Advanced Search (OLGA)

Gene: Adh7 (alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide) Rattus norvegicus

Analyze

Symbol:

Adh7

Name:

alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide

RGD ID:

621638

Description:

Enables several functions, including NAD binding activity; alcohol binding activity; and zinc ion binding activity. Involved in ethanol metabolic process and retinol metabolic process. Predicted to be located in cytoplasm. Predicted to be active in cytosol. Orthologous to human ADH7 (alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide); PARTICIPATES IN fatty acid metabolic pathway; gluconeogenesis pathway; glycolysis pathway; INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

alcohol dehydrogenase class 4 mu/sigma chain; alcohol dehydrogenase class IV mu/sigma chain; all-trans-retinol dehydrogenase [NAD(+)] ADH7; class IV alcohol dehydrogenase, mu or sigma subunit; omega-hydroxydecanoate dehydrogenase ADH7

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	229,422,125 - 229,436,584 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	229,421,252 - 229,436,691 (+)	Ensembl				GRCr8
mRatBN7.2	2	226,748,724 - 226,763,183 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	226,741,788 - 226,763,182 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	234,488,227 - 234,502,950 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	232,387,968 - 232,402,692 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	227,252,645 - 227,267,369 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	243,500,540 - 243,516,865 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	243,502,073 - 243,516,532 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	262,043,116 - 262,057,570 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	235,749,346 - 235,765,063 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	218,905,199 - 218,919,997 (+)	NCBI		Celera
RGSC_v3.1	2	235,736,085 - 235,751,803 (+)	NCBI
Cytogenetic Map	2	q44	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Esophageal Neoplasms (ISO)

Laryngeal Neoplasms (ISO)

Mouth Neoplasms (ISO)

Parkinson's disease (ISS)

Pharyngeal Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-tert-butylhydroquinone (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3-methylcholanthrene (ISO)

4,4'-diaminodiphenylmethane (EXP)

4-hydroxynon-2-enal (ISO)

7,12-dimethyltetraphene (ISO)

alachlor (EXP)

ammonium chloride (EXP)

andrographolide (ISO)

arsane (ISO)

arsenic atom (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

beta-naphthoflavone (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP)

bisphenol F (ISO)

Butylbenzyl phthalate (ISO)

cannabidiol (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chloroprene (ISO)

chlorpyrifos (EXP)

choline (ISO)

cimetidine (ISO)

cisplatin (ISO)

clofibrate (ISO)

crocidolite asbestos (ISO)

dibenzofuran (EXP)

diclofenac (ISO)

diquat (ISO)

diuron (EXP)

doramapimod (EXP)

endosulfan (EXP)

ethanol (ISO)

ethylene glycol (ISO)

fluoranthene (ISO)

folic acid (ISO)

fomepizole (ISO)

furan (EXP)

genistein (ISO)

gentamycin (EXP)

GW 4064 (ISO)

hydrogen peroxide (ISO)

indometacin (EXP)

L-methionine (ISO)

lipopolysaccharide (ISO)

N-nitrosodiethylamine (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

paraquat (EXP)

pentachlorophenol (ISO)

perfluorooctane-1-sulfonic acid (EXP,ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

pravastatin (EXP,ISO)

pregnenolone 16alpha-carbonitrile (ISO)

propan-2-ol (ISO)

silicon dioxide (EXP,ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sulforaphane (ISO)

tert-butyl hydroperoxide (ISO)

Tesaglitazar (EXP)

testosterone (EXP)

tetrachloroethene (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

triphenyl phosphate (EXP)

troglitazone (EXP)

trovafloxacin (ISO)

vitamin E (ISO)

zaragozic acid A (EXP,ISO)

zearalenone (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

ethanol catabolic process (ISO)

ethanol metabolic process (IDA,IEA)

fatty acid omega-oxidation (ISO)

lipid metabolic process (IEA)

response to bacterium (ISO)

response to ethanol (ISO)

retinoic acid metabolic process (IBA,ISO)

retinoid metabolic process (ISO,TAS)

retinol metabolic process (IBA,IDA,IEA,ISO)

Cellular Component

cytoplasm (IEA)

cytosol (IBA,IEA,ISO)

Molecular Function

alcohol dehydrogenase (NAD+) activity (IDA,IEA,ISO,TAS)

aldehyde oxidase activity (ISO)

all-trans-retinol dehydrogenase (NAD+) activity (IBA,IEA,ISO,ISS)

ethanol binding (IDA,ISO)

identical protein binding (IPI)

metal ion binding (IEA)

NAD binding (IDA)

omega-hydroxydecanoate dehydrogenase activity (IEA)

oxidoreductase activity (IEA)

receptor antagonist activity (ISO)

retinol binding (IDA,ISO)

zinc ion binding (IBA,IDA,IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

fatty acid metabolic pathway (IEA)

gluconeogenesis pathway (IEA)

glycolysis pathway (IEA)

glycolysis/gluconeogenesis pathway (IEA)

phase I biotransformation pathway via cytochrome P450 (IEA)

retinol metabolic pathway (IEA)

tyrosine metabolic pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Molecular basis for differential substrate specificity in class IV alcohol dehydrogenases: a conserved function in retinoid metabolism but not in ethanol oxidation.	Crosas B, etal., J Biol Chem 2000 Aug 18;275(33):25180-7.
2.	Distribution of class I, III and IV alcohol dehydrogenase mRNAs in the adult rat, mouse and human brain.	Galter D, etal., Eur J Biochem 2003 Mar;270(6):1316-26.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	Class IV mammalian alcohol dehydrogenase. Structural data of the rat stomach enzyme reveal a new class well separated from those already characterized.	Pares X, etal., FEBS Lett. 1990 Dec 17;277(1-2):115-8.
8.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
9.	GOA pipeline	RGD automated data pipeline
10.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:9982	PMID:518534	PMID:3663136	PMID:6372555	PMID:7026729	PMID:7876099	PMID:8127901	PMID:9002638	PMID:9228021	PMID:9600267	PMID:10358022	PMID:10402668
PMID:10969996	PMID:11410738	PMID:11997393	PMID:15369820	PMID:16787387	PMID:18424432

Genomics

Comparative Map Data

Adh7
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	229,422,125 - 229,436,584 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	229,421,252 - 229,436,691 (+)	Ensembl				GRCr8
mRatBN7.2	2	226,748,724 - 226,763,183 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	226,741,788 - 226,763,182 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	234,488,227 - 234,502,950 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	232,387,968 - 232,402,692 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	227,252,645 - 227,267,369 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	243,500,540 - 243,516,865 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	243,502,073 - 243,516,532 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	262,043,116 - 262,057,570 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	235,749,346 - 235,765,063 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	218,905,199 - 218,919,997 (+)	NCBI		Celera
RGSC_v3.1	2	235,736,085 - 235,751,803 (+)	NCBI
Cytogenetic Map	2	q44	NCBI

ADH7
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	99,412,263 - 99,435,342 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	99,412,261 - 99,435,510 (-)	Ensembl			hg38	GRCh38
GRCh37	4	100,333,420 - 100,356,499 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	100,552,441 - 100,575,548 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	4	100,690,664 - 100,713,668	NCBI
Celera	4	97,630,520 - 97,653,769 (-)	NCBI		Celera
Cytogenetic Map	4	q23	NCBI
HuRef	4	96,071,188 - 96,094,437 (-)	NCBI		HuRef
CHM1_1	4	100,309,868 - 100,333,116 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	102,727,019 - 102,750,100 (-)	NCBI		T2T-CHM13v2.0

Adh7
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	137,903,828 - 137,937,803 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	137,923,521 - 137,939,143 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	3	138,198,064 - 138,232,042 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	138,217,760 - 138,233,382 (+)	Ensembl			mm10	GRCm38
MGSCv37	3	137,880,737 - 137,895,006 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	3	138,155,147 - 138,169,421 (+)	NCBI		MGSCv36	mm8
Celera	3	144,622,819 - 144,637,080 (+)	NCBI		Celera
Cytogenetic Map	3	G3	NCBI
cM Map	3	64.13	NCBI

Adh7
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955496	8,065,943 - 8,102,066 (+)	Ensembl
ChiLan1.0	NW_004955496	8,065,943 - 8,100,878 (+)	NCBI	ChiLan1.0	ChiLan1.0

ADH7
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	97,491,600 - 97,514,798 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	97,775,286 - 97,798,330 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	91,833,111 - 91,856,325 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	102,494,784 - 102,518,215 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	102,494,784 - 102,518,215 (-)	Ensembl			panPan2	panpan1.1

Adh7
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405301	20,123,644 - 20,148,383 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936520	3,467,003 - 3,490,997 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936520	3,467,003 - 3,489,754 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LOC100512795
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	121,020,969 - 121,041,506 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	8	121,020,683 - 121,041,735 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	130,164,997 - 130,185,238 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ADH7
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	47,571,477 - 47,592,502 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	7	47,571,564 - 47,590,593 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666037	26,040,960 - 26,059,939 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Adh7
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	3	20,925,853 - 20,939,030 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Adh7
129 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	71
Count of miRNA genes:	64
Interacting mature miRNAs:	67
Transcripts:	ENSRNOT00000015870
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	170656145	239614549	Rat
631563	Hcuc3	Hepatic copper content QTL 3	3.87		liver copper amount (VT:0003065)	liver copper weight to liver dry weight ratio (CMO:0001512)	2	212145502	231732847	Rat
2301408	Kidm36	Kidney mass QTL 36		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	184482291	229482291	Rat
631501	Bp101	Blood pressure QTL 101	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	205135267	250135267	Rat
1598813	Memor9	Memory QTL 9	2.7		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	2	202029709	236904960	Rat
2307174	Activ3	Activity QTL 3	4.83	0.000058	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	210956252	251712708	Rat
8693697	Alc36	Alcohol consumption QTL 36	2	0.592	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	2	219814164	239320906	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	143344967	251712708	Rat
1298075	Scl17	Serum cholesterol level QTL 17	3.4		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	214404877	251712708	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	143344967	251712708	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845370	229470703	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	83465462	229820014	Rat
1300126	Bp175	Blood pressure QTL 175	3.46		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	204795005	249795005	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	20695736	231474293	Rat
7207484	Bss108	Bone structure and strength QTL 108	5.3		femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	2	214404877	251712708	Rat
2313073	Bmd75	Bone mineral density QTL 75	4.1	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	2	218051934	251712708	Rat
738013	Alc15	Alcohol consumption QTL 15	4.1	0.00022	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	2	186850607	231850607	Rat
61398	Bp50	Blood pressure QTL 50	4.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	192287802	237287802	Rat
7207482	Bss107	Bone structure and strength QTL 107	7		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	2	214404877	251712708	Rat
2317752	Glom23	Glomerulus QTL 23	3.6		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	2	196140964	251540988	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	205135267	250135267	Rat
1549836	Bss2	Bone structure and strength QTL 2	7.5		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	2	214404877	251712708	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	2	205135267	250135267	Rat
1359031	Bp275	Blood pressure QTL 275			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	188565047	233565047	Rat
1581499	Esta2	Estrogen-induced thymic atrophy QTL 2			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	192287802	229609668	Rat
1331767	Hrtrt12	Heart rate QTL 12	3.373		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	2	221088977	243501206	Rat
9589044	Scfw1	Subcutaneous fat weight QTL 1	5.8	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	2	184856304	229856304	Rat
8694435	Bw166	Body weight QTL 166	14.08	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	2	184856304	229856304	Rat
2293833	Kiddil8	Kidney dilation QTL 8	2.9		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	220274283	249795005	Rat
8694383	Bw158	Body weight QTL 158	7.69	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	2	184856304	229856304	Rat
1598835	Anxrr18	Anxiety related response QTL 18	2.98		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	2	203664411	248664411	Rat
7207490	Bss111	Bone structure and strength QTL 111	6.4		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	2	214404877	251712708	Rat
8693622	Alc26	Alcohol consumption QTL 26	2.4	0.667	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	2	223810546	243965570	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	166372086	229820014	Rat
8694194	Abfw1	Abdominal fat weight QTL 1	11.7	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	2	184856304	229856304	Rat
61366	Iddm3	Insulin dependent diabetes mellitus QTL 3	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	192287802	237287802	Rat
2293844	Kiddil7	Kidney dilation QTL 7	3.5		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	220274283	249795005	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	151869660	251712708	Rat

Markers in Region

RH139739

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	226,762,914 - 226,763,119 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	243,516,265 - 243,516,469	NCBI	Rnor6.0
Rnor_5.0	2	262,057,302 - 262,057,506	UniSTS	Rnor5.0
RGSC_v3.4	2	235,764,795 - 235,764,999	UniSTS	RGSC3.4
Celera	2	218,919,729 - 218,919,933	UniSTS
RH 3.4 Map	2	1594.4	UniSTS
Cytogenetic Map	2	q44	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
15	7	32	68	77	77	48	20	48	6	182	76	5	45	37	47	29	3	3

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_134329	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008761493	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC118967	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X98746	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000015870 ⟹ ENSRNOP00000015870

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	229,421,252 - 229,436,691 (+)	Ensembl
mRatBN7.2 Ensembl	2	226,741,788 - 226,763,182 (+)	Ensembl
Rnor_6.0 Ensembl	2	243,502,073 - 243,516,532 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000113512 ⟹ ENSRNOP00000077394

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	229,426,383 - 229,433,614 (+)	Ensembl
mRatBN7.2 Ensembl	2	226,752,982 - 226,760,213 (+)	Ensembl

RefSeq Acc Id:

NM_134329 ⟹ NP_599156

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	229,422,125 - 229,436,584 (+)	NCBI
mRatBN7.2	2	226,748,724 - 226,763,183 (+)	NCBI
Rnor_6.0	2	243,502,073 - 243,516,533 (+)	NCBI
Rnor_5.0	2	262,043,116 - 262,057,570 (+)	NCBI
RGSC_v3.4	2	235,749,346 - 235,765,063 (+)	RGD
Celera	2	218,905,199 - 218,919,997 (+)	RGD

Sequence:

show sequence

CCGTGCGTCAGTCAGAACACGTTCCTGTTTGCAGACCACAAACCCAGGAAAGCCAGGATGGACA
CTGCTGGAAAAGTTATTAAGTGCAAAGCAGCTGTCCTATGGGGGACGAACCAGCCCTTCTCCAT
TGAGGACATTGAAGTGGCCCCACCAAAGGCTAAGGAAGTTCGTGTTAAGATTTTGGCCACGGGA
ATCTGTGGCACAGATGACCACGTGATCAAGGGAACGATGGTGTCTAAGTTCCCAGTGATTGTGG
GACACGAAGCAGTTGGGATTGTGGAGAGTGTTGGAGAAGAGGTCACTACAGTGAGACCAGGTGA
CAAAGTGATCCCCCTCTTTCTACCACAGTGTAGAGAATGCAACCCCTGCCGCAACCCGGAGGAA
AATCTCTGCATTAGGAGCGACCTGACAGGCCGTGGAGTATTGGCTGACGGCACGACCAGGTTCA
CATGCAAGGGCAAACCAGTCCAGCACTTTATGAACACCAGCACCTTCACTGAGTACACGGTCCT
GGATGAATCCTCCGTAGCTAAGATTGATGCCGAGGCTCCTCCCGAGAAAGCCTGCTTGATTGGC
TGTGGATTTTCCACTGGTTATGGGGCTGCTGTTAAAACTGCCAAGGTCAGCCCTGGCTCCACCT
GTGCTGTGTTTGGCCTGGGAGGAGTTGGCCTGTCAGTCGTCATGGGCTGTAAAGCGGCCGGCGC
CTCCCGGATCATCGGAATTGACATCAACAAGGACAAATTTCAGAAAGCCCTGGATGTAGGGGCC
ACAGAGTGTATCAATCCCAGGGACTTCACCAAGCCCATCAGTGAGGTGCTGTCAGACATGACAG
GCAACACTGTCCAGTATACTTTTGAAGTTATCGGGCGCCTTGAGACCATGGTTGATGCCCTCTC
ATCTTGCCATATGAACTATGGGACCAGCGTGGTGGTCGGGGCTCCTCCGTCAGCCAAGATGCTC
AGCTATGACCCAATGCTGCTTTTCACTGGACGGACATGGAAGGGCTGCGTCTTTGGTGGTTGGA
AGAGCAGAGATGATGTTCCCAAATTGGTGACTGAATTCCTGGAAAAGAAATTTGACCTGGGCCA
GTTGATAACCCACACCTTGCCTTTTCATAACATCAGTGAAGGATTTGAATTGCTTTATTCAGGG
CAAAGCATTCGGACTGTCCTGACATTTTGAGATCCAGAGAGCTGGGTGTTCTGTGCTGGGCGAC
CGTGACCTGAAGCCTTGTTCCTGACAGTGTTCTCTGATATCACGAGTCTGTCTCAGAAATGCCA
TGCAGAGGCCAGGTTGGGGACAAGAGAGAGAAGCTCTACAGAGGTTTATAAACCTTCATATGTT
TAGTTTACCGGGTGCCTAGCATTAGCAGAGAACAGTAAGAGTAAATGTTCTAGTCTGCGTTTTC
CTAAGACGATAATTCTACACTTCATAAGCATATACTTGGGGTTCCAATTTGTTGGAAGAGGGAC
TGTTTTCCAGAATTTTACCACAAGTTGTTGTTACTTAAAAACAGACAAAGCATGTCGAGAGATG
TAGAGAATACATTTTTCAAGAGATCCCCACCAAAGCCACCCGAGCTCTCATTCTGTTTTTCAAC
AGAAACACTTTTAAAAATGTTATAAATTAACTTGAATTAGATTGTGAAATTGCACACATAACTT
GATTAGATTAAGAAAGAAAGTTGGGAAATTTAAGGGAAGGGCACGTTTTTTAATGATTAACTTT
GAAAATTATCGTTATGTAATTTAGTGACATGGGGGAAGCACATCTGTGCCTGGGGATATCGTCA
GCGTTTATTAATATAAAGCACTTTTACAGTAGCGATTACAGATGAACCATAGATATAACCACAT
TGGGATATTTATGATATTAAGGTTAATAAAGTAGAATGACAAGTCCTTAAGGGCATAGTAGTAA
CTCCATTTAACATGAAGATTATTCTCAGATTGCTTTAACTACACCAGCCTGTATCTGCATCTGT
CTGTGGACATGTACACACACGTAATATTCATTAAATTTTCATTGTGGTAAAAGAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_599156	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAA67297	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000015870
GenBank Protein	P41682	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_599156 ⟸ NM_134329

- UniProtKB:

P41682 (UniProtKB/Swiss-Prot), O55146 (UniProtKB/Swiss-Prot), A6HW25 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDTAGKVIKCKAAVLWGTNQPFSIEDIEVAPPKAKEVRVKILATGICGTDDHVIKGTMVSKFPV
IVGHEAVGIVESVGEEVTTVRPGDKVIPLFLPQCRECNPCRNPEENLCIRSDLTGRGVLADGTT
RFTCKGKPVQHFMNTSTFTEYTVLDESSVAKIDAEAPPEKACLIGCGFSTGYGAAVKTAKVSPG
STCAVFGLGGVGLSVVMGCKAAGASRIIGIDINKDKFQKALDVGATECINPRDFTKPISEVLSD
MTGNTVQYTFEVIGRLETMVDALSSCHMNYGTSVVVGAPPSAKMLSYDPMLLFTGRTWKGCVFG
GWKSRDDVPKLVTEFLEKKFDLGQLITHTLPFHNISEGFELLYSGQSIRTVLTF

hide sequence

Ensembl Acc Id:

ENSRNOP00000015870 ⟸ ENSRNOT00000015870

Ensembl Acc Id:

ENSRNOP00000077394 ⟸ ENSRNOT00000113512

Protein Domains

Enoyl reductase (ER)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P41682-F1-model_v2	AlphaFold	P41682	1-374	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691784

Promoter ID:

EPDNEW_R2309

Type:

single initiation site

Name:

Adh7_1

Description:

alcohol dehydrogenase 7 , mu or sigma polypeptide

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	243,502,060 - 243,502,120	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621638	AgrOrtholog
BioCyc Gene	G2FUF-51078	BioCyc
Ensembl Genes	ENSRNOG00000032959	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000015870	ENTREZGENE
Gene3D-CATH	Medium-chain alcohol dehydrogenases, catalytic domain	UniProtKB/Swiss-Prot
	NAD(P)-binding Rossmann-like Domain	UniProtKB/Swiss-Prot
InterPro	ADH_C	UniProtKB/Swiss-Prot
	ADH_N	UniProtKB/Swiss-Prot
	ADH_Zn_CS	UniProtKB/Swiss-Prot
	GroES-like_sf	UniProtKB/Swiss-Prot
	NAD(P)-bd_dom_sf	UniProtKB/Swiss-Prot
	PKS_ER	UniProtKB/Swiss-Prot
KEGG Report	rno:171178	UniProtKB/Swiss-Prot
NCBI Gene	171178	ENTREZGENE
PANTHER	ALCOHOL DEHYDROGENASE	UniProtKB/Swiss-Prot
	PTHR43880:SF2	UniProtKB/Swiss-Prot
Pfam	ADH_N	UniProtKB/Swiss-Prot
	ADH_zinc_N	UniProtKB/Swiss-Prot
PharmGKB	ADH7	RGD
PhenoGen	Adh7	PhenoGen
PROSITE	ADH_ZINC	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000032959	RatGTEx
SMART	PKS_ER	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF50129	UniProtKB/Swiss-Prot
	SSF51735	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZKA5_RAT	UniProtKB/TrEMBL
	A6HW25	ENTREZGENE, UniProtKB/TrEMBL
	ADH7_RAT	UniProtKB/Swiss-Prot
	G3V7J9_RAT	UniProtKB/TrEMBL
	O55146	ENTREZGENE
	P41682	ENTREZGENE
UniProt Secondary	O55146	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-02-26	Adh7	alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide			Symbol and Name status set to approved	625702	APPROVED
2002-08-07	Adh7	alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Annotations - KEGG (archival)