Advanced Search (OLGA)

Gene: Gbx2 (gastrulation brain homeobox 2) Rattus norvegicus

Analyze

Symbol:

Gbx2

Name:

gastrulation brain homeobox 2

RGD ID:

621866

Description:

Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific; RNA polymerase II core promoter sequence-specific DNA binding activity; and RNA polymerase II-specific DNA-binding transcription factor binding activity. Predicted to be involved in regulation of nervous system development and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within several processes, including branching involved in blood vessel morphogenesis; nervous system development; and neural crest cell migration. Predicted to be active in nucleus. Orthologous to human GBX2 (gastrulation brain homeobox 2); INTERACTS WITH 2,3,7,8-Tetrachlorodibenzofuran; 6-propyl-2-thiouracil; all-trans-retinoic acid.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

homeobox protein GBX-2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GBX2 (gastrulation brain homeobox 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Gbx2 (gastrulation brain homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gbx2 (gastrulation brain homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GBX2 (gastrulation brain homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GBX2 (gastrulation brain homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gbx2 (gastrulation brain homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GBX2 (gastrulation brain homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GBX2 (gastrulation brain homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gbx2 (gastrulation brain homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Gbx2 (gastrulation brain homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	NHLRC2 (NHL repeat containing 2)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	GBX2 (gastrulation brain homeobox 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gbx2 (gastrulation brain homeobox 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gbx2 (gastrulation brain homeobox 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gbx2 (gastrulation brain homeobox 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	unpg	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	unpg	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gbx2.2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gbx2.1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	97,957,304 - 97,959,883 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	9	97,957,304 - 97,959,883 (-)	Ensembl				GRCr8
mRatBN7.2	9	90,509,633 - 90,512,212 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	90,509,633 - 90,512,212 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	9	98,936,286 - 98,938,865 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	104,072,186 - 104,074,765 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	102,437,722 - 102,440,301 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	97,063,265 - 97,065,855 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	97,063,728 - 97,065,817 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	9	96,754,122 - 96,756,543 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	9	89,034,340 - 89,037,102 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	9	88,058,118 - 88,060,697 (-)	NCBI		Celera
RGSC_v3.1	9	89,239,950 - 89,240,065 (-)	NCBI
Cytogenetic Map	9	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

amyotrophic lateral sclerosis type 1 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

3,3',5,5'-tetrabromobisphenol A (ISO)

6-propyl-2-thiouracil (EXP)

acetaldehyde (ISO)

acetic acid (ISO)

all-trans-retinoic acid (EXP,ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

bromochloroacetic acid (ISO)

butanal (ISO)

C60 fullerene (EXP)

choline (ISO)

cisplatin (ISO)

decabromodiphenyl ether (EXP)

dimethylarsinic acid (EXP)

disodium selenite (ISO)

dorsomorphin (ISO)

entinostat (ISO)

fenarimol (EXP)

flusilazole (EXP,ISO)

folic acid (ISO)

geraniol (ISO)

hexaconazole (ISO)

L-methionine (ISO)

lead diacetate (ISO)

leflunomide (ISO)

Licochalcone B (ISO)

methimazole (EXP)

methylmercury chloride (ISO)

panobinostat (ISO)

paracetamol (EXP,ISO)

pentanal (ISO)

phenobarbital (ISO)

propanal (ISO)

propiconazole (EXP)

Ptaquiloside (ISO)

resveratrol (ISO)

SB 431542 (ISO)

titanium dioxide (ISO)

triadimefon (EXP,ISO)

tributylstannane (EXP)

trichostatin A (ISO)

triptonide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

autonomic nervous system development (ISO)

axon guidance (ISO)

branching involved in blood vessel morphogenesis (ISO)

cerebellar granule cell precursor proliferation (ISO)

cerebellum development (ISO)

DNA-templated transcription (IEA)

forebrain neuron development (ISO)

hindbrain development (ISO)

inner ear morphogenesis (ISO)

midbrain-hindbrain boundary development (ISO)

midbrain-hindbrain boundary morphogenesis (ISO)

neural crest cell migration (ISO)

positive regulation of transcription by RNA polymerase II (ISO)

regulation of DNA-templated transcription (IEA)

regulation of nervous system development (IBA)

regulation of transcription by RNA polymerase II (IBA)

rhombomere 2 development (ISO)

thalamus development (ISO)

tube morphogenesis (ISO)

Cellular Component

nucleus (IBA,IEA,ISO)

Molecular Function

DNA binding (IEA)

DNA-binding transcription activator activity, RNA polymerase II-specific (IEA,ISO)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,IEA)

RNA polymerase II core promoter sequence-specific DNA binding (IEA,ISO)

RNA polymerase II transcription regulatory region sequence-specific DNA binding (IBA,IEA,ISO)

RNA polymerase II-specific DNA-binding transcription factor binding (IEA,ISO)

sequence-specific double-stranded DNA binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	The homeobox gene GBX2, a target of the myb oncogene, mediates autocrine growth and monocyte differentiation.	Kowenz-Leutz E, etal., Cell 1997 Oct 17;91(2):185-95.
4.	Changing requirements for Gbx2 in development of the cerebellum and maintenance of the mid/hindbrain organizer.	Li JY, etal., Neuron 2002 Sep 26;36(1):31-43.
5.	Characterization and sequence analysis of the human homeobox-containing gene GBX2.	Lin X, etal., Genomics 1996 Feb 1;31(3):335-42.
6.	Regulation and function of FGF8 in patterning of midbrain and anterior hindbrain.	Mason I, etal., Biochem Cell Biol 2000;78(5):577-84.
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	Inhibition of constitutively activated Stat3 signaling pathway suppresses growth of prostate cancer cells.	Ni Z, etal., Cancer Res 2000 Mar 1;60(5):1225-8.
10.	GOA pipeline	RGD automated data pipeline
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:11967891	PMID:15829521	PMID:15996652	PMID:16651541	PMID:19279136	PMID:19700621	PMID:21048141	PMID:23144817

Genomics

Comparative Map Data

Gbx2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	97,957,304 - 97,959,883 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	9	97,957,304 - 97,959,883 (-)	Ensembl				GRCr8
mRatBN7.2	9	90,509,633 - 90,512,212 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	90,509,633 - 90,512,212 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	9	98,936,286 - 98,938,865 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	104,072,186 - 104,074,765 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	102,437,722 - 102,440,301 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	97,063,265 - 97,065,855 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	97,063,728 - 97,065,817 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	9	96,754,122 - 96,756,543 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	9	89,034,340 - 89,037,102 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	9	88,058,118 - 88,060,697 (-)	NCBI		Celera
RGSC_v3.1	9	89,239,950 - 89,240,065 (-)	NCBI
Cytogenetic Map	9	q36	NCBI

GBX2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	236,161,340 - 236,168,386 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	236,165,236 - 236,168,386 (-)	Ensembl			hg38	GRCh38
GRCh37	2	237,073,879 - 237,077,029 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	236,739,046 - 236,741,391 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	2	236,856,306 - 236,858,652	NCBI
Celera	2	230,787,441 - 230,789,786 (-)	NCBI		Celera
Cytogenetic Map	2	q37.2	NCBI
HuRef	2	228,868,880 - 228,871,225 (-)	NCBI		HuRef
CHM1_1	2	237,080,112 - 237,082,457 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	236,651,067 - 236,658,113 (-)	NCBI		T2T-CHM13v2.0

Gbx2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	89,855,684 - 89,858,898 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	89,855,678 - 89,858,901 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	1	89,927,962 - 89,931,176 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	89,927,956 - 89,931,179 (-)	Ensembl			mm10	GRCm38
MGSCv37	1	91,824,537 - 91,827,751 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	1	91,759,133 - 91,762,347 (-)	NCBI		MGSCv36	mm8
Celera	1	92,869,152 - 92,872,368 (-)	NCBI		Celera
Cytogenetic Map	1	D	NCBI
cM Map	1	45.06	NCBI

Gbx2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955453	538,280 - 540,306 (+)	Ensembl
ChiLan1.0	NW_004955453	538,066 - 541,415 (+)	NCBI	ChiLan1.0	ChiLan1.0

GBX2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	138,794,032 - 138,798,437 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	138,808,996 - 138,813,401 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	123,392,499 - 123,399,549 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

GBX2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	25	47,005,509 - 47,008,367 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	25	47,005,504 - 47,008,512 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	25	47,508,245 - 47,511,037 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	25	47,359,565 - 47,362,361 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	25	47,359,543 - 47,362,930 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	25	47,267,592 - 47,270,382 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	25	47,061,156 - 47,063,938 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	25	47,291,077 - 47,293,871 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Gbx2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	189,066,154 - 189,069,657 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936525	1,870,195 - 1,873,539 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936525	1,870,211 - 1,873,536 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GBX2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	136,029,070 - 136,032,316 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	15	136,029,393 - 136,032,568 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	150,464,293 - 150,466,933 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GBX2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	122,177,725 - 122,184,448 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	10	122,182,301 - 122,184,446 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666040	77,219,450 - 77,225,155 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gbx2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624847	1,879,007 - 1,881,669 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624847	1,878,946 - 1,881,794 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Gbx2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	4	161,930,401 - 161,933,188 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Gbx2
8 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	166
Count of miRNA genes:	128
Interacting mature miRNAs:	133
Transcripts:	ENSRNOT00000026419
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631656	Bp108	Blood pressure QTL 108	5.97	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	56047863	101047863	Rat
1582203	Gluco19	Glucose level QTL 19	3.3	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	9	63376862	108376862	Rat
724515	Uae16	Urinary albumin excretion QTL 16	8		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	65657365	108376720	Rat
724547	Cm21	Cardiac mass QTL 21	2.7		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	9	86720043	110356905	Rat
8662828	Vetf6	Vascular elastic tissue fragility QTL 6	3.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	9	44458256	99506504	Rat
2303178	Bp334	Blood pressure QTL 334	3.7	0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	86720043	121768150	Rat
724544	Uae9	Urinary albumin excretion QTL 9	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	9	64220169	109220169	Rat
1578760	Cm53	Cardiac mass QTL 53	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	9	64220169	109220169	Rat
2290450	Scl57	Serum cholesterol level QTL 57	4.15		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	9	44458256	121768150	Rat
1581580	Uae34	Urinary albumin excretion QTL 34			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	64220169	109220169	Rat
1300134	Bp185	Blood pressure QTL 185	3.73		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	9	68875497	121768150	Rat
1354626	Bvd1	Brain ventricular dilatation QTL 1	3.73	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	9	83161999	118999486	Rat
4889852	Pur26	Proteinuria QTL 26	15	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	85262459	109044727	Rat
7794784	Mcs31	Mammary carcinoma susceptibility QTL 31	2.98		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	9	85262459	118999486	Rat
731164	Uae25	Urinary albumin excretion QTL 25	3.5	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	48718864	108376862	Rat
1578757	Pur6	Proteinuria QTL 6	3.3	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	64220169	109220169	Rat
4889943	Bss90	Bone structure and strength QTL 90	4.1		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	9	54506504	99506504	Rat

Markers in Region

Gbx2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_5.0	9	96,754,122 - 96,754,504	NCBI	Rnor5.0
RGSC_v3.4	9	89,034,424 - 89,035,064	UniSTS	RGSC3.4
Celera	9	88,057,981 - 88,058,621	UniSTS
Cytogenetic Map	9	q35	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
11	2	38	98	30	29	7	24	7	3	106	71	1	88	15	47	22	5	5

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053708	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB266843	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF390072	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473997	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000026419 ⟹ ENSRNOP00000026419

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	9	97,957,304 - 97,959,883 (-)	Ensembl
mRatBN7.2 Ensembl	9	90,509,633 - 90,512,212 (-)	Ensembl
Rnor_6.0 Ensembl	9	97,063,728 - 97,065,817 (-)	Ensembl

RefSeq Acc Id:

NM_053708 ⟹ NP_446160

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	97,957,304 - 97,959,883 (-)	NCBI
mRatBN7.2	9	90,509,633 - 90,512,212 (-)	NCBI
Rnor_6.0	9	97,063,265 - 97,065,855 (-)	NCBI
Rnor_5.0	9	96,754,122 - 96,756,543 (-)	NCBI
RGSC_v3.4	9	89,034,340 - 89,037,102 (-)	RGD
Celera	9	88,058,118 - 88,060,697 (-)	NCBI

Sequence:

show sequence

GACTTTTCGTCTCTCCCTGGCTTCTCCCGAACGCGTCTATGAGCGCAGCGTTCCCGCCGTCGCT
GATGATGATGCAGCGCCCGCTGGGGAGTAGTACCGCCTTCAGCATAGACTCGCTGATCGGCAGC
CCGCCGCAGCCCAGTCCCGGCCATTTCGTCTACACCGGCTACCCCATGTTTATGCCCTACCGGC
CGGTGGTGCTGCCGCCACCGCCGCCGCCGCCTCCCGCGCTGCCCCAGGCAGCGCTACAGCCCGC
GCTGCCGCCCGCGCACCCTCACCACCAGATCCCCAGCTTGCCCACCGGCTTCTGCTCCAGCCTG
GCGCAGGGCATGGCGCTCACCTCCACTCTCATGGCCACGCTGCCCGGCGGCTTCTCTGCGTCGC
CCCAGCACCAAGAGGCGGCCGCCGCCCGCAAGTTCGCTCCGCAGCCGCTGCCTGGAGGCGGCAA
CTTCGACAAATCCGAGGCGCTCCAAGCCGATACGGAGGACGGCAAAGCCTTCTTGGCCAAGGAG
GGCTCGCTGCTCGCCTTCTCTGCGGCCGAAGCGGTGCAAGCGTCGCTCGTCGGGGCTGTCCGAG
GGCAAGGGAAAGACGAGTCAAAGGTGGAAGATGACCCGAAGGGCAAGGAGGAGAGCTTCTCTCT
GGAGAGCGATGTGGATTACAGCTCAGATGACAATTTGCCTGGCCAGACTGCTCATAAGGAAGAA
GACCCCGGCCACGCACTGGAGGAGACCCCGCAGAGCGGCGGTGCGGCAGGTAGCACCACGTCCA
CAGGCAAGAACCGGCGGCGGCGGACTGCCTTTACCAGCGAGCAGCTGCTGGAGCTGGAGAAGGA
ATTCCACTGCAAAAAGTACCTCTCCCTGACCGAGCGCTCACAGATCGCCCATGCCCTCAAACTC
AGCGAGGTGCAAGTAAAAATCTGGTTCCAGAACCGCCGGGCCAAGTGGAAACGTGTCAAGGCAG
GCAACGCCAATTCCAAGACGGGGGAGCCCTCTCGGAACCCCAAGATCGTAGTCCCCATCCCTGT
CCATGTCAGCAGGTTCGCTATTCGAAGTCAACACCAGCAGCTGGAGCAGGCCCGACCCTGAGGG
CCCAGCCAGGGTGGACACCACCGTGGAGAGGCCCTAACACTTGAGGGAACCCGTGTCAGACTCC
ACTCTTTAAAGCAGAACTCAGAGGCACCTCCCAGATGTGGACATCCCAAACAAAATGAGAGTAT
ATTCATTAGACCAGCTTAAAGGGGGCTACAGCCACACCAGAAGATACACTAAATATTTATTATA
CAACCCTACTTTGTACATAGATCTCTATATAGACTGGATCTCAGCTGCAGTGTTTGGAAAGGGA
TAGGATCAAACCTCTCCACTTACACTTTCCAGATGAAACAAAACCACCACTGTACTGTCTCCTT
CAGCGACCAAGCGAACCACTTCCCATACTTTCCCAAAGTAAACGGGAGAGACCCAAGAACACTG
CGGTTTAACCTCATTTTCTTGTTTGTTTCTATTCTGGCTTTTTGAGTTGAGTGCAGAGCAGTCG
GTTTTTTGGTTT

hide sequence

Protein Sequences


Protein RefSeqs	NP_446160	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAK70499	(Get FASTA)	NCBI Sequence Viewer
	BAF44111	(Get FASTA)	NCBI Sequence Viewer
	EDL92080	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000026419
	ENSRNOP00000026419.3

RefSeq Acc Id:

NP_446160 ⟸ NM_053708

- UniProtKB:

G3V8J6 (UniProtKB/TrEMBL), A6JQK7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSAAFPPSLMMMQRPLGSSTAFSIDSLIGSPPQPSPGHFVYTGYPMFMPYRPVVLPPPPPPPPA
LPQAALQPALPPAHPHHQIPSLPTGFCSSLAQGMALTSTLMATLPGGFSASPQHQEAAAARKFA
PQPLPGGGNFDKSEALQADTEDGKAFLAKEGSLLAFSAAEAVQASLVGAVRGQGKDESKVEDDP
KGKEESFSLESDVDYSSDDNLPGQTAHKEEDPGHALEETPQSGGAAGSTTSTGKNRRRRTAFTS
EQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRVKAGNANSKTGEPSRN
PKIVVPIPVHVSRFAIRSQHQQLEQARP

hide sequence

Ensembl Acc Id:

ENSRNOP00000026419 ⟸ ENSRNOT00000026419

Protein Domains

Homeobox

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-G3V8J6-F1-model_v2	AlphaFold	G3V8J6	1-348	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621866	AgrOrtholog
BioCyc Gene	G2FUF-26766	BioCyc
Ensembl Genes	ENSRNOG00000019495	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000026419	ENTREZGENE
	ENSRNOT00000026419.8	UniProtKB/TrEMBL
Gene3D-CATH	Homeodomain-like	UniProtKB/TrEMBL
InterPro	GBX-1/2	UniProtKB/TrEMBL
	Homeobox	UniProtKB/TrEMBL
	Homeobox_CS	UniProtKB/TrEMBL
	Homeobox_metazoa	UniProtKB/TrEMBL
	Homeodomain-like	UniProtKB/TrEMBL
KEGG Report	rno:114500	UniProtKB/TrEMBL
NCBI Gene	114500	ENTREZGENE
PANTHER	HOMEOBOX PROTEIN UNPLUGGED	UniProtKB/TrEMBL
	PTHR24334	UniProtKB/TrEMBL
	PTHR24334:SF3	UniProtKB/TrEMBL
Pfam	Homeobox	UniProtKB/TrEMBL
PhenoGen	Gbx2	PhenoGen
PRINTS	HOMEOBOX	UniProtKB/TrEMBL
PROSITE	HOMEOBOX_1	UniProtKB/TrEMBL
	HOMEOBOX_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000019495	RatGTEx
SMART	HOX	UniProtKB/TrEMBL
Superfamily-SCOP	Homeodomain_like	UniProtKB/TrEMBL
UniProt	A1IJ65_RAT	UniProtKB/TrEMBL
	A6JQK7	ENTREZGENE, UniProtKB/TrEMBL
	G3V8J6	ENTREZGENE, UniProtKB/TrEMBL
	Q91XM7_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-01-20	Gbx2	gastrulation brain homeobox 2			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Gbx2	gastrulation brain homeobox 2			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD