Advanced Search (OLGA)

Gene: Il2rg (interleukin 2 receptor subunit gamma) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Il2rg (Ensembl: Cxhxorf65)

Name:

interleukin 2 receptor subunit gamma (Ensembl:similar to human chromosome X open reading frame 65)

RGD ID:

621466

Description:

Predicted to enable coreceptor activity; interleukin-15 receptor activity; and interleukin-2 binding activity. Predicted to be involved in cellular homeostasis; cytokine-mediated signaling pathway; and positive regulation of phagocytosis. Predicted to act upstream of or within positive regulation of gene expression and positive regulation of lymphocyte differentiation. Predicted to be located in external side of plasma membrane and nucleoplasm. Predicted to be active in plasma membrane. Used to study X-linked severe combined immunodeficiency and combined T cell and B cell immunodeficiency. Human ortholog(s) of this gene implicated in X-linked severe combined immunodeficiency; combined T cell and B cell immunodeficiency; and severe combined immunodeficiency. Orthologous to human IL2RG (interleukin 2 receptor subunit gamma); PARTICIPATES IN interleukin-12 signaling pathway; interleukin-2 signaling pathway; interleukin-4 signaling pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-diaminodiphenylmethane.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Ab2-183; Cd132; cytokine receptor common subunit gamma; interleukin 2 receptor, gamma (severe combined immunodeficiency); interleukin 2 receptor, gamma chain

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Allele / Splice:

Il2rg^em2Mcwi Il2rg^em1Mcwi Il2rg^em3Mcwi Il2rg^em1Kyo Il2rg^em2Kyo Il2rg^em1Hina Il2rg^em6Kyo Il2rg^em5Kyo Il2rg^em1Iexas Il2rg^em4Kyo Il2rg^em3Kyo Il2rg^em1Ang Il2rg^em7Kyo

Genetic Models:

SS-Chr 3^BN.SS-(D3Rat164-D3Rat218).Il2rg^em1/Mcwi SS-Chr 3^BN.SS-(D3Rat 86-D3Rat218).Il2rg^em1/Mcwi SS-Chr 3^BN.SS-(D3Mgh13-D3Rat218).Il2rg^em1/Mcwi SS-Il2rg^em1Mcwi SD-Il2rg^em2Mcwi SD-Il2rg^em3Mcwi SS-Chr 3^BN.Il2rg^em1Mcwi/Mcwi SD-Rag2^em3McwiIl2rg^em2Mcwi SD-Il2rg^em1Ang TM-Il2rg^em5Kyo TM-Il2rg^em4Kyo F344-Il2rg^em3Kyo F344-Il2rg^em2Kyo F344-Il2rg^em1Kyo F344-Il2rg^em1IexasRag2^em1Iexas F344-Il2rg^em1Iexas W-Il2rg^em1Hina F344-Il2rg^em7Kyo TM-Prkdc^em4KyoIl2rg^em5Kyo F344-Prkdc^em2KyoIl2rg^em6Kyo

Is Marker For:

Strains: F344-Prkdc^em2KyoIl2rg^em6Kyo TM-Prkdc^em4KyoIl2rg^em5Kyo

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	X	70,435,340 - 70,439,052 (-)	NCBI		GRCr8
mRatBN7.2	X	66,395,330 - 66,399,026 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	66,392,542 - 66,399,823 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	X	67,878,691 - 67,882,351 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	71,379,079 - 71,382,739 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	68,939,986 - 68,943,646 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	X	71,165,378 - 71,169,078 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	71,162,585 - 71,169,865 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	X	72,017,856 - 72,021,516 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	X	89,342,055 - 89,345,715 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	X	89,416,495 - 89,419,068 (-)	NCBI
Celera	X	66,751,239 - 66,754,899 (-)	NCBI		Celera
Cytogenetic Map	X	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Il2rg	Rat	combined T cell and B cell immunodeficiency		IMP		2316325		RGD
Il2rg	Rat	COVID-19	severity	ISO	IL2RG (Homo sapiens)	32716368	protein:increased expression:serum (human)	RGD
Il2rg	Rat	Immune Deficiency Disease		IMP		13628403		RGD
Il2rg	Rat	severe combined immunodeficiency		ISO	IL2RG (Homo sapiens)	1600009	X-linked SCID and OMIM:300400	RGD
Il2rg	Rat	X-linked severe combined immunodeficiency		IMP		2316325		RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Il2rg	Rat	autistic disorder		ISO	IL2RG (Homo sapiens)	8554872	ClinVar Annotator: match by term: Autism	ClinVar	PMID:21681106 and PMID:30208311
Il2rg	Rat	autosomal hemophilia A		ISO	IL2RG (Homo sapiens)	8554872	ClinVar Annotator: match by term: AUTOSOMAL HEMOPHILIA A	ClinVar	PMID:31690835
Il2rg	Rat	combined immunodeficiency		ISO	IL2RG (Homo sapiens)	8554872	ClinVar Annotator: match by term: Combined immunodeficiency	ClinVar	PMID:25741868
Il2rg	Rat	combined T cell and B cell immunodeficiency		ISO	IL2RG (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:10792291 more ...
Il2rg	Rat	factor VIII deficiency		ISO	IL2RG (Homo sapiens)	8554872	ClinVar Annotator: match by term: Factor 8 deficiency and congenital	ClinVar	PMID:31690835
Il2rg	Rat	FG Syndrome 1		ISO	IL2RG (Homo sapiens)	8554872	ClinVar Annotator: match by term: FG syndrome 1	ClinVar	PMID:28492532
Il2rg	Rat	genetic disease		ISO	IL2RG (Homo sapiens)	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:10794431 more ...
Il2rg	Rat	syndromic X-linked intellectual disability Lubs type		ISO	IL2RG (Homo sapiens)	8554872	ClinVar Annotator: match by term: Syndromic X-linked intellectual disability Lubs type	ClinVar	PMID:25741868
Il2rg	Rat	X-linked severe combined immunodeficiency		ISO	IL2RG (Homo sapiens)	8554872	ClinVar Annotator: match by term: X-linked severe combined immunodeficiency	ClinVar	PMID:10444186 more ...

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Il2rg	Rat	combined T cell and B cell immunodeficiency		ISO	IL2RG (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD
Il2rg	Rat	Experimental Liver Cirrhosis		ISO	IL2RG (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:25380136
Il2rg	Rat	Sezary's disease		ISO	IL2RG (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:26551670

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Il2rg	Rat	combined T cell and B cell immunodeficiency		ISO	IL2RG (Homo sapiens)	7240710		OMIM
Il2rg	Rat	X-linked severe combined immunodeficiency		ISO	IL2RG (Homo sapiens)	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Il2rg	Rat	1,2-dimethylhydrazine	increases expression	ISO	Il2rg (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in increased expression of IL2RG mRNA	CTD	PMID:22206623
Il2rg	Rat	1-naphthyl isothiocyanate	increases expression	EXP		6480464	1-Naphthylisothiocyanate results in increased expression of IL2RG mRNA	CTD	PMID:25380136
Il2rg	Rat	17beta-estradiol	decreases expression	ISO	Il2rg (Mus musculus)	6480464	Estradiol results in decreased expression of IL2RG mRNA	CTD	PMID:39298647
Il2rg	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Il2rg (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of IL2RG mRNA	CTD	PMID:21570461
Il2rg	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of IL2RG mRNA	CTD	PMID:34747641
Il2rg	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Il2rg (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in increased expression of IL2RG mRNA	CTD	PMID:17942748 and PMID:26290441
Il2rg	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	Il2rg (Mus musculus)	6480464	[TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in decreased expression of IL2RG mRNA	CTD	PMID:25975270
Il2rg	Rat	4,4'-diaminodiphenylmethane	increases expression	EXP		6480464	4 and 4'-diaminodiphenylmethane results in increased expression of IL2RG mRNA	CTD	PMID:25380136
Il2rg	Rat	4,4'-sulfonyldiphenol	decreases expression	ISO	Il2rg (Mus musculus)	6480464	bisphenol S results in decreased expression of IL2RG mRNA	CTD	PMID:39298647
Il2rg	Rat	4-hydroxycyclophosphamide	multiple interactions	EXP		6480464	[afimoxifene co-treated with 4-hydroxycyclophosphamide] affects the expression of IL2RG mRNA	CTD	PMID:25833159
Il2rg	Rat	4-hydroxyphenyl retinamide	increases expression	ISO	Il2rg (Mus musculus)	6480464	Fenretinide results in increased expression of IL2RG mRNA	CTD	PMID:28973697
Il2rg	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of IL2RG mRNA	CTD	PMID:30047161
Il2rg	Rat	acetamide	increases expression	EXP		6480464	acetamide results in increased expression of IL2RG mRNA	CTD	PMID:31881176
Il2rg	Rat	acetylsalicylic acid	decreases expression	ISO	IL2RG (Homo sapiens)	6480464	Aspirin results in decreased expression of IL2RG mRNA	CTD	PMID:15928584
Il2rg	Rat	afimoxifene	multiple interactions	EXP		6480464	[afimoxifene co-treated with 4-hydroxycyclophosphamide] affects the expression of IL2RG mRNA	CTD	PMID:25833159
Il2rg	Rat	aflatoxin B1	increases methylation	ISO	IL2RG (Homo sapiens)	6480464	Aflatoxin B1 results in increased methylation of IL2RG gene	CTD	PMID:27153756
Il2rg	Rat	aflatoxin B1	increases expression	EXP		6480464	Aflatoxin B1 results in increased expression of IL2RG mRNA	CTD	PMID:25378103
Il2rg	Rat	all-trans-retinoic acid	increases expression	ISO	IL2RG (Homo sapiens)	6480464	Tretinoin results in increased expression of IL2RG mRNA	CTD	PMID:33167477
Il2rg	Rat	alpha-Zearalanol	increases expression	EXP		6480464	Zeranol results in increased expression of IL2RG mRNA	CTD	PMID:35163327
Il2rg	Rat	amitrole	increases expression	EXP		6480464	Amitrole results in increased expression of IL2RG mRNA	CTD	PMID:30047161
Il2rg	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of IL2RG mRNA	CTD	PMID:16483693
Il2rg	Rat	amphetamine	decreases expression	EXP		6480464	Amphetamine results in decreased expression of IL2RG mRNA	CTD	PMID:30779732
Il2rg	Rat	antirheumatic drug	decreases expression	ISO	IL2RG (Homo sapiens)	6480464	Antirheumatic Agents results in decreased expression of IL2RG mRNA	CTD	PMID:24449571
Il2rg	Rat	aripiprazole	multiple interactions	ISO	IL2RG (Homo sapiens)	6480464	[Aripiprazole co-treated with Ozone] results in decreased expression of IL2RG mRNA	CTD	PMID:31476115
Il2rg	Rat	benzo[a]pyrene	decreases expression	ISO	Il2rg (Mus musculus)	6480464	Benzo(a)pyrene results in decreased expression of IL2RG mRNA	CTD	PMID:19770486
Il2rg	Rat	benzo[a]pyrene	affects methylation	ISO	IL2RG (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of IL2RG promoter	CTD	PMID:27901495
Il2rg	Rat	benzo[a]pyrene	increases expression	ISO	Il2rg (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of IL2RG mRNA	CTD	PMID:22228805
Il2rg	Rat	benzo[a]pyrene	multiple interactions	ISO	Il2rg (Mus musculus)	6480464	AHR protein affects the reaction [Benzo(a)pyrene affects the expression of IL2RG mRNA]	CTD	PMID:22228805
Il2rg	Rat	benzo[a]pyrene	decreases expression	EXP		6480464	Benzo(a)pyrene results in decreased expression of IL2RG mRNA	CTD	PMID:21839799
Il2rg	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	Il2rg (Mus musculus)	6480464	Diethylhexyl Phthalate results in increased expression of IL2RG mRNA	CTD	PMID:35550907
Il2rg	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of IL2RG mRNA	CTD	PMID:25181051
Il2rg	Rat	bisphenol A	increases expression	ISO	Il2rg (Mus musculus)	6480464	bisphenol A results in increased expression of IL2RG mRNA	CTD	PMID:37894381 and PMID:38701888
Il2rg	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of IL2RG mRNA	CTD	PMID:34947998
Il2rg	Rat	Brevianamide A	increases expression	ISO	Il2rg (Mus musculus)	6480464	brevianamide A results in increased expression of IL2RG mRNA	CTD	PMID:19818335
Il2rg	Rat	C60 fullerene	decreases expression	EXP		6480464	fullerene C60 results in decreased expression of IL2RG mRNA	CTD	PMID:19167457
Il2rg	Rat	cadmium dichloride	decreases expression	ISO	IL2RG (Homo sapiens)	6480464	Cadmium Chloride results in decreased expression of IL2RG mRNA	CTD	PMID:38382870
Il2rg	Rat	calcitriol	multiple interactions	ISO	IL2RG (Homo sapiens)	6480464	[Testosterone co-treated with Calcitriol] results in increased expression of IL2RG mRNA	CTD	PMID:21592394
Il2rg	Rat	calcitriol	increases expression	ISO	IL2RG (Homo sapiens)	6480464	Calcitriol results in increased expression of IL2RG mRNA	CTD	PMID:16129123 and PMID:21592394
Il2rg	Rat	carbon nanotube	increases expression	ISO	Il2rg (Mus musculus)	6480464	Nanotubes more ...	CTD	PMID:25554681
Il2rg	Rat	ceric oxide	increases expression	EXP		6480464	ceric oxide results in increased expression of IL2RG mRNA	CTD	PMID:29463257
Il2rg	Rat	chloroprene	decreases expression	ISO	Il2rg (Mus musculus)	6480464	Chloroprene results in decreased expression of IL2RG mRNA	CTD	PMID:23125180
Il2rg	Rat	clothianidin	increases expression	ISO	IL2RG (Homo sapiens)	6480464	clothianidin results in increased expression of IL2RG mRNA	CTD	PMID:31626844
Il2rg	Rat	Cuprizon	affects expression	EXP		6480464	Cuprizone affects the expression of IL2RG mRNA	CTD	PMID:27523638
Il2rg	Rat	DDE	decreases expression	ISO	IL2RG (Homo sapiens)	6480464	Dichlorodiphenyl Dichloroethylene results in decreased expression of IL2RG mRNA	CTD	PMID:38568856
Il2rg	Rat	dextran sulfate	increases expression	ISO	Il2rg (Mus musculus)	6480464	Dextran Sulfate results in increased expression of IL2RG mRNA	CTD	PMID:23894361
Il2rg	Rat	Dibutyl phosphate	affects expression	ISO	IL2RG (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of IL2RG mRNA	CTD	PMID:37042841
Il2rg	Rat	dichloromethane	increases expression	EXP		6480464	Methylene Chloride results in increased expression of IL2RG mRNA	CTD	PMID:20955722
Il2rg	Rat	diclofenac	increases expression	ISO	Il2rg (Mus musculus)	6480464	Diclofenac results in increased expression of IL2RG mRNA	CTD	PMID:26934552
Il2rg	Rat	ethylbenzene	increases expression	EXP		6480464	ethylbenzene results in increased expression of IL2RG mRNA	CTD	PMID:20955722
Il2rg	Rat	fluvastatin	multiple interactions	ISO	IL2RG (Homo sapiens)	6480464	[zoledronic acid co-treated with fluvastatin] results in increased expression of IL2RG mRNA	CTD	PMID:16996129
Il2rg	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of IL2RG mRNA	CTD	PMID:22061828
Il2rg	Rat	lipopolysaccharide	increases expression	ISO	Il2rg (Mus musculus)	6480464	Lipopolysaccharides results in increased expression of IL2RG mRNA	CTD	PMID:26582142
Il2rg	Rat	methimazole	increases expression	EXP		6480464	Methimazole results in increased expression of IL2RG mRNA	CTD	PMID:30047161
Il2rg	Rat	methotrexate	affects expression	ISO	Il2rg (Mus musculus)	6480464	Methotrexate affects the expression of IL2RG mRNA	CTD	PMID:18502557
Il2rg	Rat	mycophenolic acid	increases expression	ISO	Il2rg (Mus musculus)	6480464	Mycophenolic Acid results in increased expression of IL2RG mRNA	CTD	PMID:19818335
Il2rg	Rat	N-nitrosodimethylamine	increases expression	EXP		6480464	Dimethylnitrosamine results in increased expression of IL2RG mRNA	CTD	PMID:25380136
Il2rg	Rat	neoechinulin A	increases expression	ISO	Il2rg (Mus musculus)	6480464	neoechinulin A results in increased expression of IL2RG mRNA	CTD	PMID:19818335
Il2rg	Rat	nickel atom	increases expression	ISO	IL2RG (Homo sapiens)	6480464	Nickel results in increased expression of IL2RG mRNA	CTD	PMID:25583101
Il2rg	Rat	nickel subsulfide	affects expression	EXP		6480464	nickel subsulfide affects the expression of IL2RG mRNA	CTD	PMID:24952340
Il2rg	Rat	nitrates	multiple interactions	ISO	Il2rg (Mus musculus)	6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of IL2RG mRNA	CTD	PMID:35964746
Il2rg	Rat	oxaliplatin	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in increased expression of IL2RG mRNA	CTD	PMID:25729387
Il2rg	Rat	ozone	decreases expression	ISO	Il2rg (Mus musculus)	6480464	Ozone results in decreased expression of IL2RG mRNA	CTD	PMID:17095637
Il2rg	Rat	ozone	multiple interactions	ISO	Il2rg (Mus musculus)	6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of IL2RG mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of IL2RG mRNA	CTD	PMID:34911549
Il2rg	Rat	ozone	decreases expression	ISO	IL2RG (Homo sapiens)	6480464	Ozone results in decreased expression of IL2RG mRNA	CTD	PMID:31476115
Il2rg	Rat	ozone	multiple interactions	ISO	IL2RG (Homo sapiens)	6480464	[Aripiprazole co-treated with Ozone] results in decreased expression of IL2RG mRNA	CTD	PMID:31476115
Il2rg	Rat	paracetamol	increases expression	ISO	IL2RG (Homo sapiens)	6480464	Acetaminophen results in increased expression of IL2RG mRNA	CTD	PMID:26690555
Il2rg	Rat	perfluorohexanesulfonic acid	decreases expression	ISO	Il2rg (Mus musculus)	6480464	perfluorohexanesulfonic acid results in decreased expression of IL2RG mRNA	CTD	PMID:37995155
Il2rg	Rat	phosgene	affects expression	ISO	Il2rg (Mus musculus)	6480464	Phosgene affects the expression of IL2RG mRNA	CTD	PMID:16300373
Il2rg	Rat	pirinixic acid	multiple interactions	ISO	Il2rg (Mus musculus)	6480464	[pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of IL2RG mRNA	CTD	PMID:19710929
Il2rg	Rat	pregnenolone 16alpha-carbonitrile	increases expression	EXP		6480464	Pregnenolone Carbonitrile results in increased expression of IL2RG mRNA	CTD	PMID:30047161
Il2rg	Rat	prostaglandin E2	decreases expression	ISO	IL2RG (Homo sapiens)	6480464	Dinoprostone results in decreased expression of IL2RG	CTD	PMID:19812686
Il2rg	Rat	resveratrol	multiple interactions	ISO	IL2RG (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of IL2RG mRNA	CTD	PMID:23557933
Il2rg	Rat	S-adenosyl-L-methioninate	decreases expression	ISO	Il2rg (Mus musculus)	6480464	S-Adenosylmethionine results in decreased expression of IL2RG mRNA	CTD	PMID:18098314
Il2rg	Rat	S-adenosyl-L-methionine	decreases expression	ISO	Il2rg (Mus musculus)	6480464	S-Adenosylmethionine results in decreased expression of IL2RG mRNA	CTD	PMID:18098314
Il2rg	Rat	silicon dioxide	increases expression	ISO	Il2rg (Mus musculus)	6480464	Silicon Dioxide results in increased expression of IL2RG mRNA	CTD	PMID:23221170 and PMID:29341224
Il2rg	Rat	silicon dioxide	increases expression	ISO	IL2RG (Homo sapiens)	6480464	Silicon Dioxide results in increased expression of IL2RG mRNA	CTD	PMID:25351596
Il2rg	Rat	sirolimus	multiple interactions	ISO	Il2rg (Mus musculus)	6480464	[Sirolimus binds to FKBP1A protein] which results in decreased expression of IL2RG mRNA and [Sirolimus binds to FKBP1A protein] which results in decreased expression of IL2RG protein	CTD	PMID:12531798
Il2rg	Rat	sodium arsenite	increases expression	ISO	IL2RG (Homo sapiens)	6480464	sodium arsenite results in increased expression of IL2RG mRNA	CTD	PMID:38568856
Il2rg	Rat	sodium arsenite	increases expression	ISO	Il2rg (Mus musculus)	6480464	sodium arsenite results in increased expression of IL2RG mRNA	CTD	PMID:36209798
Il2rg	Rat	sterigmatocystin	increases expression	ISO	Il2rg (Mus musculus)	6480464	Sterigmatocystin results in increased expression of IL2RG mRNA	CTD	PMID:19818335
Il2rg	Rat	sulfadimethoxine	increases expression	EXP		6480464	Sulfadimethoxine results in increased expression of IL2RG mRNA	CTD	PMID:30047161
Il2rg	Rat	tamibarotene	decreases expression	ISO	Il2rg (Mus musculus)	6480464	tamibarotene results in decreased expression of IL2RG mRNA	CTD	PMID:20861477
Il2rg	Rat	tamoxifen	affects expression	ISO	Il2rg (Mus musculus)	6480464	Tamoxifen affects the expression of IL2RG mRNA	CTD	PMID:20937368
Il2rg	Rat	testosterone	multiple interactions	ISO	IL2RG (Homo sapiens)	6480464	[Testosterone co-treated with Calcitriol] results in increased expression of IL2RG mRNA	CTD	PMID:21592394
Il2rg	Rat	testosterone	increases expression	ISO	IL2RG (Homo sapiens)	6480464	Testosterone results in increased expression of IL2RG mRNA	CTD	PMID:21592394
Il2rg	Rat	tetrachloromethane	affects expression	ISO	Il2rg (Mus musculus)	6480464	Carbon Tetrachloride affects the expression of IL2RG mRNA	CTD	PMID:17484886
Il2rg	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of IL2RG mRNA	CTD	PMID:34492290
Il2rg	Rat	TMC-120A	increases expression	ISO	Il2rg (Mus musculus)	6480464	TMC 120A results in increased expression of IL2RG mRNA	CTD	PMID:19818335
Il2rg	Rat	toluene	increases expression	EXP		6480464	Toluene results in increased expression of IL2RG mRNA	CTD	PMID:22967744
Il2rg	Rat	topotecan	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in increased expression of IL2RG mRNA	CTD	PMID:25729387
Il2rg	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of IL2RG mRNA	CTD	PMID:20955722 and PMID:33387578
Il2rg	Rat	triphenyl phosphate	affects expression	ISO	IL2RG (Homo sapiens)	6480464	triphenyl phosphate affects the expression of IL2RG mRNA	CTD	PMID:37042841
Il2rg	Rat	zoledronic acid	multiple interactions	ISO	IL2RG (Homo sapiens)	6480464	[zoledronic acid co-treated with fluvastatin] results in increased expression of IL2RG mRNA	CTD	PMID:16996129

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Il2rg	Rat	B cell differentiation	acts_upstream_of	ISO	Il2rg (Mus musculus)	1624291	MGI:2429736 PMID:9252128	RGD	PMID:9252128
Il2rg	Rat	B cell differentiation	acts_upstream_of	IEA	UniProtKB:P34902 and ensembl:ENSMUSP00000033664	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Il2rg	Rat	CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation	acts_upstream_of	ISO	Il2rg (Mus musculus)	1624291	MGI:1857455 PMID:16227984	RGD	PMID:16227984
Il2rg	Rat	CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation	acts_upstream_of	IEA	UniProtKB:P34902 and ensembl:ENSMUSP00000033664	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Il2rg	Rat	cellular homeostasis	involved_in	ISO	IL2RG (Homo sapiens)	1624291	PMID:35021100	RGD	PMID:35021100
Il2rg	Rat	cellular homeostasis	involved_in	IEA	UniProtKB:P31785 and ensembl:ENSP00000363318	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Il2rg	Rat	gene expression	acts_upstream_of_or_within	IEA	UniProtKB:Q3V2K1 and ensembl:ENSMUSP00000098910	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Il2rg	Rat	gene expression	acts_upstream_of	ISO	Il2rg (Mus musculus)	1624291	MGI:2429736 PMID:18958875	RGD	PMID:18958875
Il2rg	Rat	gene expression	acts_upstream_of	IEA	UniProtKB:P34902 and ensembl:ENSMUSP00000033664	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Il2rg	Rat	interleukin-15-mediated signaling pathway	involved_in	ISO	IL2RG (Homo sapiens)	1624291	PMID:15123770	RGD	PMID:15123770
Il2rg	Rat	interleukin-15-mediated signaling pathway	involved_in	IEA	UniProtKB:P31785 and ensembl:ENSP00000363318	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Il2rg	Rat	interleukin-2-mediated signaling pathway	involved_in	ISO	IL2RG (Homo sapiens)	1624291	PMID:7568005	RGD	PMID:7568005
Il2rg	Rat	interleukin-2-mediated signaling pathway	involved_in	IEA	UniProtKB:P31785 and ensembl:ENSP00000363318	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Il2rg	Rat	interleukin-7-mediated signaling pathway	involved_in	ISO	IL2RG (Homo sapiens)	1624291	PMID:8128231	RGD	PMID:8128231
Il2rg	Rat	interleukin-7-mediated signaling pathway	involved_in	IEA	UniProtKB:P31785 and ensembl:ENSP00000363318	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Il2rg	Rat	interleukin-9-mediated signaling pathway	involved_in	ISO	IL2RG (Homo sapiens)	1624291	PMID:18829468	RGD	PMID:18829468
Il2rg	Rat	interleukin-9-mediated signaling pathway	involved_in	IEA	UniProtKB:P31785 and ensembl:ENSP00000363318	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Il2rg	Rat	lymphocyte differentiation	acts_upstream_of	ISO	Il2rg (Mus musculus)	1624291	MGI:5544783 PMID:23918385	RGD	PMID:23918385
Il2rg	Rat	lymphocyte differentiation	acts_upstream_of	IEA	UniProtKB:P34902 and ensembl:ENSMUSP00000033664	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Il2rg	Rat	mature B cell differentiation	acts_upstream_of	IEA	UniProtKB:P34902 and ensembl:ENSMUSP00000033664	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Il2rg	Rat	mature B cell differentiation	acts_upstream_of	ISO	Il2rg (Mus musculus)	1624291	MGI:5544783 PMID:23918385	RGD	PMID:23918385
Il2rg	Rat	positive regulation of B cell differentiation	acts_upstream_of_or_within	ISO	Il2rg (Mus musculus)	1624291	MGI:2429736 more ...	RGD	PMID:23918385 and PMID:9252128
Il2rg	Rat	positive regulation of B cell differentiation	acts_upstream_of_or_within	IEA	UniProtKB:P34902 and ensembl:ENSMUSP00000033664	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Il2rg	Rat	positive regulation of CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation	acts_upstream_of_or_within	ISO	Il2rg (Mus musculus)	1624291	MGI:1857455 PMID:16227984	RGD	PMID:16227984
Il2rg	Rat	positive regulation of CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation	acts_upstream_of_or_within	IEA	UniProtKB:P34902 and ensembl:ENSMUSP00000033664	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Il2rg	Rat	positive regulation of gene expression	acts_upstream_of_or_within	ISO	Il2rg (Mus musculus)	1624291	MGI:2429736 PMID:18958875	RGD	PMID:18958875
Il2rg	Rat	positive regulation of gene expression	acts_upstream_of_or_within	IEA	UniProtKB:P34902 and ensembl:ENSMUSP00000033664	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Il2rg	Rat	positive regulation of phagocytosis	involved_in	ISO	IL2RG (Homo sapiens)	1624291	PMID:15123770	RGD	PMID:15123770
Il2rg	Rat	positive regulation of phagocytosis	involved_in	IEA	UniProtKB:P31785 and ensembl:ENSP00000363318	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Il2rg	Rat	positive regulation of T cell differentiation in thymus	acts_upstream_of_or_within	ISO	Il2rg (Mus musculus)	1624291	MGI:1857455 more ...	RGD	PMID:9252128 and PMID:9916699
Il2rg	Rat	positive regulation of T cell differentiation in thymus	acts_upstream_of_or_within	IEA	UniProtKB:P34902 and ensembl:ENSMUSP00000033664	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Il2rg	Rat	regulation of gene expression	acts_upstream_of_or_within	ISO	Il2rg (Mus musculus)	1624291	MGI:1857455 PMID:9916699	RGD	PMID:9916699
Il2rg	Rat	regulation of gene expression	acts_upstream_of_or_within	IEA	UniProtKB:P34902 and ensembl:ENSMUSP00000033664	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Il2rg	Rat	T cell differentiation in thymus	acts_upstream_of	IEA	UniProtKB:P34902 and ensembl:ENSMUSP00000033664	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Il2rg	Rat	T cell differentiation in thymus	acts_upstream_of	ISO	Il2rg (Mus musculus)	1624291	MGI:1857455 more ...	RGD	PMID:9252128 and PMID:9916699
Il2rg	Rat	transcription by RNA polymerase II	acts_upstream_of_or_within	IEA	UniProtKB:Q3V2K1 and ensembl:ENSMUSP00000098910	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Il2rg	Rat	cell surface	located_in	ISO	IL2RG (Homo sapiens)	1624291	PMID:15123770	RGD	PMID:15123770
Il2rg	Rat	cell surface	located_in	IEA	UniProtKB:P31785 and ensembl:ENSP00000363318	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Il2rg	Rat	external side of plasma membrane	located_in	ISO	Il2rg (Mus musculus)	1624291	PMID:8262055	RGD	PMID:8262055
Il2rg	Rat	external side of plasma membrane	located_in	IEA	UniProtKB:P34902 and ensembl:ENSMUSP00000033664	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Il2rg	Rat	membrane	located_in	IEA	UniProtKB-SubCell:SL-0162	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Il2rg	Rat	membrane	located_in	IEA	InterPro:IPR003531	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Il2rg	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Il2rg	Rat	nucleoplasm	located_in	ISO	IL2RG (Homo sapiens) and UniProtKB:P31785-1	1624291		RGD	GO_REF:0000052
Il2rg	Rat	nucleoplasm	located_in	IEA	UniProtKB:P31785 and ensembl:ENSP00000363318	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Il2rg	Rat	plasma membrane	is_active_in	ISO	IL2RG (Homo sapiens)	1624291	PMID:18829468 more ...	RGD	PMID:18829468 more ...
Il2rg	Rat	plasma membrane	is_active_in	IEA	UniProtKB:P31785 and ensembl:ENSP00000363318	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Il2rg	Rat	plasma membrane	located_in	ISO	IL2RG (Homo sapiens) and UniProtKB:P31785-1	1624291		RGD	GO_REF:0000052

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Il2rg	Rat	coreceptor activity	enables	ISO	IL2RG (Homo sapiens)	1624291	PMID:18829468 more ...	RGD	PMID:18829468 more ...
Il2rg	Rat	coreceptor activity	enables	IEA	UniProtKB:P31785 and ensembl:ENSP00000363318	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Il2rg	Rat	cytokine receptor activity	enables	IEA	InterPro:IPR003531	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Il2rg	Rat	interleukin-15 receptor activity	enables	ISO	IL2RG (Homo sapiens)	1624291	PMID:15123770	RGD	PMID:15123770
Il2rg	Rat	interleukin-15 receptor activity	enables	IEA	UniProtKB:P31785 and ensembl:ENSP00000363318	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Il2rg	Rat	interleukin-2 binding	enables	IEA	UniProtKB:P34902 and ensembl:ENSMUSP00000033664	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Il2rg	Rat	interleukin-2 binding	enables	ISO	Il2rg (Mus musculus)	1624291	PR:P04351 PMID:8262055	RGD	PMID:8262055
Il2rg	Rat	protein binding	enables	ISO	IL2RG (Homo sapiens)	1624291	UniProtKB:P13232 more ...	RGD	PMID:12504082 more ...
Il2rg	Rat	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	IEA	UniProtKB:Q3V2K1 and ensembl:ENSMUSP00000098910	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Il2rg	Rat	cytokine mediated signaling pathway		IEA		6907045		KEGG	rno:04060
Il2rg	Rat	endocytosis pathway		IEA		6907045		KEGG	rno:04144
Il2rg	Rat	Jak-Stat signaling pathway		IEA		6907045		KEGG	rno:04630
Il2rg	Rat	measles pathway		IEA		6907045		KEGG	rno:05162
Il2rg	Rat	primary immunodeficiency pathway		IEA		6907045		KEGG	rno:05340

Imported Annotations - PID (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Il2rg	Rat	interleukin-12 signaling pathway		ISO	IL2RG (Homo sapiens)	6484113		PID	PID:200045
Il2rg	Rat	interleukin-2 signaling pathway		ISO	IL2RG (Homo sapiens)	6484113		PID	PID:200098
Il2rg	Rat	interleukin-4 signaling pathway		ISO	IL2RG (Homo sapiens)	6484113		PID	PID:200022

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Il2rg	Rat	decreased bone marrow cell number		IMP		13628403		RGD
Il2rg	Rat	decreased CD4-positive, alpha-beta T cell number		IMP		13628403		RGD
Il2rg	Rat	decreased CD8-positive, alpha-beta T cell number		IMP		13628403		RGD
Il2rg	Rat	decreased leukocyte cell number		IMP		2316325		RGD
Il2rg	Rat	decreased mature B cell number		IMP		13628403		RGD
Il2rg	Rat	decreased NK cell number		IMP		13628403		RGD
Il2rg	Rat	decreased T cell number		IMP		13628403		RGD
Il2rg	Rat	decreased thymocyte number		IMP		13628403		RGD
Il2rg	Rat	lymph node hypoplasia		IMP		13628403		RGD
Il2rg	Rat	spleen hypoplasia		IMP		2316325		RGD
Il2rg	Rat	spleen hypoplasia		IMP		13628403		RGD
Il2rg	Rat	thymus hypoplasia		IMP		2316325		RGD

#	Reference Title	Reference Citation
1.	Screening for mutations causing X-linked severe combined immunodeficiency in the IL-2R gamma chain gene by single-strand conformation polymorphism analysis.	Clark PA, etal., Hum Genet. 1995 Oct;96(4):427-32.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Correlation Between Relative Nasopharyngeal Virus RNA Load and Lymphocyte Count Disease Severity in Patients with COVID-19.	Liu Y, etal., Viral Immunol. 2020 Apr 10. doi: 10.1089/vim.2020.0062.
5.	Generation of knockout rats with X-linked severe combined immunodeficiency (X-SCID) using zinc-finger nucleases.	Mashimo T, etal., PLoS One. 2010 Jan 25;5(1):e8870.
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	Generation of immunodeficient rats with Rag1 and Il2rg gene deletions and human tissue grafting models.	Ménoret S, etal., Transplantation. 2018 Apr 24. doi: 10.1097/TP.0000000000002251.
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	Structural basis for binding multiple ligands by the common cytokine receptor gamma-chain.	Olosz F and Malek TR, J Biol Chem 2002 Apr 5;277(14):12047-52.
10.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
11.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
12.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
13.	GOA pipeline	RGD automated data pipeline
14.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
15.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:8262055	PMID:9252128	PMID:9916699	PMID:12477932	PMID:15123770	PMID:16227984	PMID:18958875	PMID:19946888	PMID:23918385

Il2rg
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	X	70,435,340 - 70,439,052 (-)	NCBI		GRCr8
mRatBN7.2	X	66,395,330 - 66,399,026 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	66,392,542 - 66,399,823 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	X	67,878,691 - 67,882,351 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	71,379,079 - 71,382,739 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	68,939,986 - 68,943,646 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	X	71,165,378 - 71,169,078 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	71,162,585 - 71,169,865 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	X	72,017,856 - 72,021,516 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	X	89,342,055 - 89,345,715 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	X	89,416,495 - 89,419,068 (-)	NCBI
Celera	X	66,751,239 - 66,754,899 (-)	NCBI		Celera
Cytogenetic Map	X	q22	NCBI

IL2RG
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	X	71,107,404 - 71,111,577 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	X	71,107,404 - 71,112,108 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	X	70,327,254 - 70,331,427 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	X	70,243,984 - 70,248,128 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	X	70,110,279 - 70,114,424	NCBI
Celera	X	70,681,159 - 70,685,386 (-)	NCBI		Celera
Cytogenetic Map	X	q13.1	NCBI
HuRef	X	64,146,973 - 64,150,762 (-)	NCBI		HuRef
CHM1_1	X	70,219,589 - 70,223,820 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	X	69,541,496 - 69,545,673 (-)	NCBI		T2T-CHM13v2.0

Il2rg
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	X	100,307,991 - 100,311,861 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	X	100,307,984 - 100,311,861 (-)	Ensembl		GRCm39 Ensembl
GRCm38	X	101,264,385 - 101,268,255 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	X	101,264,378 - 101,268,255 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	X	98,459,726 - 98,463,545 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	X	97,467,106 - 97,470,925 (-)	NCBI		MGSCv36	mm8
Celera	X	88,180,558 - 88,184,377 (-)	NCBI		Celera
Cytogenetic Map	X	D	NCBI
cM Map	X	43.9	NCBI

Il2rg
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955475	10,676,870 - 10,680,517 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955475	10,676,592 - 10,680,565 (-)	NCBI	ChiLan1.0	ChiLan1.0

IL2RG
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	X	70,785,171 - 70,789,380 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	X	70,788,781 - 70,792,982 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	X	60,375,815 - 60,386,936 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	X	70,433,355 - 70,437,590 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	X	70,433,360 - 70,437,590 (-)	Ensembl	panpan1.1		panPan2

IL2RG
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	X	55,480,846 - 55,488,485 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	X	55,481,092 - 55,484,751 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	X	46,308,162 - 46,311,760 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	X	56,449,759 - 56,453,658 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	X	56,450,007 - 56,453,637 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	X	54,418,234 - 54,421,830 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	X	55,749,655 - 55,753,253 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	X	55,676,806 - 55,680,404 (-)	NCBI		UU_Cfam_GSD_1.0
Dog Cytomap	X	q	NCBI

Il2rg
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	X	46,725,215 - 46,728,870 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936762	487,380 - 491,044 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936762	487,414 - 491,028 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

IL2RG
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	X	57,143,570 - 57,147,256 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	X	57,143,568 - 57,151,242 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	X	64,674,048 - 64,677,372 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3
Pig Cytomap	X	q13	NCBI

IL2RG
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	X	60,905,011 - 60,915,723 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	X	60,905,343 - 60,909,149 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666065	2,765,485 - 2,776,292 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Il2rg
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624903	1,402,481 - 1,406,600 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624903	1,402,586 - 1,406,554 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Il2rg
3 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	288
Count of miRNA genes:	177
Interacting mature miRNAs:	199
Transcripts:	ENSRNOT00000005343, ENSRNOT00000050415
Prediction methods:	Microtar, Miranda, Pita, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61430	Cia18	Collagen induced arthritis QTL 18	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	X	14843113	120568734	Rat
61431	Cia19	Collagen induced arthritis QTL 19	4.4		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	X	65612192	120568734	Rat
738035	Stresp1	Stress response QTL 1	4.96	0.000011	stress-related behavior trait (VT:0010451)	defensive burying - coping	X	41304447	112935181	Rat
1598837	Memor13	Memory QTL 13	3.2		exploratory behavior trait (VT:0010471)	difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678)	X	41052407	146860749	Rat

U21795

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	X	66,395,261 - 66,395,407 (+)	MAPPER	mRatBN7.2
Rnor_6.0	X	71,165,305 - 71,165,450	NCBI	Rnor6.0
Rnor_5.0	X	72,017,783 - 72,017,928	UniSTS	Rnor5.0
RGSC_v3.4	X	89,341,982 - 89,342,127	UniSTS	RGSC3.4
Celera	X	66,751,166 - 66,751,311	UniSTS
Cytogenetic Map	X	q31	UniSTS

PMC155645P2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	X	66,397,266 - 66,397,791 (+)	MAPPER	mRatBN7.2
Rnor_6.0	X	71,167,310 - 71,167,834	NCBI	Rnor6.0
Rnor_5.0	X	72,019,788 - 72,020,312	UniSTS	Rnor5.0
RGSC_v3.4	X	89,343,987 - 89,344,511	UniSTS	RGSC3.4
Celera	X	66,753,171 - 66,753,695	UniSTS
Cytogenetic Map	X	q31	UniSTS

Il2rg

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	X	70,435,939 - 70,436,385 (+)	Marker Load Pipeline
mRatBN7.2	X	66,395,934 - 66,396,380 (+)	MAPPER	mRatBN7.2
Rnor_6.0	X	71,165,978 - 71,166,423	NCBI	Rnor6.0
Rnor_5.0	X	72,018,456 - 72,018,901	UniSTS	Rnor5.0
RGSC_v3.4	X	89,342,655 - 89,343,100	UniSTS	RGSC3.4
Celera	X	66,751,839 - 66,752,284	UniSTS
Cytogenetic Map	X	q31	UniSTS

The following Strains have been annotated to Il2rg

F344-Prkdc^em2KyoIl2rg^em6Kyo TM-Prkdc^em4KyoIl2rg^em5Kyo

This gene Il2rg is modified in the following models/strains:

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_080889	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017601899	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063279764	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF410926	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC079343	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473966	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232752	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GU294902	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GU294903	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GU294904	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GU294905	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GU294906	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GU294907	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GU294908	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GU294909	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GU294910	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GU294911	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GU294912	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GU294913	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GU294914	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GU294915	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GU294916	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GU294917	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GU294918	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GU294919	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GU294920	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GU294921	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GU294922	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GU294923	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GU294924	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GU294925	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000021	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000005343 ⟹ ENSRNOP00000005343

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	X	66,395,336 - 66,399,017 (-)	Ensembl
Rnor_6.0 Ensembl	X	71,165,366 - 71,169,038 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000050415 ⟹ ENSRNOP00000050241

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	X	66,392,542 - 66,399,823 (-)	Ensembl
Rnor_6.0 Ensembl	X	71,162,585 - 71,169,865 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000075911

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	X	71,165,785 - 71,167,054 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000075934 ⟹ ENSRNOP00000068438

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	X	66,392,542 - 66,399,044 (-)	Ensembl
Rnor_6.0 Ensembl	X	71,165,366 - 71,168,612 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000076166

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	X	71,165,912 - 71,166,988 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000077024

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	X	71,167,829 - 71,169,032 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000102285 ⟹ ENSRNOP00000088633

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	X	66,392,542 - 66,398,386 (-)	Ensembl

RefSeq Acc Id:

NM_080889 ⟹ NP_543165

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	X	70,435,340 - 70,439,000 (-)	NCBI
mRatBN7.2	X	66,395,335 - 66,398,996 (-)	NCBI
Rnor_6.0	X	71,165,378 - 71,169,038 (-)	NCBI
Rnor_5.0	X	72,017,856 - 72,021,516 (-)	NCBI
RGSC_v3.4	X	89,342,055 - 89,345,715 (-)	RGD
Celera	X	66,751,239 - 66,754,899 (-)	RGD

Sequence:

show sequence

GAAGAGCAAGCGCCATGTTGAAACCATTATTGCCATCTAGATCCTTCTTACTCCTTCAGCTGCTTCTGCTGAGGGTAGGGTGGAGCTCCAAGGTCCTCATGTCCAGTGGGAATGAAGACACCAAATCT
GATCTCTTGCTGACTTCTATGGACCTTAAACATCTCAGTGTTCCTACTCTGCCCCTCCCAGAGGTTCAATGCTTTGTGTTCAATGTCGAGTATATGAATTGCACTTGGAATAGCAGTTCTGAGCCTCA
GCCGACCAACCTCACTATGCACTATAGGTACAAGGGATCTGATAATAATACATTCCAGGAGTGCAGCCACTATCTGTTCTCAAAAGAGATTACTTCTGGCTGTCAGATACAAAAAGAAGATATCCAGC
TCTACCAGACATTTGTTGTCCAGCTTCAGGACCCCCAGAAACCCCAGAGGCGAGCCGAACAGAAGCTAAACCTACAGAATCTTGTGATCCCATGGGCTCCAGAGAATCTAACACTTTATAACCTGAGT
GAATCTCAGGTAGAACTGAGGTGGAAAAGCAGATACATAGAACGCTGTTTACAATACTTGGTGCAGTACCGGAGCAACCGAGATCGAAGCTGGACGGAACAAATAGTGGATCATGAGCCTAGATTCTC
CCTGCCTAGTGTGGATGAACAGAAGCTGTACACATTTCGGGTTCGGAGCCGCTTTAACCCGATCTGTGGAAGTACTCAACAGTGGAGTAAATGGAGCCAACCAATCCACTGGGGGAGCCATACTGCAG
AGGAGAATCCTTCCTTGTTTGCACTGGAAGCTGTGCTTATCCCTGTTGGCACCATGGGGTTGATTATTACCCTGATCTTTGTGTACTGTTGGTTGGAACGAATGCCTCGAATTCCCGCCATCAAGAAT
CTAGAGGATCTGGTTACTGAATACCATGGGAACTTTTCGGCCTGGAGTGGTGTGTCTAAAGGGCTGACTGAGAGTCTGCAGCCAGACTACAGTGAACGGTTCTGCCACGTCAGTGAGATTCCCCCGAA
AGGAGGAGCCCTAGGAGAGGGGCCTGGAGGCTCTCCTTGCAGCCTTCATAGCCCTTACTGGCCTCCCCCATGTTATTCTCTGAAGCCTGAAGCCTGAGCCTCCAATCCCTTGATGGAACCTCAAAGTC
CTATAGCCCTAAGTGATGCTAACCTCCCCCTACACATTTTGCCAACCTGGATCCAATGCTTATTGCCTCCCGCTATGGCTAATTTTCAATTTCATGTCCCATGTAACTGCTTTTCCATTCCATACGCC
CTACTTGAGAATGCCCCTTGCCCCCTTTCCCTGCACAAGCCCTCCCGTGCCTAGTCTAGTACTTTTTCACTTTTTTTTTGAGAGAGTCTTACCCTGTAGTCCGGGGTGGCTGGGAACTTACTACGTAG
GCCAGATTGGCCTATAACTCAGAGGCGATCATCCCACTTCTTCTTCTCAAGTGTCGGCGTTCTTGGCAAGCACCACCACATCCAGCACGGCCCTCTTCTTTTACAGGATTCTCCCTCCCTTTTTCTAC
CTACCATTCAACTGTTGCCAAATCAATAAGAAATAAAGTTTTTAACCAATAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_017601899 ⟹ XP_017457388

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	X	70,436,347 - 70,439,052 (-)	NCBI
mRatBN7.2	X	66,396,342 - 66,399,026 (-)	NCBI
Rnor_6.0	X	71,166,385 - 71,169,078 (-)	NCBI

Sequence:

show sequence

GAGTGGTTCAGGGTTCTGACACAGACTACACCCAGAGAAAGAAGAGCAAGCGCCATGTTGAAACCATTATTGCCATCTAGATCCTTCTTACTCCTTCAGCTGCTTCTGCTGAGGGTAGGGTGGAGCTC
CAAGGTCCTCATGTCCAGTGGGAATGAAGACACCAAATCTGATCTCTTGCTGACTTCTATGGACCTTAAACATCTCAGTGTTCCTACTCTGCCCCTCCCAGAGGTTCAATGCTTTGTGTTCAATGTCG
AGTATATGAATTGCACTTGGAATAGCAGTTCTGAGCCTCAGCCGACCAACCTCACTATGCACTATAGGTACAAGGGATCTGATAATAATACATTCCAGGAGTGCAGCCACTATCTGTTCTCAAAAGAG
ATTACTTCTGGCTGTCAGATACAAAAAGAAGATATCCAGCTCTACCAGACATTTGTTGTCCAGCTTCAGGACCCCCAGAAACCCCAGAGGCGAGCCGAACAGAAGCTAAACCTACAGAATCTTGTGAT
CCCATGGGCTCCAGAGAATCTAACACTTTATAACCTGAGTGAATCTCAGGTAGAACTGAGGTGGAAAAGCAGATACATAGAACGCTGTTTACAATACTTGGTGCAGTACCGGAGCAACCGAGATCGAA
GCTGGACGGAACAAATAGTGGATCATGAGCCTAGATTCTCCCTGCCTAGTGTGGATGAACAGAAGCTAGAATCCTTCCTTGTTTGCACTGGAAGCTGTGCTTATCCCTGTTGGCACCATGGGGTTGAT
TATTACCCTGATCTTTGTGTACTGTTGGTTGGAACGAATGCCTCGAATTCCCGCCATCAAGAATCTAGAGGATCTGGTTACTGA

hide sequence

RefSeq Acc Id:

XM_063279764 ⟹ XP_063135834

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	X	70,436,326 - 70,439,052 (-)	NCBI


Protein RefSeqs	NP_543165	(Get FASTA)	NCBI Sequence Viewer
	XP_017457388	(Get FASTA)	NCBI Sequence Viewer
	XP_063135834	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH79343	(Get FASTA)	NCBI Sequence Viewer
	AAL61621	(Get FASTA)	NCBI Sequence Viewer
	ADC29438	(Get FASTA)	NCBI Sequence Viewer
	ADC29439	(Get FASTA)	NCBI Sequence Viewer
	ADC29440	(Get FASTA)	NCBI Sequence Viewer
	ADC29441	(Get FASTA)	NCBI Sequence Viewer
	ADC29442	(Get FASTA)	NCBI Sequence Viewer
	EDL95905	(Get FASTA)	NCBI Sequence Viewer
	EDL95906	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000005343
	ENSRNOP00000005343.4
	ENSRNOP00000050241.3
	ENSRNOP00000088633.1

RefSeq Acc Id:	NP_543165 ⟸ NM_080889
- Peptide Label:	precursor
- UniProtKB:	Q68FU6 (UniProtKB/TrEMBL), A6IQA7 (UniProtKB/TrEMBL), F7ER36 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLKPLLPSRSFLLLQLLLLRVGWSSKVLMSSGNEDTKSDLLLTSMDLKHLSVPTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTMHYRYKGSDNNTFQECSHYLFSKEITSGCQIQKEDIQLYQTF VVQLQDPQKPQRRAEQKLNLQNLVIPWAPENLTLYNLSESQVELRWKSRYIERCLQYLVQYRSNRDRSWTEQIVDHEPRFSLPSVDEQKLYTFRVRSRFNPICGSTQQWSKWSQPIHWGSHTAEENPS LFALEAVLIPVGTMGLIITLIFVYCWLERMPRIPAIKNLEDLVTEYHGNFSAWSGVSKGLTESLQPDYSERFCHVSEIPPKGGALGEGPGGSPCSLHSPYWPPPCYSLKPEA hide sequence

RefSeq Acc Id:	XP_017457388 ⟸ XM_017601899
- Peptide Label:	isoform X2
- UniProtKB:	D3JTH6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLKPLLPSRSFLLLQLLLLRVGWSSKVLMSSGNEDTKSDLLLTSMDLKHLSVPTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTMHYRYKGSDNNTFQECSHYLFSKEITSGCQIQKEDIQLYQTF VVQLQDPQKPQRRAEQKLNLQNLVIPWAPENLTLYNLSESQVELRWKSRYIERCLQYLVQYRSNRDRSWTEQIVDHEPRFSLPSVDEQKLESFLVCTGSCAYPCWHHGVDYYPDLCVLLVGTNASNSR HQESRGSGY hide sequence

Ensembl Acc Id:

ENSRNOP00000068438 ⟸ ENSRNOT00000075934

Ensembl Acc Id:

ENSRNOP00000005343 ⟸ ENSRNOT00000005343

Ensembl Acc Id:

ENSRNOP00000050241 ⟸ ENSRNOT00000050415

Protein Domains

Fibronectin type-III

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q7TP53-F1-model_v2	AlphaFold	Q7TP53	1-448	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13701872

Promoter ID:

EPDNEW_R12396

Type:

multiple initiation site

Name:

Il2rg_1

Description:

interleukin 2 receptor subunit gamma

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	X	71,169,045 - 71,169,105	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-2104	BioCyc
Ensembl Genes	ENSRNOG00000003954	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000005343	ENTREZGENE
	ENSRNOT00000005343.8	UniProtKB/TrEMBL
	ENSRNOT00000050415.7	UniProtKB/TrEMBL
	ENSRNOT00000102285.1	UniProtKB/TrEMBL
Gene3D-CATH	2.60.40.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7106866	IMAGE-MGC_LOAD
InterPro	CRLF2-like_D2	UniProtKB/TrEMBL
	CXorf65-like	UniProtKB/TrEMBL
	Fibronectin_type3	UniProtKB/TrEMBL
	FN3_sf	UniProtKB/TrEMBL
	Hempt_rcpt_S_F1_CS	UniProtKB/TrEMBL
	Ig-like_fold	UniProtKB/TrEMBL
	TSLPR_D1	UniProtKB/TrEMBL
KEGG Report	rno:140924	UniProtKB/TrEMBL
MGC_CLONE	MGC:94791	IMAGE-MGC_LOAD
NCBI Gene	140924	ENTREZGENE
PANTHER	AB2-183	UniProtKB/TrEMBL
	CYTOKINE RECEPTOR	UniProtKB/TrEMBL
	INTERLEUKIN 2 RECEPTOR SUBUNIT GAMMA	UniProtKB/TrEMBL
	PTHR33887	UniProtKB/TrEMBL
Pfam	CRLF2-like_D2	UniProtKB/TrEMBL
	Il2rg	UniProtKB/TrEMBL
	TSLPR_D1	UniProtKB/TrEMBL
PhenoGen	Il2rg	PhenoGen
PROSITE	FN3	UniProtKB/TrEMBL
	HEMATOPO_REC_S_F1	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000003954	RatGTEx
SMART	FN3	UniProtKB/TrEMBL
Superfamily-SCOP	FN_III-like	UniProtKB/TrEMBL
UniProt	A0A8I6A886_RAT	UniProtKB/TrEMBL
	A6IQA7	ENTREZGENE, UniProtKB/TrEMBL
	A6IQA8	ENTREZGENE, UniProtKB/TrEMBL
	D3JTH6	ENTREZGENE, UniProtKB/TrEMBL
	D3JTH7_RAT	UniProtKB/TrEMBL
	D3JTH8_RAT	UniProtKB/TrEMBL
	D3JTI0_RAT	UniProtKB/TrEMBL
	F7ER36	ENTREZGENE, UniProtKB/TrEMBL
	Q68FU6	ENTREZGENE
	Q7TP53_RAT	UniProtKB/TrEMBL
	Q8VHR8_RAT	UniProtKB/TrEMBL
UniProt Secondary	Q68FU6	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-11-06	Il2rg	interleukin 2 receptor, gamma	Il2rg	interleukin 2 receptor, gamma chain	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-22	Il2rg	interleukin 2 receptor, gamma chain	Il2rg	interleukin 2 receptor, gamma (severe combined immunodeficiency)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Il2rg	interleukin 2 receptor, gamma (severe combined immunodeficiency)		interleukin 2 receptor, gamma chain	Name updated	1299863	APPROVED
2002-08-07	Il2rg	interleukin 2 receptor, gamma chain			Symbol and Name status set to provisional	70820	PROVISIONAL

Note Type	Note	Reference
gene_disease	mutation causes X-linked severe combined immunodeficiency disease (X-SCID)	633044

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Mammalian Phenotype