Symbol:
Enpp1
Name:
ectonucleotide pyrophosphatase/phosphodiesterase 1
RGD ID:
628825
Description:
Enables phosphodiesterase I activity. Involved in several processes, including brain development; cellular response to cAMP; and cellular response to mechanical stimulus. Located in dendrite; neuronal cell body; and plasma membrane. Biomarker of aortic valve disease 1. Human ortholog(s) of this gene implicated in several diseases, including arterial calcification of infancy; end stage renal disease; obesity; ossification of the posterior longitudinal ligament of spine; and type 2 diabetes mellitus. Orthologous to human ENPP1 (ectonucleotide pyrophosphatase/phosphodiesterase 1); PARTICIPATES IN insulin signaling pathway; niacin metabolic pathway; pantothenic acid metabolic pathway; INTERACTS WITH 17beta-estradiol; 1H-[1,2,4]oxadiazolo[4,3-a]quinoxalin-1-one; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
alkaline phosphodiesterase I; E-NPP 1; ectonucleotide pyrophosphatase/phosphodiesterase family member 1; NPPase; Npps; nucleotide diphosphatase; nucleotide pyrophosphatase; Pc1; phosphodiesterase I/nucleotide pyrophosphatase 1; plasma-cell membrane glycoprotein PC-1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 22,518,051 - 22,583,044 (+) NCBI GRCr8 mRatBN7.2 1 20,698,746 - 20,763,741 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 20,698,764 - 20,763,715 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 20,475,435 - 20,539,162 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 26,475,432 - 26,539,171 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 20,675,339 - 20,739,097 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 21,748,201 - 21,813,205 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 21,748,261 - 21,813,371 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 23,228,262 - 23,292,896 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 21,223,678 - 21,287,411 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 21,223,940 - 21,288,766 (+) NCBI Celera 1 19,451,097 - 19,514,516 (+) NCBI Celera Cytogenetic Map 1 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Enpp1 Rat (1->4)-beta-D-glucan multiple interactions ISO Enpp1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ENPP1 mRNA CTD PMID:36331819 Enpp1 Rat 1,1-dichloroethene decreases expression ISO Enpp1 (Mus musculus) 6480464 vinylidene chloride results in decreased expression of ENPP1 mRNA CTD PMID:26682919 Enpp1 Rat 1,2-dimethylhydrazine affects expression ISO Enpp1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine affects the expression of ENPP1 mRNA CTD PMID:22206623 Enpp1 Rat 17alpha-ethynylestradiol increases expression ISO Enpp1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of ENPP1 mRNA CTD PMID:17942748 Enpp1 Rat 17beta-estradiol decreases expression ISO ENPP1 (Homo sapiens) 6480464 Estradiol results in decreased expression of ENPP1 mRNA CTD PMID:24758408 Enpp1 Rat 17beta-estradiol decreases expression ISO Enpp1 (Mus musculus) 6480464 Estradiol results in decreased expression of ENPP1 mRNA CTD PMID:39298647 Enpp1 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of ENPP1 mRNA CTD PMID:32145629 Enpp1 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of ENPP1 mRNA CTD PMID:26496021 Enpp1 Rat 17beta-estradiol multiple interactions ISO ENPP1 (Homo sapiens) 6480464 EGF protein inhibits the reaction [Estradiol results in decreased expression of ENPP1 mRNA] CTD PMID:24758408 Enpp1 Rat 1H-[1,2,4]oxadiazolo[4,3-a]quinoxalin-1-one multiple interactions EXP 6480464 1H-(1 more ... CTD PMID:21414308 Enpp1 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO ENPP1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Enpp1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Enpp1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of ENPP1 mRNA CTD PMID:19933214 Enpp1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO ENPP1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of ENPP1 mRNA CTD PMID:20106945 and PMID:21632981 Enpp1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ENPP1 mRNA CTD PMID:21215274 and PMID:34747641 Enpp1 Rat 2,4,6-tribromophenol increases expression ISO ENPP1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Enpp1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of ENPP1 mRNA CTD PMID:21346803 Enpp1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of ENPP1 mRNA CTD PMID:21346803 Enpp1 Rat 2-palmitoylglycerol increases expression ISO ENPP1 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of ENPP1 mRNA CTD PMID:37199045 Enpp1 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Enpp1 Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO ENPP1 (Homo sapiens) 6480464 tetrabromobisphenol A results in increased expression of ENPP1 protein CTD PMID:31675489 Enpp1 Rat 3,4-methylenedioxymethamphetamine decreases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of ENPP1 mRNA CTD PMID:30071829 Enpp1 Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin results in decreased expression of ENPP1 protein CTD PMID:34915118 Enpp1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO ENPP1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of ENPP1 mRNA more ... CTD PMID:28628672 Enpp1 Rat 4,4'-diaminodiphenylmethane decreases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of ENPP1 mRNA CTD PMID:30723492 Enpp1 Rat 4,4'-sulfonyldiphenol multiple interactions ISO Enpp1 (Mus musculus) 6480464 [bisphenol S co-treated with Tretinoin] results in decreased expression of ENPP1 mRNA CTD PMID:30951980 Enpp1 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of ENPP1 mRNA CTD PMID:36041667 Enpp1 Rat 4,4'-sulfonyldiphenol decreases expression ISO Enpp1 (Mus musculus) 6480464 bisphenol S results in decreased expression of ENPP1 mRNA CTD PMID:39298647 Enpp1 Rat 4,4'-sulfonyldiphenol increases expression ISO Enpp1 (Mus musculus) 6480464 bisphenol S results in increased expression of ENPP1 mRNA CTD PMID:30951980 Enpp1 Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of ENPP1 mRNA CTD PMID:19483382 Enpp1 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of ENPP1 mRNA CTD PMID:19483382 Enpp1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of ENPP1 mRNA CTD PMID:24780913 Enpp1 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of ENPP1 mRNA CTD PMID:31881176 Enpp1 Rat aflatoxin B1 decreases expression ISO Enpp1 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of ENPP1 mRNA CTD PMID:19770486 Enpp1 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of ENPP1 mRNA CTD PMID:33354967 Enpp1 Rat aflatoxin B1 decreases methylation ISO ENPP1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of ENPP1 gene CTD PMID:27153756 Enpp1 Rat aflatoxin B1 decreases expression ISO ENPP1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of ENPP1 mRNA CTD PMID:22100608 Enpp1 Rat all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of ENPP1 mRNA CTD PMID:20488242 Enpp1 Rat all-trans-retinoic acid increases expression ISO Enpp1 (Mus musculus) 6480464 Tretinoin results in increased expression of ENPP1 mRNA CTD PMID:36189433 Enpp1 Rat all-trans-retinoic acid multiple interactions ISO Enpp1 (Mus musculus) 6480464 [bisphenol A co-treated with Tretinoin] results in decreased expression of ENPP1 mRNA more ... CTD PMID:30951980 and PMID:36189433 Enpp1 Rat allopurinol decreases expression EXP 6480464 Allopurinol results in decreased expression of ENPP1 mRNA CTD PMID:26968635 Enpp1 Rat alloxanthine decreases expression EXP 6480464 Oxypurinol results in decreased expression of ENPP1 mRNA CTD PMID:26968635 Enpp1 Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of ENPP1 mRNA CTD PMID:19483382 Enpp1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of ENPP1 mRNA CTD PMID:16483693 Enpp1 Rat aristolochic acid A decreases expression ISO ENPP1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of ENPP1 mRNA CTD PMID:33212167 Enpp1 Rat arsane multiple interactions ISO ENPP1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ENPP1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ENPP1 mRNA CTD PMID:39836092 Enpp1 Rat arsenic atom multiple interactions ISO ENPP1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ENPP1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ENPP1 mRNA CTD PMID:39836092 Enpp1 Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of ENPP1 mRNA CTD PMID:36841081 Enpp1 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of ENPP1 gene CTD PMID:35440735 Enpp1 Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of ENPP1 mRNA CTD PMID:19483382 Enpp1 Rat benzo[a]pyrene increases expression ISO Enpp1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of ENPP1 mRNA CTD PMID:22228805 Enpp1 Rat benzo[a]pyrene decreases expression ISO ENPP1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of ENPP1 mRNA CTD PMID:30453624 Enpp1 Rat benzo[a]pyrene increases methylation ISO ENPP1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of ENPP1 promoter CTD PMID:27901495 Enpp1 Rat benzo[a]pyrene affects methylation ISO ENPP1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of ENPP1 intron CTD PMID:30157460 Enpp1 Rat benzo[a]pyrene increases expression ISO ENPP1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of ENPP1 mRNA CTD PMID:26238291 Enpp1 Rat benzo[a]pyrene diol epoxide I decreases expression ISO ENPP1 (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Enpp1 Rat bisphenol A decreases expression ISO Enpp1 (Mus musculus) 6480464 bisphenol A results in decreased expression of ENPP1 mRNA CTD PMID:20739668 Enpp1 Rat bisphenol A increases expression ISO Enpp1 (Mus musculus) 6480464 bisphenol A results in increased expression of ENPP1 mRNA CTD PMID:30951980 more ... Enpp1 Rat bisphenol A decreases expression ISO ENPP1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of ENPP1 mRNA and bisphenol A results in decreased expression of ENPP1 protein CTD PMID:29275510 and PMID:31675489 Enpp1 Rat bisphenol A multiple interactions ISO Enpp1 (Mus musculus) 6480464 [bisphenol A co-treated with Tretinoin] results in decreased expression of ENPP1 mRNA CTD PMID:30951980 Enpp1 Rat bisphenol A affects expression ISO ENPP1 (Homo sapiens) 6480464 bisphenol A affects the expression of ENPP1 mRNA CTD PMID:30903817 Enpp1 Rat bisphenol A multiple interactions ISO ENPP1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of ENPP1 mRNA CTD PMID:28628672 Enpp1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ENPP1 mRNA CTD PMID:25181051 Enpp1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of ENPP1 mRNA and [bisphenol A co-treated with Estradiol] results in increased expression of ENPP1 mRNA CTD PMID:26496021 and PMID:36041667 Enpp1 Rat bisphenol F multiple interactions ISO ENPP1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of ENPP1 mRNA CTD PMID:28628672 Enpp1 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of ENPP1 mRNA CTD PMID:36041667 Enpp1 Rat bisphenol F increases expression ISO Enpp1 (Mus musculus) 6480464 bisphenol F results in increased expression of ENPP1 mRNA CTD PMID:30951980 Enpp1 Rat bisphenol F multiple interactions ISO Enpp1 (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of ENPP1 mRNA CTD PMID:30951980 Enpp1 Rat buta-1,3-diene decreases expression ISO Enpp1 (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of ENPP1 mRNA CTD PMID:29038090 Enpp1 Rat butanal decreases expression ISO ENPP1 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of ENPP1 mRNA CTD PMID:26079696 Enpp1 Rat caffeine decreases phosphorylation ISO ENPP1 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of ENPP1 protein CTD PMID:35688186 Enpp1 Rat carbamazepine affects expression ISO ENPP1 (Homo sapiens) 6480464 Carbamazepine affects the expression of ENPP1 mRNA CTD PMID:24752500 Enpp1 Rat carbon nanotube decreases expression ISO Enpp1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Enpp1 Rat chromium atom increases expression ISO ENPP1 (Homo sapiens) 6480464 Chromium results in increased expression of ENPP1 mRNA CTD PMID:17547211 Enpp1 Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of ENPP1 mRNA CTD PMID:19483382 Enpp1 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of ENPP1 mRNA CTD PMID:24386269 Enpp1 Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of ENPP1 mRNA CTD PMID:22465980 Enpp1 Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of ENPP1 mRNA CTD PMID:22465980 Enpp1 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of ENPP1 mRNA CTD PMID:27523638 Enpp1 Rat cyclosporin A increases expression ISO ENPP1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of ENPP1 mRNA CTD PMID:21632981 Enpp1 Rat cyclosporin A decreases expression ISO ENPP1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of ENPP1 mRNA CTD PMID:20106945 and PMID:25562108 Enpp1 Rat decabromodiphenyl ether increases expression ISO ENPP1 (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of ENPP1 protein CTD PMID:31675489 Enpp1 Rat dexamethasone multiple interactions ISO ENPP1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of ENPP1 mRNA more ... CTD PMID:28628672 Enpp1 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of ENPP1 mRNA CTD PMID:21266533 Enpp1 Rat diclofenac affects expression ISO ENPP1 (Homo sapiens) 6480464 Diclofenac affects the expression of ENPP1 mRNA CTD PMID:24752500 Enpp1 Rat dipyridamole decreases expression EXP 6480464 Dipyridamole results in decreased expression of ENPP1 protein CTD PMID:21414308 Enpp1 Rat dorsomorphin multiple interactions ISO ENPP1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Enpp1 Rat elemental selenium decreases expression ISO Enpp1 (Mus musculus) 6480464 Selenium results in decreased expression of ENPP1 mRNA CTD PMID:28810182 Enpp1 Rat endosulfan affects expression EXP 6480464 Endosulfan affects the expression of ENPP1 mRNA CTD PMID:29391264 Enpp1 Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of ENPP1 mRNA CTD PMID:31881178 Enpp1 Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of ENPP1 mRNA CTD PMID:18035473 Enpp1 Rat folic acid increases expression ISO Enpp1 (Mus musculus) 6480464 Folic Acid results in increased expression of ENPP1 mRNA CTD PMID:25629700 Enpp1 Rat folic acid decreases expression ISO ENPP1 (Homo sapiens) 6480464 Folic Acid results in decreased expression of ENPP1 mRNA CTD PMID:21867686 Enpp1 Rat folpet decreases expression ISO Enpp1 (Mus musculus) 6480464 folpet results in decreased expression of ENPP1 mRNA CTD PMID:31558096 Enpp1 Rat genistein increases expression ISO ENPP1 (Homo sapiens) 6480464 Genistein results in increased expression of ENPP1 mRNA CTD PMID:22228119 Enpp1 Rat genistein decreases expression ISO Enpp1 (Mus musculus) 6480464 Genistein results in decreased expression of ENPP1 mRNA CTD PMID:32186404 Enpp1 Rat glycerol 2-phosphate increases expression ISO ENPP1 (Homo sapiens) 6480464 beta-glycerophosphoric acid results in increased expression of ENPP1 mRNA CTD PMID:18500657 Enpp1 Rat glycerol 2-phosphate multiple interactions ISO ENPP1 (Homo sapiens) 6480464 Levamisole inhibits the reaction [beta-glycerophosphoric acid results in increased activity of ENPP1 protein] and Levamisole inhibits the reaction [beta-glycerophosphoric acid results in increased expression of ENPP1 mRNA] CTD PMID:18500657 Enpp1 Rat glycerol 2-phosphate increases activity ISO ENPP1 (Homo sapiens) 6480464 beta-glycerophosphoric acid results in increased activity of ENPP1 protein CTD PMID:18500657 Enpp1 Rat glyphosate increases methylation EXP 6480464 Glyphosate results in increased methylation of ENPP1 gene CTD PMID:31011160 Enpp1 Rat hydroquinone O-beta-D-glucopyranoside decreases expression ISO ENPP1 (Homo sapiens) 6480464 Arbutin results in decreased expression of ENPP1 mRNA CTD PMID:17103032 Enpp1 Rat indometacin multiple interactions ISO ENPP1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of ENPP1 mRNA more ... CTD PMID:28628672 Enpp1 Rat indometacin decreases expression EXP 6480464 Indomethacin results in decreased expression of ENPP1 mRNA CTD PMID:36868495 Enpp1 Rat inulin multiple interactions ISO Enpp1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of ENPP1 mRNA CTD PMID:36331819 Enpp1 Rat isoprenaline decreases expression EXP 6480464 Isoproterenol results in decreased expression of ENPP1 protein CTD PMID:21414308 Enpp1 Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of ENPP1 mRNA CTD PMID:19483382 Enpp1 Rat leflunomide increases expression ISO ENPP1 (Homo sapiens) 6480464 leflunomide results in increased expression of ENPP1 mRNA CTD PMID:28988120 Enpp1 Rat levamisole multiple interactions ISO ENPP1 (Homo sapiens) 6480464 Levamisole inhibits the reaction [beta-glycerophosphoric acid results in increased activity of ENPP1 protein] and Levamisole inhibits the reaction [beta-glycerophosphoric acid results in increased expression of ENPP1 mRNA] CTD PMID:18500657 Enpp1 Rat maneb multiple interactions ISO Enpp1 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of ENPP1 mRNA CTD PMID:36117858 Enpp1 Rat manganese atom multiple interactions ISO ENPP1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ENPP1 mRNA CTD PMID:39836092 Enpp1 Rat manganese(0) multiple interactions ISO ENPP1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ENPP1 mRNA CTD PMID:39836092 Enpp1 Rat manganese(II) chloride multiple interactions ISO ENPP1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ENPP1 mRNA CTD PMID:39836092 Enpp1 Rat mercury atom increases expression ISO ENPP1 (Homo sapiens) 6480464 Mercury results in increased expression of ENPP1 mRNA CTD PMID:17547211 Enpp1 Rat mercury(0) increases expression ISO ENPP1 (Homo sapiens) 6480464 Mercury results in increased expression of ENPP1 mRNA CTD PMID:17547211 Enpp1 Rat methamphetamine decreases expression ISO Enpp1 (Mus musculus) 6480464 Methamphetamine results in decreased expression of ENPP1 mRNA CTD PMID:26307267 Enpp1 Rat methidathion increases expression ISO Enpp1 (Mus musculus) 6480464 methidathion results in increased expression of ENPP1 mRNA CTD PMID:34813904 Enpp1 Rat methotrexate affects expression ISO Enpp1 (Mus musculus) 6480464 Methotrexate affects the expression of ENPP1 mRNA CTD PMID:18502557 Enpp1 Rat methylmercury chloride decreases expression ISO ENPP1 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of ENPP1 mRNA CTD PMID:28001369 Enpp1 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Enpp1 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of ENPP1 mRNA CTD PMID:36189433 Enpp1 Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of ENPP1 mRNA CTD PMID:19638242 Enpp1 Rat N-nitrosodiethylamine increases expression ISO Enpp1 (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of ENPP1 mRNA CTD PMID:24535843 Enpp1 Rat N-nitrosodimethylamine increases expression ISO ENPP1 (Homo sapiens) 6480464 Dimethylnitrosamine results in increased expression of ENPP1 mRNA CTD PMID:17547211 Enpp1 Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of ENPP1 mRNA CTD PMID:24136188 Enpp1 Rat nickel atom decreases expression ISO ENPP1 (Homo sapiens) 6480464 Nickel results in decreased expression of ENPP1 mRNA CTD PMID:25583101 Enpp1 Rat nickel sulfate increases expression ISO ENPP1 (Homo sapiens) 6480464 nickel sulfate results in increased expression of ENPP1 mRNA CTD PMID:22714537 Enpp1 Rat nitroprusside multiple interactions EXP 6480464 1H-(1 more ... CTD PMID:21414308 Enpp1 Rat nitroprusside decreases expression EXP 6480464 Nitroprusside results in decreased expression of ENPP1 protein CTD PMID:21414308 Enpp1 Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of ENPP1 mRNA CTD PMID:19483382 Enpp1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of ENPP1 mRNA CTD PMID:25729387 Enpp1 Rat oxaliplatin decreases expression EXP 6480464 oxaliplatin results in decreased expression of ENPP1 mRNA CTD PMID:25729387 Enpp1 Rat ozone multiple interactions ISO Enpp1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of ENPP1 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of ENPP1 mRNA CTD PMID:34911549 Enpp1 Rat paracetamol decreases expression ISO ENPP1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of ENPP1 mRNA CTD PMID:26690555 Enpp1 Rat paraquat multiple interactions ISO Enpp1 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of ENPP1 mRNA CTD PMID:36117858 Enpp1 Rat parathion increases expression ISO Enpp1 (Mus musculus) 6480464 Parathion results in increased expression of ENPP1 mRNA CTD PMID:34813904 Enpp1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Enpp1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ENPP1 mRNA more ... CTD PMID:36331819 Enpp1 Rat phenobarbital decreases expression ISO Enpp1 (Mus musculus) 6480464 Phenobarbital results in decreased expression of ENPP1 mRNA CTD PMID:23091169 Enpp1 Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of ENPP1 mRNA CTD PMID:19483382 Enpp1 Rat pirinixic acid decreases expression ISO Enpp1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of ENPP1 mRNA CTD PMID:23811191 Enpp1 Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of ENPP1 mRNA CTD PMID:22484513 Enpp1 Rat potassium dichromate increases expression ISO ENPP1 (Homo sapiens) 6480464 Potassium Dichromate results in increased expression of ENPP1 mRNA CTD PMID:17547211 Enpp1 Rat progesterone increases expression ISO ENPP1 (Homo sapiens) 6480464 Progesterone results in increased expression of ENPP1 mRNA CTD PMID:20864642 Enpp1 Rat quercetin decreases expression ISO ENPP1 (Homo sapiens) 6480464 Quercetin results in decreased expression of ENPP1 mRNA CTD PMID:21632981 Enpp1 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of ENPP1 mRNA CTD PMID:19013527 Enpp1 Rat SB 431542 multiple interactions ISO ENPP1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Enpp1 Rat selenium atom decreases expression ISO Enpp1 (Mus musculus) 6480464 Selenium results in decreased expression of ENPP1 mRNA CTD PMID:28810182 Enpp1 Rat silicon dioxide decreases expression ISO ENPP1 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of ENPP1 mRNA CTD PMID:25895662 Enpp1 Rat silver atom decreases expression ISO Enpp1 (Mus musculus) 6480464 Silver results in decreased expression of ENPP1 mRNA CTD PMID:27131904 Enpp1 Rat silver(0) decreases expression ISO Enpp1 (Mus musculus) 6480464 Silver results in decreased expression of ENPP1 mRNA CTD PMID:27131904 Enpp1 Rat sodium arsenite increases expression ISO ENPP1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of ENPP1 mRNA CTD PMID:22714537 Enpp1 Rat sodium arsenite multiple interactions ISO ENPP1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ENPP1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ENPP1 mRNA CTD PMID:39836092 Enpp1 Rat sodium chloride increases expression EXP 6480464 Sodium Chloride results in increased expression of ENPP1 mRNA CTD PMID:37992803 Enpp1 Rat sotorasib multiple interactions ISO ENPP1 (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of ENPP1 mRNA CTD PMID:36139627 Enpp1 Rat sunitinib increases expression ISO ENPP1 (Homo sapiens) 6480464 Sunitinib results in increased expression of ENPP1 mRNA CTD PMID:31533062 Enpp1 Rat tauroursodeoxycholic acid decreases expression EXP 6480464 ursodoxicoltaurine results in decreased expression of ENPP1 mRNA CTD PMID:15885361 Enpp1 Rat testosterone decreases expression ISO ENPP1 (Homo sapiens) 6480464 Testosterone results in decreased expression of ENPP1 mRNA CTD PMID:33359661 Enpp1 Rat testosterone enanthate affects expression ISO ENPP1 (Homo sapiens) 6480464 testosterone enanthate affects the expression of ENPP1 mRNA CTD PMID:17440010 Enpp1 Rat tetrachloroethene increases expression ISO Enpp1 (Mus musculus) 6480464 Tetrachloroethylene results in increased expression of ENPP1 mRNA CTD PMID:28973375 Enpp1 Rat tetrachloromethane increases expression ISO Enpp1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of ENPP1 mRNA CTD PMID:17484886 Enpp1 Rat tetrachloromethane decreases expression ISO Enpp1 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of ENPP1 mRNA CTD PMID:31919559 Enpp1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of ENPP1 mRNA CTD PMID:31150632 Enpp1 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of ENPP1 mRNA CTD PMID:19483382 Enpp1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of ENPP1 mRNA CTD PMID:34492290 Enpp1 Rat titanium dioxide increases methylation ISO Enpp1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of ENPP1 gene CTD PMID:35295148 Enpp1 Rat titanium dioxide decreases methylation ISO Enpp1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of ENPP1 promoter CTD PMID:35295148 Enpp1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of ENPP1 mRNA CTD PMID:25729387 Enpp1 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of ENPP1 mRNA CTD PMID:25729387 Enpp1 Rat trametinib multiple interactions ISO ENPP1 (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of ENPP1 mRNA CTD PMID:36139627 Enpp1 Rat trichostatin A decreases expression ISO ENPP1 (Homo sapiens) 6480464 trichostatin A results in decreased expression of ENPP1 mRNA CTD PMID:24935251 Enpp1 Rat trimellitic anhydride increases expression ISO Enpp1 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of ENPP1 mRNA CTD PMID:19042947 Enpp1 Rat triptonide decreases expression ISO Enpp1 (Mus musculus) 6480464 triptonide results in decreased expression of ENPP1 mRNA CTD PMID:33045310 Enpp1 Rat troglitazone decreases expression ISO Enpp1 (Mus musculus) 6480464 troglitazone results in decreased expression of ENPP1 mRNA CTD PMID:28973697 Enpp1 Rat trovafloxacin decreases expression ISO Enpp1 (Mus musculus) 6480464 trovafloxacin results in decreased expression of ENPP1 mRNA CTD PMID:35537566 Enpp1 Rat valproic acid affects expression ISO ENPP1 (Homo sapiens) 6480464 Valproic Acid affects the expression of ENPP1 mRNA CTD PMID:25979313 Enpp1 Rat valproic acid multiple interactions ISO ENPP1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ENPP1 mRNA CTD PMID:27188386 Enpp1 Rat valproic acid increases expression ISO ENPP1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of ENPP1 mRNA CTD PMID:24383497 more ... Enpp1 Rat venlafaxine hydrochloride decreases expression EXP 6480464 Venlafaxine Hydrochloride results in decreased expression of ENPP1 mRNA CTD PMID:25423262 Enpp1 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of ENPP1 mRNA CTD PMID:23034163 Enpp1 Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of ENPP1 gene CTD PMID:31079544 Enpp1 Rat vorinostat multiple interactions ISO ENPP1 (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ENPP1 mRNA CTD PMID:27188386 Enpp1 Rat warfarin increases expression EXP 6480464 Warfarin results in increased expression of ENPP1 mRNA and Warfarin results in increased expression of ENPP1 protein CTD PMID:22659116
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) 1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 1H-[1,2,4]oxadiazolo[4,3-a]quinoxalin-1-one (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 2-palmitoylglycerol (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (EXP) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) acetamide (EXP) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (EXP,ISO) allopurinol (EXP) alloxanthine (EXP) amiodarone (EXP) ammonium chloride (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) atrazine (EXP) benzbromarone (EXP) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP,ISO) buta-1,3-diene (ISO) butanal (ISO) caffeine (ISO) carbamazepine (ISO) carbon nanotube (ISO) chromium atom (ISO) clofibrate (EXP) cobalt dichloride (EXP) copper atom (EXP) copper(0) (EXP) Cuprizon (EXP) cyclosporin A (ISO) decabromodiphenyl ether (ISO) dexamethasone (ISO) dibutyl phthalate (EXP) diclofenac (ISO) dipyridamole (EXP) dorsomorphin (ISO) elemental selenium (ISO) endosulfan (EXP) fipronil (EXP) flavonoids (EXP) folic acid (ISO) folpet (ISO) genistein (ISO) glycerol 2-phosphate (ISO) glyphosate (EXP) hydroquinone O-beta-D-glucopyranoside (ISO) indometacin (EXP,ISO) inulin (ISO) isoprenaline (EXP) L-ethionine (EXP) leflunomide (ISO) levamisole (ISO) maneb (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) mercury atom (ISO) mercury(0) (ISO) methamphetamine (ISO) methidathion (ISO) methotrexate (ISO) methylmercury chloride (ISO) mono(2-ethylhexyl) phthalate (ISO) N-nitrosodiethylamine (EXP,ISO) N-nitrosodimethylamine (ISO) nefazodone (EXP) nickel atom (ISO) nickel sulfate (ISO) nitroprusside (EXP) omeprazole (EXP) oxaliplatin (EXP) ozone (ISO) paracetamol (ISO) paraquat (ISO) parathion (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) pirinixic acid (EXP,ISO) potassium dichromate (ISO) progesterone (ISO) quercetin (ISO) rotenone (EXP) SB 431542 (ISO) selenium atom (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sodium chloride (EXP) sotorasib (ISO) sunitinib (ISO) tauroursodeoxycholic acid (EXP) testosterone (ISO) testosterone enanthate (ISO) tetrachloroethene (ISO) tetrachloromethane (EXP,ISO) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) trametinib (ISO) trichostatin A (ISO) trimellitic anhydride (ISO) triptonide (ISO) troglitazone (ISO) trovafloxacin (ISO) valproic acid (ISO) venlafaxine hydrochloride (EXP) vinclozolin (EXP) vorinostat (ISO) warfarin (EXP)
Molecular Function
3',5'-cyclic-AMP phosphodiesterase activity (IEA) ATP binding (ISO) ATP diphosphatase activity (IEA) calcium ion binding (ISO,ISS) cyclic-GMP-AMP hydrolase activity (IEA,ISO,ISS) dinucleotide phosphatase activity (IBA,ISO,ISS) exonuclease activity (ISO) GTP diphosphatase activity (IEA) hydrolase activity (IEA) hydrolase activity, acting on ester bonds (IEA) identical protein binding (ISO) insulin receptor binding (ISO) metal ion binding (IEA) nucleic acid binding (IEA) nucleoside triphosphate diphosphatase activity (IEA,ISO,ISS) phosphatase activity (ISO) phosphodiesterase I activity (IBA,IDA,IEA,ISO,ISS) phosphoric diester hydrolase activity (ISO) polysaccharide binding (IEA) protein binding (ISO) protein homodimerization activity (ISO,ISS) pyrophosphatase activity (ISO) scavenger receptor activity (IEA) UTP diphosphatase activity (IEA) zinc ion binding (ISO,ISS)
1.
The expression of ecto-nucleotide pyrophosphatase/phosphodiesterase 1 (E-NPP1) is correlated with astrocytic tumor grade.
Aerts I, etal., Clin Neurol Neurosurg. 2011 Apr;113(3):224-9. doi: 10.1016/j.clineuro.2010.11.018. Epub 2010 Dec 30.
2.
Cyclic AMP-dependent down regulation of ecto-nucleotide pyrophosphatase/phosphodiesterase 1 (NPP1) in rat C6 glioma.
Aerts I, etal., Eur J Pharmacol. 2011 Mar 1;654(1):1-9. doi: 10.1016/j.ejphar.2010.11.031. Epub 2010 Dec 16.
3.
Biochemical analysis of ecto-nucleotide pyrophosphatase phosphodiesterase activity in brain membranes indicates involvement of NPP1 isoenzyme in extracellular hydrolysis of diadenosine polyphosphates in central nervous system.
Asensio AC, etal., Neurochem Int. 2007 Mar;50(4):581-90. Epub 2006 Dec 21.
4.
The ENPP1 Q121 variant predicts major cardiovascular events in high-risk individuals: evidence for interaction with obesity in diabetic patients.
Bacci S, etal., Diabetes. 2011 Mar;60(3):1000-7. Epub 2011 Jan 31.
5.
Structural basis of allotypes of ecto-nucleotide pyrophosphatase/phosphodiesterase (plasma cell membrane glycoprotein PC-1) in the mouse and rat, and analysis of allele-specific xenogeneic antibodies.
Banakh I, etal., Eur J Immunogenet 2002 Aug;29(4):307-13.
6.
Immunolocalization of ecto-nucleotide pyrophosphatase/phosphodiesterase 1 (NPP1) in the rat forebrain.
Bjelobaba I, etal., Brain Res. 2006 Nov 20;1120(1):54-63. Epub 2006 Oct 16.
7.
Generalized arterial calcification of infancy: different clinical courses in two affected siblings.
Cheng KS, etal., Am J Med Genet A. 2005 Jul 15;136(2):210-3.
8.
Expression mapping of ectonucleotide pyrophosphatase/phosphodiesterase 1-3 (E-NPP1-3) in different brain structures during rat development.
Cognato Gde P, etal., Int J Dev Neurosci. 2008 Oct;26(6):593-8. doi: 10.1016/j.ijdevneu.2008.05.001. Epub 2008 May 9.
9.
Inhibition of ectonucleotidase with ARL67156 prevents the development of calcific aortic valve disease in warfarin-treated rats.
Côté N, etal., Eur J Pharmacol. 2012 Aug 15;689(1-3):139-46. doi: 10.1016/j.ejphar.2012.05.016. Epub 2012 May 31.
10.
Genetic mapping and exome sequencing identify 2 mutations associated with stroke protection in pediatric patients with sickle cell anemia.
Flanagan JM, etal., Blood. 2013 Apr 18;121(16):3237-45. doi: 10.1182/blood-2012-10-464156. Epub 2013 Feb 19.
11.
Phosphodiesterase-Ialpha/autotaxin: a counteradhesive protein expressed by oligodendrocytes during onset of myelination.
Fox MA, etal., Mol Cell Neurosci 2003 Jul;23(3):507-19.
12.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
13.
Expression of membrane-bound NPP-type ecto-phosphodiesterases in rat podocytes cultured at normal and high glucose concentrations.
Jankowski M, etal., Biochem Biophys Res Commun. 2011 Dec 9;416(1-2):64-9. doi: 10.1016/j.bbrc.2011.10.144. Epub 2011 Nov 6.
14.
Chondrogenesis mediated by PPi depletion promotes spontaneous aortic calcification in NPP1-/- mice.
Johnson K, etal., Arterioscler Thromb Vasc Biol. 2005 Apr;25(4):686-91. Epub 2004 Dec 29.
15.
Association of the distal region of the ectonucleotide pyrophosphatase/phosphodiesterase 1 gene with type 2 diabetes in an African-American population enriched for nephropathy.
Keene KL, etal., Diabetes. 2008 Apr;57(4):1057-62. Epub 2008 Jan 9.
16.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
17.
Enpp1: a potential facilitator of breast cancer bone metastasis.
Lau WM, etal., PLoS One. 2013 Jul 5;8(7):e66752. doi: 10.1371/journal.pone.0066752. Print 2013.
18.
Autosomal-recessive hypophosphatemic rickets is associated with an inactivation mutation in the ENPP1 gene.
Levy-Litan V, etal., Am J Hum Genet. 2010 Feb 12;86(2):273-8. Epub 2010 Feb 4.
19.
Mutant Enpp1asj mice as a model for generalized arterial calcification of infancy.
Li Q, etal., Dis Model Mech. 2013 Sep;6(5):1227-35. doi: 10.1242/dmm.012765. Epub 2013 Jun 20.
20.
Loss-of-function ENPP1 mutations cause both generalized arterial calcification of infancy and autosomal-recessive hypophosphatemic rickets.
Lorenz-Depiereux B, etal., Am J Hum Genet. 2010 Feb 12;86(2):267-72. Epub 2010 Feb 4.
21.
Variants of ENPP1 are associated with childhood and adult obesity and increase the risk of glucose intolerance and type 2 diabetes.
Meyre D, etal., Nat Genet. 2005 Aug;37(8):863-7. Epub 2005 Jul 17.
22.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
23.
Association of the human NPPS gene with ossification of the posterior longitudinal ligament of the spine (OPLL).
Nakamura I, etal., Hum Genet. 1999 Jun;104(6):492-7.
24.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
25.
Acidosis is a key regulator of osteoblast ecto-nucleotidase pyrophosphatase/phosphodiesterase 1 (NPP1) expression and activity.
Orriss IR, etal., J Cell Physiol. 2015 Dec;230(12):3049-56. doi: 10.1002/jcp.25041.
26.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
27.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
28.
A polymorphism (K121Q) of the human glycoprotein PC-1 gene coding region is strongly associated with insulin resistance.
Pizzuti A, etal., Diabetes. 1999 Sep;48(9):1881-4.
29.
UBXD4, a UBX-containing protein, regulates the cell surface number and stability of alpha3-containing nicotinic acetylcholine receptors.
Rezvani K, etal., J Neurosci. 2009 May 27;29(21):6883-96. doi: 10.1523/JNEUROSCI.4723-08.2009.
30.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
31.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
32.
Comprehensive gene review and curation
RGD comprehensive gene curation
33.
Hypophosphatemia, hyperphosphaturia, and bisphosphonate treatment are associated with survival beyond infancy in generalized arterial calcification of infancy.
Rutsch F, etal., Circ Cardiovasc Genet. 2008 Dec;1(2):133-40.
34.
Mutations in ENPP1 are associated with 'idiopathic' infantile arterial calcification.
Rutsch F, etal., Nat Genet 2003 Aug;34(4):379-81.
35.
No correlation of plasma cell 1 overexpression with insulin resistance in diabetic rats and 3T3-L1 adipocytes.
Sakoda H, etal., Diabetes 1999 Jul;48(7):1365-71.
36.
Insulin resistance and left ventricular hypertrophy in end-stage renal disease: association between the ENPP1 gene and left ventricular concentric remodelling.
Spoto B, etal., Nephrol Dial Transplant. 2012 Feb;27(2):661-6. Epub 2011 May 19.
37.
Differential regulation of the expression of nucleotide pyrophosphatases/phosphodiesterases in rat liver.
Stefan C, etal., Biochim Biophys Acta. 1999 May 6;1450(1):45-52.
38.
The extent of ossification of posterior longitudinal ligament of the spine associated with nucleotide pyrophosphatase gene and leptin receptor gene polymorphisms.
Tahara M, etal., Spine (Phila Pa 1976). 2005 Apr 15;30(8):877-80; discussion 881.
39.
Association and interaction analyses of genetic variants in ADIPOQ, ENPP1, GHSR, PPARgamma and TCF7L2 genes for diabetic nephropathy in a Taiwanese population with type 2 diabetes.
Wu LS, etal., Nephrol Dial Transplant. 2009 Nov;24(11):3360-6. Epub 2009 Jun 8.
40.
Expression of ectonucleotide pyrophosphatase-1 in end-plate chondrocytes with transforming growth factor beta 1 siRNA interference by cyclic mechanical tension.
Xu HG, etal., Chin Med J (Engl). 2013 Oct;126(20):3886-90.
41.
Regulation of insulin receptor function.
Youngren JF Cell Mol Life Sci. 2007 Apr;64(7-8):873-91.
42.
Unilateral anterior crossbite induces aberrant mineral deposition in degenerative temporomandibular cartilage in rats.
Zhang M, etal., Osteoarthritis Cartilage. 2016 May;24(5):921-31. doi: 10.1016/j.joca.2015.12.009. Epub 2015 Dec 31.
Enpp1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 22,518,051 - 22,583,044 (+) NCBI GRCr8 mRatBN7.2 1 20,698,746 - 20,763,741 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 20,698,764 - 20,763,715 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 20,475,435 - 20,539,162 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 26,475,432 - 26,539,171 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 20,675,339 - 20,739,097 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 21,748,201 - 21,813,205 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 21,748,261 - 21,813,371 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 23,228,262 - 23,292,896 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 21,223,678 - 21,287,411 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 21,223,940 - 21,288,766 (+) NCBI Celera 1 19,451,097 - 19,514,516 (+) NCBI Celera Cytogenetic Map 1 p12 NCBI
ENPP1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 131,808,020 - 131,895,155 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 131,808,016 - 131,895,155 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 132,129,160 - 132,216,295 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 132,170,853 - 132,254,043 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 132,170,852 - 132,254,043 NCBI Celera 6 132,876,272 - 132,963,416 (+) NCBI Celera Cytogenetic Map 6 q23.2 NCBI HuRef 6 129,704,724 - 129,791,900 (+) NCBI HuRef CHM1_1 6 132,392,926 - 132,480,050 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 133,002,962 - 133,090,181 (+) NCBI T2T-CHM13v2.0
Enpp1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 24,513,812 - 24,588,057 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 24,513,812 - 24,588,057 (-) Ensembl GRCm39 Ensembl GRCm38 10 24,637,914 - 24,712,159 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 24,637,914 - 24,712,159 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 24,361,217 - 24,431,908 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 24,330,827 - 24,401,518 (-) NCBI MGSCv36 mm8 Celera 10 25,583,320 - 25,641,223 (-) NCBI Celera Cytogenetic Map 10 A4 NCBI cM Map 10 12.26 NCBI
Enpp1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955436 12,415,737 - 12,480,359 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955436 12,416,147 - 12,477,214 (+) NCBI ChiLan1.0 ChiLan1.0
ENPP1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 151,797,817 - 151,882,874 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 149,704,715 - 149,789,744 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 129,591,858 - 129,673,000 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 133,698,904 - 133,783,644 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 133,698,640 - 133,783,644 (+) Ensembl panpan1.1 panPan2
ENPP1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 251,985 - 322,081 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 252,103 - 322,718 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 1,243,885 - 1,317,644 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 44,146 - 117,941 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 48,283 - 118,098 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 93,290 - 167,054 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 38,450 - 112,214 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 209,085 - 282,880 (-) NCBI UU_Cfam_GSD_1.0
Enpp1
ENPP1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 31,722,721 - 31,796,595 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 31,724,290 - 31,796,594 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 35,240,330 - 35,281,377 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ENPP1
Enpp1
.
Predicted Target Of
Count of predictions: 84 Count of miRNA genes: 75 Interacting mature miRNAs: 80 Transcripts: ENSRNOT00000019519 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1578650 Bmd6 Bone mineral density QTL 6 12.2 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 1 509108 43284926 Rat 1354647 Despr8 Despair related QTL 8 0.0000341 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 1 24744506 Rat 1578651 Bmd7 Bone mineral density QTL 7 14.2 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 1 509108 43284926 Rat 2313062 Bmd73 Bone mineral density QTL 73 3.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 11481312 82174945 Rat 1554320 Bmd1 Bone mineral density QTL 1 12.2 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 509108 86060548 Rat 2313065 Bss67 Bone structure and strength QTL 67 3.1 0.0001 tibia area (VT:1000281) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 7421626 Bp360 Blood pressure QTL 360 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 4393289 49393289 Rat 2313070 Bss52 Bone structure and strength QTL 52 4.4 0.0001 body length (VT:0001256) body length (CMO:0000013) 1 1 32356093 Rat 2313069 Bss68 Bone structure and strength QTL 68 2.9 0.0001 tibia size trait (VT:0100001) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 631494 Bp95 Blood pressure QTL 95 40 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 16206210 49268520 Rat 2313075 Bss66 Bone structure and strength QTL 66 3.4 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 11481312 82174945 Rat 5684998 Bss101 Bone structure and strength QTL 101 3.6 tibia strength trait (VT:1000284) tibia ultimate force (CMO:0001734) 1 15431621 49361612 Rat 2298546 Neuinf4 Neuroinflammation QTL 4 5.1 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 1 1 28736750 Rat 5684999 Bss102 Bone structure and strength QTL 102 5.5 7e-07 tibia strength trait (VT:1000284) tibia stiffness (CMO:0001735) 1 15431621 49361612 Rat 1300167 Hrtrt2 Heart rate QTL 2 4.35 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 11481312 75088344 Rat 2313077 Bss69 Bone structure and strength QTL 69 3.5 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 11481312 82174945 Rat 2317755 Glom22 Glomerulus QTL 22 3.8 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 1 11481482 32355910 Rat 1578756 Iddm22 Insulin dependent diabetes mellitus QTL 22 2.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 11835181 56835181 Rat 631508 Sald1 Serum aldosterone level QTL 1 3.7 blood aldosterone amount (VT:0005346) serum aldosterone level (CMO:0000487) 1 9856001 54856001 Rat 2313090 Bmd69 Bone mineral density QTL 69 4.4 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 1 32356093 Rat 4889451 Eae29 Experimental allergic encephalomyelitis QTL 29 5.51 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 1 5925877 24697545 Rat 1558642 Prcr2 Prostate cancer resistance QTL 2 4.3 prostate integrity trait (VT:0010571) area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899) 1 20763158 44095856 Rat 2313092 Bmd72 Bone mineral density QTL 72 2.5 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 11481312 82174945 Rat 2313097 Bss70 Bone structure and strength QTL 70 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 738020 Pia8 Pristane induced arthritis QTL 8 4.7 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 1 65833076 Rat 1600360 Mcs16 Mammary carcinoma susceptibility QTL 16 2.4 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 2244390 43433040 Rat 1578669 Bss9 Bone structure and strength QTL 9 6.3 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 1 509108 43284926 Rat 2302038 Pia31 Pristane induced arthritis QTL 31 5.5 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111) 1 10992065 55992065 Rat 634353 Rends2 Renal damage susceptibility QTL 2 0.05 kidney blood vessel morphology trait (VT:0000530) organ lesion measurement (CMO:0000677) 1 19333571 56983283 Rat 2313053 Bss51 Bone structure and strength QTL 51 3.8 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 1 32356093 Rat
D1Rat153
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 20,704,398 - 20,704,605 (+) MAPPER mRatBN7.2 Rnor_6.0 1 21,753,867 - 21,754,073 NCBI Rnor6.0 Rnor_5.0 1 23,233,912 - 23,234,118 UniSTS Rnor5.0 RGSC_v3.4 1 21,229,308 - 21,229,515 RGD RGSC3.4 RGSC_v3.4 1 21,229,309 - 21,229,515 UniSTS RGSC3.4 RGSC_v3.1 1 21,230,688 - 21,230,894 RGD Celera 1 19,456,728 - 19,456,934 UniSTS RH 3.4 Map 1 199.8 RGD RH 3.4 Map 1 199.8 UniSTS RH 2.0 Map 1 126.9 RGD FHH x ACI Map 1 18.0099 RGD Cytogenetic Map 1 p12 UniSTS
AU048957
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 1 22,580,388 - 22,580,540 (+) Marker Load Pipeline mRatBN7.2 1 20,761,085 - 20,761,237 (+) MAPPER mRatBN7.2 Rnor_6.0 1 21,810,550 - 21,810,701 NCBI Rnor6.0 Rnor_5.0 1 23,290,241 - 23,290,392 UniSTS Rnor5.0 RGSC_v3.4 1 21,285,992 - 21,286,143 UniSTS RGSC3.4 Celera 1 19,513,099 - 19,513,248 UniSTS Cytogenetic Map 1 p12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000019519 ⟹ ENSRNOP00000019519
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 20,698,764 - 20,763,715 (+) Ensembl Rnor_6.0 Ensembl 1 21,748,261 - 21,813,371 (+) Ensembl
RefSeq Acc Id:
NM_053535 ⟹ NP_445987
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 22,518,069 - 22,583,044 (+) NCBI mRatBN7.2 1 20,698,764 - 20,763,741 (+) NCBI Rnor_6.0 1 21,748,236 - 21,811,969 (+) NCBI Rnor_5.0 1 23,228,262 - 23,292,896 (+) NCBI RGSC_v3.4 1 21,223,678 - 21,287,411 (+) RGD Celera 1 19,451,097 - 19,514,516 (+) RGD
Sequence:
ATGGAGCGCGACGGCGAACAGGCAGGGCAAGGGCCCCGGCATGGGCCAGCGGGAAACGGCCGCGAGCTGGAGTCTCCAGCCGCCGCTTCGCTGCTGGCGCCCATGGACCTAGGGGAGGAGCCGCTGGA
hide sequence
RefSeq Acc Id:
XM_006227692 ⟹ XP_006227754
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 22,518,051 - 22,583,044 (+) NCBI mRatBN7.2 1 20,698,746 - 20,763,741 (+) NCBI Rnor_6.0 1 21,748,201 - 21,813,205 (+) NCBI Rnor_5.0 1 23,228,262 - 23,292,896 (+) NCBI
Sequence:
TATTAAAGCTCGGCCGGCGGGGGCAGAGCGGGGCGATGGAGCGCGACGGCGAACAGGCAGGGCA
hide sequence
RefSeq Acc Id:
XM_039092963 ⟹ XP_038948891
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 22,557,702 - 22,583,044 (+) NCBI mRatBN7.2 1 20,738,390 - 20,763,741 (+) NCBI
RefSeq Acc Id:
NP_445987 ⟸ NM_053535
- UniProtKB:
Q924C3 (UniProtKB/Swiss-Prot), Q920C8 (UniProtKB/Swiss-Prot), Q91XQ3 (UniProtKB/Swiss-Prot), G3V7V4 (UniProtKB/TrEMBL), A6JUK6 (UniProtKB/TrEMBL)
- Sequence:
MERDGEQAGQGPRHGPAGNGRELESPAAASLLAPMDLGEEPLEKAERARTAKDPNTYKVLSLVLSVCVLTTILGCIFGLKPSCAKEVKSCKGRCFERTFSNCRCDAACVSLGNCCLDFQETCVEPTHI
hide sequence
RefSeq Acc Id:
XP_006227754 ⟸ XM_006227692
- Peptide Label:
isoform X1
- UniProtKB:
Q924C3 (UniProtKB/Swiss-Prot), Q920C8 (UniProtKB/Swiss-Prot), Q91XQ3 (UniProtKB/Swiss-Prot)
- Sequence:
MERDGEQAGQGPRHGPAGNGRELESPAAASLLAPMDLGEEPLEKAERARTAKDPNTYKVLSLVL
hide sequence
Ensembl Acc Id:
ENSRNOP00000019519 ⟸ ENSRNOT00000019519
RefSeq Acc Id:
XP_038948891 ⟸ XM_039092963
- Peptide Label:
isoform X2
- UniProtKB:
A6JUK7 (UniProtKB/TrEMBL)
RGD ID: 13689527 Promoter ID: EPDNEW_R51 Type: single initiation site Name: Enpp1_1 Description: ectonucleotide pyrophosphatase/phosphodiesterase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 21,748,230 - 21,748,290 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Enpp1
ectonucleotide pyrophosphatase/phosphodiesterase 1
Symbol and Name status set to approved
1299863 APPROVED
2003-02-27
Enpp1
ectonucleotide pyrophosphatase/phosphodiesterase 1
Symbol and Name status set to provisional
70820 PROVISIONAL
