Symbol:
Il3ra
Name:
interleukin 3 receptor subunit alpha
RGD ID:
628728
Description:
Predicted to enable cytokine binding activity and interleukin-3 receptor activity. Predicted to be involved in cytokine-mediated signaling pathway and positive regulation of cell population proliferation. Predicted to act upstream of or within interleukin-3-mediated signaling pathway. Predicted to be part of receptor complex. Predicted to be active in external side of plasma membrane. Orthologous to human IL3RA (interleukin 3 receptor subunit alpha); PARTICIPATES IN interleukin-3 signaling pathway; apoptotic cell death pathway; cytokine mediated signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol; acetamide.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Cyrl; cytokine receptor-like protein CYRL; interleukin 3 receptor, alpha; interleukin 3 receptor, alpha chain; interleukin-3 receptor subunit alpha
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
IL3RA (interleukin 3 receptor subunit alpha) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, OMA, OrthoDB, OrthoMCL, PhylomeDB, Treefam
Mus musculus (house mouse):
Il3ra (interleukin 3 receptor, alpha chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Il3ra (interleukin 3 receptor subunit alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
IL3RA (interleukin 3 receptor subunit alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Il3ra (interleukin 3 receptor subunit alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
IL3RA (interleukin 3 receptor subunit alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
IL3RA (interleukin 3 receptor subunit alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Il3ra (interleukin 3 receptor subunit alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
IL13RA2 (interleukin 13 receptor subunit alpha 2) HGNC
Panther
Homo sapiens (human):
CSF2RA (colony stimulating factor 2 receptor subunit alpha) HGNC
OrthoDB
Homo sapiens (human):
ASMT (acetylserotonin O-methyltransferase) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
IL3RA (interleukin 3 receptor subunit alpha)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Il3ra (interleukin 3 receptor, alpha chain)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 21,431,848 - 21,437,336 (-) NCBI GRCr8 mRatBN7.2 12 16,318,081 - 16,323,781 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 16,318,081 - 16,323,484 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 17,135,140 - 17,140,539 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 17,758,865 - 17,764,264 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 16,821,662 - 16,827,061 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 18,534,762 - 18,542,508 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 18,534,767 - 18,540,166 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 20,519,720 - 20,527,317 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 16,825,702 - 16,830,035 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 16,855,630 - 16,859,963 (-) NCBI Celera 12 18,067,830 - 18,073,220 (-) NCBI Celera Cytogenetic Map 12 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Il3ra Rat (1->4)-beta-D-glucan multiple interactions ISO Il3ra (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of IL3RA mRNA CTD PMID:36331819 Il3ra Rat (S)-nicotine decreases expression ISO IL3RA (Homo sapiens) 6480464 Nicotine results in decreased expression of IL3RA mRNA CTD PMID:18247414 Il3ra Rat 1,2-dimethylhydrazine increases expression ISO Il3ra (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of IL3RA mRNA CTD PMID:22206623 Il3ra Rat 17alpha-ethynylestradiol increases expression ISO Il3ra (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of IL3RA mRNA CTD PMID:17555576 Il3ra Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Il3ra (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Lipopolysaccharides] results in decreased methylation of IL3RA gene CTD PMID:21212295 Il3ra Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of IL3RA mRNA CTD PMID:32109520 more ... Il3ra Rat 2,3,7,8-tetrachlorodibenzodioxine decreases methylation ISO Il3ra (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased methylation of IL3RA gene CTD PMID:21212295 Il3ra Rat 2-naphthylamine decreases expression ISO IL3RA (Homo sapiens) 6480464 2-Naphthylamine results in decreased expression of IL3RA mRNA CTD PMID:18247414 Il3ra Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of IL3RA mRNA CTD PMID:36041667 Il3ra Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of IL3RA mRNA CTD PMID:31881176 Il3ra Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of IL3RA mRNA CTD PMID:16483693 Il3ra Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of IL3RA mRNA CTD PMID:30779732 Il3ra Rat antimycin A decreases expression ISO IL3RA (Homo sapiens) 6480464 Antimycin A results in decreased expression of IL3RA mRNA CTD PMID:33770205 Il3ra Rat aristolochic acid A increases expression ISO IL3RA (Homo sapiens) 6480464 aristolochic acid I results in increased expression of IL3RA mRNA CTD PMID:33212167 Il3ra Rat arsenous acid decreases expression ISO IL3RA (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of IL3RA mRNA and Arsenic Trioxide results in decreased expression of IL3RA protein CTD PMID:24791595 Il3ra Rat arsenous acid multiple interactions ISO IL3RA (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to IL3RA protein] CTD PMID:26598702 Il3ra Rat Azoxymethane multiple interactions ISO Il3ra (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of IL3RA mRNA CTD PMID:29950665 Il3ra Rat benzene increases expression ISO Il3ra (Mus musculus) 6480464 Benzene results in increased expression of IL3RA protein CTD PMID:27339418 Il3ra Rat benzene multiple interactions ISO Il3ra (Mus musculus) 6480464 [Formaldehyde co-treated with Benzene] results in increased expression of IL3RA protein CTD PMID:27339418 Il3ra Rat benzo[a]pyrene decreases expression ISO IL3RA (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of IL3RA mRNA CTD PMID:18247414 Il3ra Rat bis(2-ethylhexyl) phthalate decreases expression ISO IL3RA (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of IL3RA mRNA CTD PMID:31163220 Il3ra Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of IL3RA mRNA CTD PMID:25181051 Il3ra Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of IL3RA mRNA CTD PMID:36041667 Il3ra Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of IL3RA mRNA CTD PMID:32145629 Il3ra Rat bisphenol A decreases expression ISO Il3ra (Mus musculus) 6480464 bisphenol A results in decreased expression of IL3RA mRNA CTD PMID:30245210 Il3ra Rat bisphenol F decreases expression ISO Il3ra (Mus musculus) 6480464 bisphenol F results in decreased expression of IL3RA mRNA CTD PMID:38685157 Il3ra Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of IL3RA mRNA CTD PMID:36041667 Il3ra Rat butanal increases expression ISO IL3RA (Homo sapiens) 6480464 butyraldehyde results in increased expression of IL3RA mRNA CTD PMID:26079696 Il3ra Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of IL3RA mRNA CTD PMID:33453195 Il3ra Rat cadmium dichloride decreases expression ISO IL3RA (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of IL3RA mRNA CTD PMID:33770205 Il3ra Rat carbon nanotube affects expression ISO Il3ra (Mus musculus) 6480464 Nanotubes and Carbon affects the expression of IL3RA mRNA CTD PMID:25554681 Il3ra Rat carbon nanotube increases expression ISO Il3ra (Mus musculus) 6480464 Nanotubes and Carbon analog results in increased expression of IL3RA mRNA CTD PMID:25554681 Il3ra Rat CGP 52608 multiple interactions ISO IL3RA (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to IL3RA gene] CTD PMID:28238834 Il3ra Rat chlorpyrifos increases expression ISO Il3ra (Mus musculus) 6480464 Chlorpyrifos results in increased expression of IL3RA mRNA CTD PMID:37019170 Il3ra Rat cisplatin multiple interactions ISO IL3RA (Homo sapiens) 6480464 [Cisplatin co-treated with panobinostat] affects the expression of IL3RA mRNA CTD PMID:21791302 Il3ra Rat copper atom multiple interactions ISO IL3RA (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of IL3RA mRNA CTD PMID:30911355 Il3ra Rat copper(0) multiple interactions ISO IL3RA (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of IL3RA mRNA CTD PMID:30911355 Il3ra Rat D-penicillamine increases expression EXP 6480464 Penicillamine results in increased expression of IL3RA mRNA CTD PMID:19575532 Il3ra Rat dextran sulfate multiple interactions ISO Il3ra (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of IL3RA mRNA CTD PMID:29950665 Il3ra Rat diarsenic trioxide decreases expression ISO IL3RA (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of IL3RA mRNA and Arsenic Trioxide results in decreased expression of IL3RA protein CTD PMID:24791595 Il3ra Rat diarsenic trioxide multiple interactions ISO IL3RA (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to IL3RA protein] CTD PMID:26598702 Il3ra Rat dioxygen multiple interactions ISO Il3ra (Mus musculus) 6480464 [sulforaphane affects the susceptibility to Oxygen] which affects the expression of IL3RA mRNA CTD PMID:30529165 Il3ra Rat disodium selenite increases expression ISO IL3RA (Homo sapiens) 6480464 Sodium Selenite results in increased expression of IL3RA mRNA CTD PMID:18175754 Il3ra Rat formaldehyde increases expression ISO Il3ra (Mus musculus) 6480464 Formaldehyde results in increased expression of IL3RA protein CTD PMID:27339418 Il3ra Rat formaldehyde multiple interactions ISO Il3ra (Mus musculus) 6480464 [Formaldehyde co-treated with Benzene] results in increased expression of IL3RA protein CTD PMID:27339418 Il3ra Rat furan increases methylation EXP 6480464 furan results in increased methylation of IL3RA gene CTD PMID:22079235 Il3ra Rat hydroquinone O-beta-D-glucopyranoside increases expression ISO IL3RA (Homo sapiens) 6480464 Arbutin results in increased expression of IL3RA mRNA CTD PMID:17103032 Il3ra Rat lipopolysaccharide multiple interactions ISO Il3ra (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Lipopolysaccharides] results in decreased methylation of IL3RA gene CTD PMID:21212295 Il3ra Rat MeIQx increases expression ISO IL3RA (Homo sapiens) 6480464 2-amino-3 more ... CTD PMID:20816883 Il3ra Rat mercury atom decreases expression ISO IL3RA (Homo sapiens) 6480464 Mercury results in decreased expression of IL3RA mRNA CTD PMID:16823088 Il3ra Rat mercury(0) decreases expression ISO IL3RA (Homo sapiens) 6480464 Mercury results in decreased expression of IL3RA mRNA CTD PMID:16823088 Il3ra Rat nicotine decreases expression ISO IL3RA (Homo sapiens) 6480464 Nicotine results in decreased expression of IL3RA mRNA CTD PMID:18247414 Il3ra Rat panobinostat increases expression ISO IL3RA (Homo sapiens) 6480464 Panobinostat results in increased expression of IL3RA mRNA CTD PMID:33770205 Il3ra Rat panobinostat multiple interactions ISO IL3RA (Homo sapiens) 6480464 [Cisplatin co-treated with panobinostat] affects the expression of IL3RA mRNA CTD PMID:21791302 Il3ra Rat paracetamol affects expression ISO Il3ra (Mus musculus) 6480464 Acetaminophen affects the expression of IL3RA mRNA CTD PMID:17562736 Il3ra Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of IL3RA mRNA CTD PMID:33387578 Il3ra Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Il3ra (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of IL3RA mRNA CTD PMID:36331819 Il3ra Rat rotenone decreases expression ISO IL3RA (Homo sapiens) 6480464 Rotenone results in decreased expression of IL3RA mRNA CTD PMID:29955902 Il3ra Rat Soman increases expression EXP 6480464 Soman results in increased expression of IL3RA mRNA CTD PMID:19281266 Il3ra Rat sulforaphane multiple interactions ISO Il3ra (Mus musculus) 6480464 [sulforaphane affects the susceptibility to Oxygen] which affects the expression of IL3RA mRNA CTD PMID:30529165 Il3ra Rat tacedinaline increases expression ISO IL3RA (Homo sapiens) 6480464 tacedinaline results in increased expression of IL3RA mRNA CTD PMID:33770205 Il3ra Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of IL3RA mRNA CTD PMID:23411599 Il3ra Rat titanium dioxide multiple interactions ISO Il3ra (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of IL3RA mRNA CTD PMID:29950665 Il3ra Rat tributylstannane increases expression ISO Il3ra (Mus musculus) 6480464 tributyltin results in increased expression of IL3RA mRNA CTD PMID:31939706 Il3ra Rat trichloroethene multiple interactions ISO Il3ra (Mus musculus) 6480464 PPARA protein inhibits the reaction [Trichloroethylene results in increased expression of IL3RA protein] CTD PMID:15363585 Il3ra Rat trichloroethene increases expression ISO Il3ra (Mus musculus) 6480464 Trichloroethylene results in increased expression of IL3RA mRNA CTD PMID:15363585 Il3ra Rat triphenyl phosphate affects expression ISO IL3RA (Homo sapiens) 6480464 triphenyl phosphate affects the expression of IL3RA mRNA CTD PMID:37042841 Il3ra Rat urethane increases expression ISO IL3RA (Homo sapiens) 6480464 Urethane results in increased expression of IL3RA mRNA CTD PMID:28818685 Il3ra Rat zidovudine multiple interactions ISO Il3ra (Mus musculus) 6480464 [IL3 protein co-treated with CSF2 protein] inhibits the reaction [Zidovudine results in decreased expression of IL3RA mRNA] CTD PMID:12084393 Il3ra Rat zidovudine decreases expression ISO Il3ra (Mus musculus) 6480464 Zidovudine results in decreased expression of IL3RA mRNA CTD PMID:12084393
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(1->4)-beta-D-glucan (ISO) (S)-nicotine (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-naphthylamine (ISO) 4,4'-sulfonyldiphenol (EXP) acetamide (EXP) ammonium chloride (EXP) amphetamine (EXP) antimycin A (ISO) aristolochic acid A (ISO) arsenous acid (ISO) Azoxymethane (ISO) benzene (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP,ISO) butanal (ISO) cadmium dichloride (EXP,ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) cisplatin (ISO) copper atom (ISO) copper(0) (ISO) D-penicillamine (EXP) dextran sulfate (ISO) diarsenic trioxide (ISO) dioxygen (ISO) disodium selenite (ISO) formaldehyde (ISO) furan (EXP) hydroquinone O-beta-D-glucopyranoside (ISO) lipopolysaccharide (ISO) MeIQx (ISO) mercury atom (ISO) mercury(0) (ISO) nicotine (ISO) panobinostat (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) rotenone (ISO) Soman (EXP) sulforaphane (ISO) tacedinaline (ISO) thioacetamide (EXP) titanium dioxide (ISO) tributylstannane (ISO) trichloroethene (ISO) triphenyl phosphate (ISO) urethane (ISO) zidovudine (ISO)
Il3ra Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 21,431,848 - 21,437,336 (-) NCBI GRCr8 mRatBN7.2 12 16,318,081 - 16,323,781 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 16,318,081 - 16,323,484 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 17,135,140 - 17,140,539 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 17,758,865 - 17,764,264 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 16,821,662 - 16,827,061 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 18,534,762 - 18,542,508 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 18,534,767 - 18,540,166 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 20,519,720 - 20,527,317 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 16,825,702 - 16,830,035 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 16,855,630 - 16,859,963 (-) NCBI Celera 12 18,067,830 - 18,073,220 (-) NCBI Celera Cytogenetic Map 12 q11 NCBI
IL3RA Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 1,336,785 - 1,382,689 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38 Y 1,336,785 - 1,382,689 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl Y 1,336,616 - 1,382,689 (+) Ensembl GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 1,336,616 - 1,382,689 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 1,455,678 - 1,501,582 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 GRCh37 Y 1,405,678 - 1,451,582 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 Y 1,415,509 - 1,461,582 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 36 X 1,415,509 - 1,461,582 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 Y 1,499,187 - 1,545,408 NCBI Celera X 5,763,883 - 5,782,916 (+) NCBI Celera Cytogenetic Map X ;Y NCBI CHM1_1 X 1,486,100 - 1,532,170 (+) NCBI CHM1_1 T2T-CHM13v2.0 Y 1,201,550 - 1,246,464 (+) NCBI T2T-CHM13v2.0 T2T-CHM13v2.0 X 1,187,106 - 1,226,335 (+) NCBI T2T-CHM13v2.0
Il3ra Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 8,114,270 - 8,123,851 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 8,113,752 - 8,123,488 (-) Ensembl GRCm39 Ensembl GRCm38 14 14,345,912 - 14,355,493 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 14,346,275 - 14,356,011 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 15,179,009 - 15,188,004 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 13,139,762 - 13,148,757 (+) NCBI MGSCv36 mm8 Celera 14 10,023,172 - 10,032,166 (+) NCBI Celera Cytogenetic Map 14 A1 NCBI cM Map 14 7.08 NCBI
Il3ra Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955499 1,004,432 - 1,011,950 (+) NCBI ChiLan1.0 ChiLan1.0
IL3RA Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 X 894,590 - 912,213 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl X 894,552 - 911,556 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha X 835,696 - 852,616 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 X 805,892 - 822,821 (+) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 X 797,886 - 814,855 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 X 814,528 - 831,515 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 X 850,504 - 867,235 (+) NCBI UU_Cfam_GSD_1.0
Il3ra Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404953 572,452 - 578,962 (+) NCBI HiC_Itri_2
IL3RA No map positions available.
IL3RA Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Vero_WHO_p1.0 NW_023666056 1,314,792 - 1,364,886 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Il3ra
.
Predicted Target Of
Count of predictions: 75 Count of miRNA genes: 67 Interacting mature miRNAs: 70 Transcripts: ENSRNOT00000001792 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
61443 Btemp2 Thermal response to stress QTL 2 3.3 0.000094 body temperature trait (VT:0005535) core body temperature (CMO:0001036) 12 15025183 20794014 Rat 8552964 Pigfal17 Plasma insulin-like growth factor 1 level QTL 17 3.5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 9590147 Scort7 Serum corticosterone level QTL 7 13.61 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 12 1 42110980 Rat 1549829 Scl48 Serum cholesterol level QTL 48 5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 12 9603277 46669029 Rat 61331 Eau2 Experimental allergic uveoretinitis QTL 2 0.0005 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 12 8525423 28064601 Rat 2293684 Bmd26 Bone mineral density QTL 26 4.4 0.0002 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 12 15872653 32974238 Rat 6893681 Bw109 Body weight QTL 109 2.3 0.004 body mass (VT:0001259) body weight (CMO:0000012) 12 1 23297788 Rat 1302792 Scl21 Serum cholesterol level QTL 21 3.8 0.0011 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 12 7196730 46669029 Rat 1598855 Bp294 Blood pressure QTL 294 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 1 34851688 Rat 1600391 Edcs2 Endometrial carcinoma susceptibility QTL2 3.5 0.01 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 12 6833190 17870186 Rat 10755457 Coatc14 Coat color QTL 14 0.01759 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 12 1 22591684 Rat 1331761 Bp218 Blood pressure QTL 218 2.973 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 45055165 Rat 8694179 Bw150 Body weight QTL 150 2.9 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7411545 Bw128 Body weight QTL 128 5.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7411547 Bw129 Body weight QTL 129 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 5564495 46669029 Rat 1300157 Rf21 Renal function QTL 21 4.4 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 12 9318216 32103380 Rat 737979 Pia22 Pristane induced arthritis QTL 22 53.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 1 44465750 Rat 2300186 Bmd59 Bone mineral density QTL 59 7.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 12 10474137 46669029 Rat 7411660 Foco28 Food consumption QTL 28 10.9 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 1331755 Bp219 Blood pressure QTL 219 3.041 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 28064557 Rat 2312418 Kidm41 Kidney mass QTL 41 3.7 0.0001 kidney mass (VT:0002707) single kidney wet weight to body weight ratio (CMO:0000622) 12 1 19611090 Rat 7411641 Foco19 Food consumption QTL 19 27.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 1549912 Bp268 Blood pressure QTL 268 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 13182736 46669029 Rat 2302060 Pia37 Pristane induced arthritis QTL 37 6.1 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 13198157 46669029 Rat 1641928 Alcrsp5 Alcohol response QTL 5 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 12 12812385 46669029 Rat 8552912 Pigfal6 Plasma insulin-like growth factor 1 level QTL 6 5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564498 46669029 Rat 10059594 Kidm46 Kidney mass QTL 46 3.79 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 12 6107579 46669029 Rat 1581516 Cm56 Cardiac mass QTL 56 4.2 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 12 1 29333307 Rat 9590086 Insglur6 Insulin/glucose ratio QTL 6 18.97 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 12 1 42110980 Rat 8552918 Pigfal7 Plasma insulin-like growth factor 1 level QTL 7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 1549902 Bp269 Blood pressure QTL 269 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 13182736 46669029 Rat 61404 Bw120 Body weight QTL 120 5.1 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 12 12351619 46669029 Rat 1331786 Kidm11 Kidney mass QTL 11 3.571 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 12 11073825 24234895 Rat 2293699 Bss49 Bone structure and strength QTL 49 5.61 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 12 10474137 46669029 Rat 634351 Apr5 Acute phase response QTL 5 6.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 12 1 44503507 Rat 634350 Apr4 Acute phase response QTL 4 6 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 1172005 46172005 Rat 61416 Pia4 Pristane induced arthritis QTL 4 8.4 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 12 13635523 30827399 Rat 7204484 Bp358 Blood pressure QTL 358 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 13008296 19212979 Rat 7387292 Kidm42 Kidney mass QTL 42 3.03 0.0004 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 12 1 36247923 Rat 61421 Cia12 Collagen induced arthritis QTL 12 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 13635523 35682913 Rat 2303569 Gluco44 Glucose level QTL 44 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 12812385 46669029 Rat 7411586 Foco5 Food consumption QTL 5 5.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 2303575 Insul14 Insulin level QTL 14 4 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 12 1 42450532 Rat 7411588 Foco6 Food consumption QTL 6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2302042 Pia38 Pristane induced arthritis QTL 38 3.5 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 1 44503507 Rat 7411595 Foco9 Food consumption QTL 9 4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 7411597 Foco10 Food consumption QTL 10 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2293086 Iddm30 Insulin dependent diabetes mellitus QTL 30 3.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 8449490 28302290 Rat 631543 Bp83 Blood pressure QTL 83 5.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 15550826 38478808 Rat
RH128686
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 16,317,924 - 16,318,074 (+) MAPPER mRatBN7.2 Rnor_6.0 12 18,534,606 - 18,534,755 NCBI Rnor6.0 Rnor_5.0 12 20,519,560 - 20,519,709 UniSTS Rnor5.0 RGSC_v3.4 12 16,825,542 - 16,825,691 UniSTS RGSC3.4 Celera 12 18,067,674 - 18,067,823 UniSTS RH 3.4 Map 12 256.3 UniSTS Cytogenetic Map 12 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000001792 ⟹ ENSRNOP00000001792
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 16,318,081 - 16,323,484 (-) Ensembl Rnor_6.0 Ensembl 12 18,534,767 - 18,540,166 (-) Ensembl
RefSeq Acc Id:
NM_139260 ⟹ NP_640353
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 21,431,848 - 21,437,250 (-) NCBI mRatBN7.2 12 16,318,081 - 16,323,484 (-) NCBI Rnor_6.0 12 18,534,762 - 18,540,166 (-) NCBI Rnor_5.0 12 20,519,720 - 20,527,317 (-) NCBI RGSC_v3.4 12 16,825,702 - 16,830,035 (-) RGD Celera 12 18,067,830 - 18,073,220 (-) NCBI
Sequence:
GTCTGTGGACTCTGCTGGGGTCGGCAGAGAGCGAGCGAGGTCCGTGCGTGGATTTGGGGTCCGGGATCAGGCGGTGGTCACTCTGTGTCTCAGGGAACACTGAGAGCAGGAACGGAAGATAACAGCCC
hide sequence
RefSeq Acc Id:
XM_006248989 ⟹ XP_006249051
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 21,431,848 - 21,437,292 (-) NCBI mRatBN7.2 12 16,318,081 - 16,323,776 (-) NCBI Rnor_6.0 12 18,534,762 - 18,542,508 (-) NCBI Rnor_5.0 12 20,519,720 - 20,527,317 (-) NCBI
Sequence:
CTAAAAAATTCTTCAAATTTTTTCTGAATCATTTTGTGTCTATTATATTCAGAATTATTTTCCTGCACCTATAGCCCTGTAGTTGTCCTGCACTTGTAGAACTGCACCTACCCTGCACCTGAATCCTT
hide sequence
RefSeq Acc Id:
XR_005491596
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 21,431,848 - 21,437,336 (-) NCBI mRatBN7.2 12 16,318,081 - 16,323,781 (-) NCBI
RefSeq Acc Id:
NP_640353 ⟸ NM_139260
- Peptide Label:
precursor
- UniProtKB:
E9PSX4 (UniProtKB/TrEMBL)
- Sequence:
MAAGVWLLLSVTMFEAMSERGVHMEAPPLTPPIRNLSIDPAQRRLTWEWGGGGTRAEGGALGPRFLCRKEGRDPVRADPAGHSCSFPALSHCHVTNFTVFPEGQEKDAAHLCFQPRDPNRAAAARNLH
hide sequence
RefSeq Acc Id:
XP_006249051 ⟸ XM_006248989
- Peptide Label:
isoform X1
- UniProtKB:
E9PSX4 (UniProtKB/TrEMBL)
- Sequence:
MAAGVWLLLSVTMFEAMSERGVHMEAPPLTPPIRNLSIDPAQRRLTWEWGGGGTRAEGGALGPR
hide sequence
Ensembl Acc Id:
ENSRNOP00000001792 ⟸ ENSRNOT00000001792
RGD ID: 13698487 Promoter ID: EPDNEW_R9011 Type: initiation region Name: Il3ra_1 Description: interleukin 3 receptor subunit alpha SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 12 18,540,169 - 18,540,229 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-02
Il3ra
interleukin 3 receptor subunit alpha
Il3ra
interleukin 3 receptor, alpha
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-11-06
Il3ra
interleukin 3 receptor, alpha
Il3ra
interleukin 3 receptor, alpha chain
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
Il3ra
interleukin 3 receptor, alpha chain
Cyrl
cytokine receptor-like protein CYRL
Symbol and Name updated
1299863 APPROVED
2003-02-27
Cyrl
cytokine receptor-like protein CYRL
Symbol and Name status set to provisional
70820 PROVISIONAL
