rat
1582237	Kidm34	Kidney mass QTL 34	4	0.0001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	4	148090542	168069246	Rat
61446	Coreg2	Compensatory renal growth QTL 2	3.5		kidney mass (VT:0002707)	compensatory renal growth score (CMO:0001894)	4	148423102	157580971	Rat

Markers in Region

Wnt5b

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	152,610,063 - 152,610,483 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	151,501,460 - 151,501,879	NCBI	Rnor6.0
Rnor_5.0	4	217,414,253 - 217,414,672	UniSTS	Rnor5.0
RGSC_v3.4	4	155,748,146 - 155,748,565	UniSTS	RGSC3.4
Celera	4	141,470,683 - 141,471,102	UniSTS
Cytogenetic Map	4	q42	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium									8	6	22	2
Low	3	37	20	8	15	8		1	65	29	19	9
Below cutoff		6	34	30	4	30	8	10	1				8

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001100489	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017592493	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107157	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107158	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063285651	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF481944	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC161860	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473964	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000011044 ⟹ ENSRNOP00000011044

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	152,609,569 - 152,733,407 (-)	Ensembl
Rnor_6.0 Ensembl	4	151,500,962 - 151,516,894 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000089970 ⟹ ENSRNOP00000070168

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	4	151,500,957 - 151,516,223 (-)	Ensembl

RefSeq Acc Id:

NM_001100489 ⟹ NP_001093959

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	154,281,852 - 154,297,598 (-)	NCBI
mRatBN7.2	4	152,609,566 - 152,625,315 (-)	NCBI
Rnor_6.0	4	151,500,962 - 151,516,894 (-)	NCBI
Rnor_5.0	4	217,413,755 - 217,429,687 (-)	NCBI
RGSC_v3.4	4	155,747,648 - 155,763,554 (-)	RGD
Celera	4	141,470,185 - 141,485,879 (-)	RGD

Sequence:

show sequence

AACTCTGAATCCTGCTCCGGCCACCTTCCTCTCTTAGTGGACCCAGGTCAAACGTATTTCCTAT
ACCAACGGTCTAAAAAGCATTTGCCGCCCCCTCCTGGACAGTCTAGAGACCCAGACACTCAGGA
TCAGCGTGGGAGCTCCGCTTTGGAAGATGTTGGTCCCTGGGCACTGGGATGGGTTGAGGCCGGC
CATGCCCAGCCTGCTGCTGCTGTTCGTGGCAGCTCTGCTCTCCAGCTGGGCACAGCTGCTGACT
GACGCCAACTCCTGGTGGTCGCTGGCTCTGAACCCGGTGCAGAGACCCGAGATGTTCATCATTG
GCGCTCAGCCCGTGTGCAGCCAACTTCCCGGGCTTTCGCCAGGCCAGCGAAAGCTGTGTCAGTT
GTATCAGGAGCACATGTCCTACATCGGGGAGGGAGCCAAGACGGGCATCAGGGAGTGCCAGCAC
CAGTTTCGACAGAGGCGGTGGAACTGCAGCACCGTGGACAACTTGTCTGTCTTTGGCAGGGTCA
TGCAGATAGGTAGCCGAGAGACTGCCTTCACATATGCGGTGAGCGCTGCTGGTGTGGTGAATGC
CATCAGCCGAGCCTGCAGAGAGGGTGAGCTGTCCACCTGTGGCTGCAGCCGTGCAGCGAGGCCC
AAGGACCTGCCACGAGACTGGTTGTGGGGCGGCTGTGGGGACAACGTGGAGTATGGCTACCGCT
TTGCCAAGGAGTTTGTGGATGCCCGAGAGCGTGAGAAGAACTTTGCCAAGGGATCAGAGGAGCA
GGGCCGAGCCCTCATGAACTTACAGAACAACGAGGCTGGCCGCCGGGCCGTGTATAAGATGGCT
GATGTCTCCTGCAAATGTCACGGAGTCTCCGGGTCCTGCAGCCTCAAGACCTGCTGGCTCCAGC
TGGCTGAGTTCCGCAAGGTGGGGGACCGTTTGAAAGAGAAGTATGACAGCGCTGCGGCCATGCG
TATCACCCGTCAGGGCAAGCTGGAACTGACCAACAGCCGCTTCAACCAGCCCAGCCCGGAGGAC
CTGGTCTACGTAGACCCCAGCCCTGACTACTGCCTGCGAAATGAGACCACGGGCTCCCTGGGCA
CCCAAGGTCGCCTCTGCAACAAGACCTCAGAGGGCACGGATGGCTGCGAGCTCATGTGCTGTGG
CCGCGGCTATGACCGCTTCAAGAGCGTCCAGGTGGAACGCTGCCACTGCAGGTTCCACTGGTGT
TGCTTTGTCAGATGCAAAAAATGCACCGAGATCGTGGACCAGTATGTCTGTAAGTGACTGCACA
CGGGCCTCCAGCCCGCTCCTCTCCGCCTCACAAAAGTCTATATTATATAAATCTATCTAAAATA
TATTTTATATTTGTACGAATGGATGGATGGATGATGAATAATCAAGAGAAGAGAATGGAGAGGA
AGAACTTCCGAGATGCTGGCCCTCTGTGAGGACTGGACTTTGCTGGAAATCTACAGCCAGTGGG
AGAGAAACGGGCTTTTCCCTGTTTTCTGGCCAGGACTCTCTGGACAGGGGCTTGAGAATGTCTA
TGCGCCATAGCCTCCGGGAGAAAGGTGGGGAGGAGATGAAGGGGATGGGCTTGTTTCAGATCTA
TAGTCCTGTGGGGAAGATGAATGTCTGTGACCCTGGCCAGGAGACCCAGAGGCCCTGTGGAAGG
TAGGAAGACCTGCCCACCCCGATGGAGGCCCAGGTCTTCCCCGAGATGGAGATGGCTTTGGGAA
GGGGCTCTGAGCTTGCTTCTTTTCTCATCTGAGTACACATGGCAGGAAAGTTTCCTTCCCCAAT
ATTGGGGAGTGGTCTCAAGTCACCCTGACTGGTGACCGTAAGAGATCTGGGCCTCCCTGGACCC
TGGGTCTGCCTTCGGATGAGAATATCACCAGCTTCTGCGTCAAGCTCCTGTGCCAAGAGAAAGA
CGTCACCTGCTATTGCCAGGAAGTCATGGGGCAAAGCTGGGCTTCGACTGGGGACCTGTTGCAC
AGGATGGGAAACTGCTGTCACTCTGTTGAGGGAGGCCTGAAGAACGGCAGGCATGCTGGCAGGC
CAACTGCCTTGTGTGACTGTCATCGCTGCCCACATGTACAGCATCCCTCTGACATTAAATACCT
TTTACTCAAG

hide sequence

RefSeq Acc Id:

XM_039107157 ⟹ XP_038963085

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	154,281,853 - 154,405,541 (-)	NCBI
mRatBN7.2	4	152,609,566 - 152,733,407 (-)	NCBI

RefSeq Acc Id:

XM_039107158 ⟹ XP_038963086

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	154,281,853 - 154,406,081 (-)	NCBI
mRatBN7.2	4	152,609,566 - 152,733,790 (-)	NCBI

RefSeq Acc Id:

XM_063285651 ⟹ XP_063141721

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	154,281,853 - 154,316,538 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001093959	(Get FASTA)	NCBI Sequence Viewer
	XP_038963085	(Get FASTA)	NCBI Sequence Viewer
	XP_038963086	(Get FASTA)	NCBI Sequence Viewer
	XP_063141721	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI61860	(Get FASTA)	NCBI Sequence Viewer
	AAN51980	(Get FASTA)	NCBI Sequence Viewer
	EDM02053	(Get FASTA)	NCBI Sequence Viewer
	EDM02054	(Get FASTA)	NCBI Sequence Viewer
	EDM02055	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000011044
	ENSRNOP00000011044.4

RefSeq Acc Id:	NP_001093959 ⟸ NM_001100489
- Peptide Label:	precursor
- UniProtKB:	B1WBR9 (UniProtKB/TrEMBL), F7FL18 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLVPGHWDGLRPAMPSLLLLFVAALLSSWAQLLTDANSWWSLALNPVQRPEMFIIGAQPVCSQL PGLSPGQRKLCQLYQEHMSYIGEGAKTGIRECQHQFRQRRWNCSTVDNLSVFGRVMQIGSRETA FTYAVSAAGVVNAISRACREGELSTCGCSRAARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDAR EREKNFAKGSEEQGRALMNLQNNEAGRRAVYKMADVSCKCHGVSGSCSLKTCWLQLAEFRKVGD RLKEKYDSAAAMRITRQGKLELTNSRFNQPSPEDLVYVDPSPDYCLRNETTGSLGTQGRLCNKT SEGTDGCELMCCGRGYDRFKSVQVERCHCRFHWCCFVRCKKCTEIVDQYVCK hide sequence

RefSeq Acc Id:

ENSRNOP00000070168 ⟸ ENSRNOT00000089970

RefSeq Acc Id:

ENSRNOP00000011044 ⟸ ENSRNOT00000011044

RefSeq Acc Id:	XP_038963086 ⟸ XM_039107158
- Peptide Label:	isoform X1
- UniProtKB:	B1WBR9 (UniProtKB/TrEMBL), F7FL18 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038963085 ⟸ XM_039107157
- Peptide Label:	isoform X1
- UniProtKB:	B1WBR9 (UniProtKB/TrEMBL), F7FL18 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063141721 ⟸ XM_063285651
- Peptide Label:	isoform X1
- UniProtKB:	B1WBR9 (UniProtKB/TrEMBL), F7FL18 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B1WBR9-F1-model_v2	AlphaFold	B1WBR9	1-372	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:628850	AgrOrtholog
BioCyc Gene	G2FUF-43218	BioCyc
Ensembl Genes	ENSRNOG00000008168	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000011044.5	UniProtKB/TrEMBL
Gene3D-CATH	3.30.2460.20	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7096336	IMAGE-MGC_LOAD
InterPro	Wnt_C	UniProtKB/TrEMBL
	Wnt_CS	UniProtKB/TrEMBL
	Wnt_SF	UniProtKB/TrEMBL
KEGG Report	rno:282582	UniProtKB/TrEMBL
MGC_CLONE	MGC:187394	IMAGE-MGC_LOAD
NCBI Gene	282582	ENTREZGENE
PANTHER	PTHR12027:SF87	UniProtKB/TrEMBL
	Wnt	UniProtKB/TrEMBL
Pfam	wnt	UniProtKB/TrEMBL
PhenoGen	Wnt5b	PhenoGen
PRINTS	WNTPROTEIN	UniProtKB/TrEMBL
PROSITE	WNT1	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000008168	RatGTEx
SMART	WNT1	UniProtKB/TrEMBL
UniProt	B1WBR9	ENTREZGENE, UniProtKB/TrEMBL
	F7FL18	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-03-29	Wnt5b	Wnt family member 5B	Wnt5b	wingless-type MMTV integration site family, member 5B	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-11-14	Wnt5b	wingless-type MMTV integration site family, member 5B	Wnt5b	wingless-related MMTV integration site 5B	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Wnt5b	wingless-related MMTV integration site 5B			Symbol and Name status set to approved	1299863	APPROVED
2003-02-27	Wnt5b	wingless-related MMTV integration site 5B			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)