Symbol:
Ica1
Name:
islet cell autoantigen 1
RGD ID:
621465
Description:
Enables protein domain specific binding activity. Involved in regulation of protein-containing complex assembly. Located in Golgi apparatus; dendrite; and perinuclear region of cytoplasm. Used to study diabetes mellitus. Human ortholog(s) of this gene implicated in type 1 diabetes mellitus. Orthologous to human ICA1 (islet cell autoantigen 1); PARTICIPATES IN type 1 diabetes mellitus pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
69 kDa islet cell autoantigen; ICA69; ICAp69; islet cell autoantigen 1, 69 kDa; islet cell autoantigen p69; p69
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ICA1 (islet cell autoantigen 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):
Ica1 (islet cell autoantigen 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ica1 (islet cell autoantigen 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ICA1 (islet cell autoantigen 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ICA1 (islet cell autoantigen 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ica1 (islet cell autoantigen 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ICA1 (islet cell autoantigen 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ICA1 (islet cell autoantigen 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ica1 (islet cell autoantigen 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
ICA1 (islet cell autoantigen 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Ica1 (islet cell autoantigen 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ica1 (islet cell autoantigen 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
ICA69
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
ric-19
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ica1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Candidate Gene For:
Gluco32 Gluco61
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 37,622,759 - 37,771,055 (-) NCBI GRCr8 mRatBN7.2 4 36,656,475 - 36,804,705 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 36,656,475 - 36,804,298 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 41,623,730 - 41,765,233 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 37,549,925 - 37,691,432 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 35,962,394 - 36,103,901 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 34,635,509 - 34,780,187 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 34,635,506 - 34,780,193 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 34,493,594 - 34,639,924 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 33,680,878 - 33,830,443 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 33,799,417 - 33,948,647 (-) NCBI Celera 4 32,158,705 - 32,303,677 (-) NCBI Celera Cytogenetic Map 4 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ica1 Rat 1,2-dimethylhydrazine increases expression ISO Ica1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of ICA1 mRNA CTD PMID:22206623 Ica1 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of ICA1 mRNA CTD PMID:30723492 Ica1 Rat 17alpha-ethynylestradiol affects expression ISO Ica1 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of ICA1 mRNA CTD PMID:17555576 Ica1 Rat 17alpha-ethynylestradiol multiple interactions ISO Ica1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ICA1 mRNA CTD PMID:17942748 Ica1 Rat 17alpha-ethynylestradiol increases expression ISO Ica1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of ICA1 mRNA CTD PMID:17942748 Ica1 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of ICA1 mRNA CTD PMID:32145629 Ica1 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Ica1 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Ica1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Ica1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ICA1 mRNA CTD PMID:17942748 Ica1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ICA1 mRNA CTD PMID:33387578 Ica1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ICA1 mRNA CTD PMID:34747641 Ica1 Rat 2-acetamidofluorene increases expression EXP 6480464 2-Acetylaminofluorene results in increased expression of ICA1 mRNA CTD PMID:21784091 Ica1 Rat 2-methylcholine affects expression ISO ICA1 (Homo sapiens) 6480464 beta-methylcholine affects the expression of ICA1 mRNA CTD PMID:21179406 Ica1 Rat 2-palmitoylglycerol increases expression ISO ICA1 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of ICA1 mRNA CTD PMID:37199045 Ica1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO ICA1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of ICA1 mRNA CTD PMID:28628672 Ica1 Rat 4-hydroxyphenyl retinamide increases expression ISO Ica1 (Mus musculus) 6480464 Fenretinide results in increased expression of ICA1 mRNA CTD PMID:28973697 Ica1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of ICA1 mRNA CTD PMID:31881176 Ica1 Rat acrylamide increases expression ISO Ica1 (Mus musculus) 6480464 Acrylamide results in increased expression of ICA1 mRNA CTD PMID:30807115 Ica1 Rat aflatoxin B1 decreases expression ISO ICA1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of ICA1 mRNA CTD PMID:22100608 Ica1 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of ICA1 mRNA CTD PMID:23630614 and PMID:25378103 Ica1 Rat all-trans-retinoic acid decreases expression ISO ICA1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of ICA1 mRNA CTD PMID:23724009 Ica1 Rat arsane affects methylation ISO ICA1 (Homo sapiens) 6480464 Arsenic affects the methylation of ICA1 gene CTD PMID:25304211 Ica1 Rat arsenic atom affects methylation ISO ICA1 (Homo sapiens) 6480464 Arsenic affects the methylation of ICA1 gene CTD PMID:25304211 Ica1 Rat atrazine decreases expression ISO ICA1 (Homo sapiens) 6480464 Atrazine results in decreased expression of ICA1 mRNA CTD PMID:22378314 Ica1 Rat benzo[a]pyrene decreases expression ISO Ica1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of ICA1 mRNA CTD PMID:21715664 Ica1 Rat benzo[a]pyrene increases methylation ISO ICA1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of ICA1 5' UTR CTD PMID:27901495 Ica1 Rat benzo[a]pyrene affects methylation ISO ICA1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of ICA1 promoter CTD PMID:27901495 Ica1 Rat benzo[a]pyrene multiple interactions ISO Ica1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of ICA1 mRNA CTD PMID:27858113 Ica1 Rat benzo[b]fluoranthene multiple interactions ISO Ica1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of ICA1 mRNA CTD PMID:27858113 Ica1 Rat Benzo[ghi]perylene increases expression ISO Ica1 (Mus musculus) 6480464 1 and 12-benzoperylene results in increased expression of ICA1 mRNA CTD PMID:26377693 Ica1 Rat beta-lapachone increases expression ISO ICA1 (Homo sapiens) 6480464 beta-lapachone results in increased expression of ICA1 mRNA CTD PMID:38218311 Ica1 Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of ICA1 mRNA CTD PMID:18164116 Ica1 Rat bis(2-ethylhexyl) phthalate increases methylation ISO Ica1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased methylation of ICA1 intron CTD PMID:32864567 Ica1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ICA1 mRNA CTD PMID:25181051 more ... Ica1 Rat bisphenol A multiple interactions ISO ICA1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of ICA1 gene CTD PMID:31601247 Ica1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ICA1 mRNA CTD PMID:34947998 Ica1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of ICA1 gene CTD PMID:28505145 Ica1 Rat bisphenol F multiple interactions ISO ICA1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of ICA1 mRNA CTD PMID:28628672 Ica1 Rat butan-1-ol multiple interactions ISO ICA1 (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of ICA1 mRNA CTD PMID:29432896 Ica1 Rat butanal increases expression ISO ICA1 (Homo sapiens) 6480464 butyraldehyde results in increased expression of ICA1 mRNA CTD PMID:26079696 Ica1 Rat carbon nanotube increases expression ISO Ica1 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of ICA1 mRNA CTD PMID:25554681 Ica1 Rat CGP 52608 multiple interactions ISO ICA1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to ICA1 gene] CTD PMID:28238834 Ica1 Rat chlordecone increases expression ISO Ica1 (Mus musculus) 6480464 Chlordecone results in increased expression of ICA1 mRNA CTD PMID:29980752 Ica1 Rat choline multiple interactions ISO Ica1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of ICA1 mRNA CTD PMID:20938992 Ica1 Rat chrysene multiple interactions ISO Ica1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of ICA1 mRNA CTD PMID:27858113 Ica1 Rat coumestrol multiple interactions ISO ICA1 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of ICA1 mRNA CTD PMID:19167446 Ica1 Rat crocidolite asbestos decreases expression ISO ICA1 (Homo sapiens) 6480464 Asbestos and Crocidolite results in decreased expression of ICA1 mRNA CTD PMID:29523930 Ica1 Rat cyclophosphamide affects response to substance ISO Ica1 (Mus musculus) 6480464 ICA1 protein affects the susceptibility to Cyclophosphamide CTD PMID:11751995 Ica1 Rat DDE decreases expression ISO ICA1 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of ICA1 mRNA CTD PMID:38568856 Ica1 Rat dexamethasone multiple interactions ISO ICA1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of ICA1 mRNA CTD PMID:28628672 Ica1 Rat diethyl phthalate decreases expression EXP 6480464 diethyl phthalate results in decreased expression of ICA1 mRNA CTD PMID:32341500 Ica1 Rat dorsomorphin multiple interactions ISO ICA1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ICA1 mRNA CTD PMID:27188386 Ica1 Rat doxorubicin decreases expression ISO ICA1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of ICA1 mRNA CTD PMID:29803840 Ica1 Rat elemental selenium multiple interactions ISO ICA1 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of ICA1 mRNA CTD PMID:19244175 Ica1 Rat elemental selenium increases expression ISO ICA1 (Homo sapiens) 6480464 Selenium results in increased expression of ICA1 mRNA CTD PMID:19244175 Ica1 Rat Enterolactone multiple interactions ISO ICA1 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of ICA1 mRNA CTD PMID:19167446 Ica1 Rat epoxiconazole decreases expression ISO Ica1 (Mus musculus) 6480464 epoxiconazole results in decreased expression of ICA1 mRNA CTD PMID:35436446 Ica1 Rat ethanol affects splicing ISO Ica1 (Mus musculus) 6480464 Ethanol affects the splicing of ICA1 mRNA CTD PMID:30319688 Ica1 Rat ethanol increases expression ISO Ica1 (Mus musculus) 6480464 Ethanol results in increased expression of ICA1 mRNA CTD PMID:30319688 Ica1 Rat folic acid multiple interactions ISO Ica1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of ICA1 mRNA CTD PMID:20938992 Ica1 Rat fulvestrant multiple interactions ISO ICA1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of ICA1 gene CTD PMID:31601247 Ica1 Rat furan increases expression EXP 6480464 furan results in increased expression of ICA1 mRNA CTD PMID:25539665 more ... Ica1 Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of ICA1 mRNA CTD PMID:21396975 Ica1 Rat indometacin multiple interactions ISO ICA1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of ICA1 mRNA CTD PMID:28628672 Ica1 Rat L-methionine multiple interactions ISO Ica1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of ICA1 mRNA CTD PMID:20938992 Ica1 Rat menadione affects expression ISO ICA1 (Homo sapiens) 6480464 Vitamin K 3 affects the expression of ICA1 mRNA CTD PMID:20044591 Ica1 Rat methylparaben increases expression ISO ICA1 (Homo sapiens) 6480464 methylparaben results in increased expression of ICA1 mRNA CTD PMID:31745603 Ica1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of ICA1 mRNA and [Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of ICA1 mRNA CTD PMID:18164116 and PMID:28943392 Ica1 Rat N-nitrosodiethylamine multiple interactions ISO Ica1 (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in increased expression of ICA1 mRNA CTD PMID:24535843 Ica1 Rat N-nitrosodiethylamine increases expression ISO Ica1 (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of ICA1 mRNA CTD PMID:24535843 Ica1 Rat ozone multiple interactions ISO Ica1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of ICA1 mRNA CTD PMID:34911549 Ica1 Rat p-toluidine increases expression EXP 6480464 4-toluidine results in increased expression of ICA1 mRNA CTD PMID:27638505 Ica1 Rat paracetamol affects expression ISO Ica1 (Mus musculus) 6480464 Acetaminophen affects the expression of ICA1 mRNA CTD PMID:17562736 Ica1 Rat paracetamol decreases expression ISO ICA1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of ICA1 mRNA CTD PMID:29067470 Ica1 Rat pentanal increases expression ISO ICA1 (Homo sapiens) 6480464 pentanal results in increased expression of ICA1 mRNA CTD PMID:26079696 Ica1 Rat perfluorohexanesulfonic acid decreases expression ISO Ica1 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in decreased expression of ICA1 mRNA CTD PMID:37995155 Ica1 Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of ICA1 mRNA CTD PMID:19162173 Ica1 Rat phenobarbital multiple interactions ISO Ica1 (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in increased expression of ICA1 mRNA CTD PMID:24535843 Ica1 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of ICA1 mRNA CTD PMID:19162173 Ica1 Rat propanal increases expression ISO ICA1 (Homo sapiens) 6480464 propionaldehyde results in increased expression of ICA1 mRNA CTD PMID:26079696 Ica1 Rat prothioconazole increases expression ISO ICA1 (Homo sapiens) 6480464 prothioconazole results in increased expression of ICA1 mRNA CTD PMID:35048155 Ica1 Rat SB 431542 multiple interactions ISO ICA1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ICA1 mRNA CTD PMID:27188386 Ica1 Rat selenium atom multiple interactions ISO ICA1 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of ICA1 mRNA CTD PMID:19244175 Ica1 Rat selenium atom increases expression ISO ICA1 (Homo sapiens) 6480464 Selenium results in increased expression of ICA1 mRNA CTD PMID:19244175 Ica1 Rat silicon dioxide affects expression ISO ICA1 (Homo sapiens) 6480464 Silicon Dioxide analog affects the expression of ICA1 mRNA CTD PMID:25895662 Ica1 Rat sodium arsenite increases expression ISO ICA1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of ICA1 mRNA CTD PMID:29301061 Ica1 Rat sodium arsenite decreases expression ISO ICA1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of ICA1 mRNA CTD PMID:34032870 Ica1 Rat sunitinib decreases expression ISO ICA1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of ICA1 mRNA CTD PMID:31533062 Ica1 Rat tetrachloromethane affects expression ISO Ica1 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of ICA1 mRNA CTD PMID:17484886 Ica1 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of ICA1 mRNA CTD PMID:21784091 more ... Ica1 Rat tetraphene multiple interactions ISO Ica1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of ICA1 mRNA CTD PMID:27858113 Ica1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of ICA1 mRNA CTD PMID:21784091 and PMID:23411599 Ica1 Rat thioacetamide multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of ICA1 mRNA CTD PMID:28943392 Ica1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of ICA1 mRNA CTD PMID:33387578 Ica1 Rat trimellitic anhydride decreases expression ISO Ica1 (Mus musculus) 6480464 trimellitic anhydride results in decreased expression of ICA1 mRNA CTD PMID:19042947 Ica1 Rat triphenyl phosphate affects expression ISO ICA1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of ICA1 mRNA CTD PMID:37042841 Ica1 Rat valproic acid decreases expression ISO ICA1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of ICA1 mRNA CTD PMID:29154799 Ica1 Rat valproic acid multiple interactions ISO ICA1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ICA1 mRNA CTD PMID:27188386 Ica1 Rat valproic acid increases expression ISO ICA1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of ICA1 mRNA CTD PMID:26272509 Ica1 Rat vanadyl sulfate decreases expression ISO ICA1 (Homo sapiens) 6480464 vanadyl sulfate results in decreased expression of ICA1 mRNA CTD PMID:16330358 Ica1 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of ICA1 mRNA CTD PMID:23034163 Ica1 Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of ICA1 gene CTD PMID:31682807 Ica1 Rat vitamin E multiple interactions ISO ICA1 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of ICA1 mRNA CTD PMID:19244175 Ica1 Rat vitamin E increases expression ISO ICA1 (Homo sapiens) 6480464 Vitamin E results in increased expression of ICA1 mRNA CTD PMID:19244175
Imported Annotations - KEGG (archival)
1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-acetamidofluorene (EXP) 2-methylcholine (ISO) 2-palmitoylglycerol (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4-hydroxyphenyl retinamide (ISO) acetamide (EXP) acrylamide (ISO) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (ISO) arsane (ISO) arsenic atom (ISO) atrazine (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) Benzo[ghi]perylene (ISO) beta-lapachone (ISO) beta-naphthoflavone (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) butan-1-ol (ISO) butanal (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlordecone (ISO) choline (ISO) chrysene (ISO) coumestrol (ISO) crocidolite asbestos (ISO) cyclophosphamide (ISO) DDE (ISO) dexamethasone (ISO) diethyl phthalate (EXP) dorsomorphin (ISO) doxorubicin (ISO) elemental selenium (ISO) Enterolactone (ISO) epoxiconazole (ISO) ethanol (ISO) folic acid (ISO) fulvestrant (ISO) furan (EXP) indole-3-methanol (EXP) indometacin (ISO) L-methionine (ISO) menadione (ISO) methylparaben (ISO) N-nitrosodiethylamine (EXP,ISO) ozone (ISO) p-toluidine (EXP) paracetamol (ISO) pentanal (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctanoic acid (EXP) phenobarbital (ISO) pirinixic acid (EXP) propanal (ISO) prothioconazole (ISO) SB 431542 (ISO) selenium atom (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sunitinib (ISO) tetrachloromethane (EXP,ISO) tetraphene (ISO) thioacetamide (EXP) trichloroethene (EXP) trimellitic anhydride (ISO) triphenyl phosphate (ISO) valproic acid (ISO) vanadyl sulfate (ISO) vinclozolin (EXP) vitamin E (ISO)
Cellular Component
cytoplasm (IEA) cytoplasmic vesicle (IEA) cytosol (IEA,ISO,ISS) dendrite (IDA) endomembrane system (IEA) Golgi apparatus (IBA,IEA) Golgi membrane (IDA,IEA,ISO,ISS) Golgi stack (IDA) intracellular membrane-bounded organelle (IEA,ISO) membrane (IEA) perinuclear region of cytoplasm (IDA) secretory granule membrane (IEA,ISO,ISS) synapse (IEA) synaptic vesicle membrane (IEA,ISO,ISS) transport vesicle membrane (IEA)
1.
PICK1-ICA69 heteromeric BAR domain complex regulates synaptic targeting and surface expression of AMPA receptors.
Cao M, etal., J Neurosci. 2007 Nov 21;27(47):12945-56.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
Reduced thymic expression of islet antigen contributes to loss of self-tolerance.
Mathews CE, etal., Ann N Y Acad Sci. 2003 Nov;1005:412-7.
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
Cloning of human and rat p69 cDNA, a candidate autoimmune target in type 1 diabetes.
Miyazaki I, etal., Biochim Biophys Acta 1994 Oct 21;1227(1-2):101-4.
7.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
9.
GOA pipeline
RGD automated data pipeline
10.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
12.
HLA-associated inverse correlation between T cell and antibody responsiveness to islet autoantigen in recent-onset insulin-dependent diabetes mellitus.
Roep BO, etal., Eur J Immunol. 1996 Jun;26(6):1285-9.
13.
Islet cell autoantigen of 69 kDa is an arfaptin-related protein associated with the Golgi complex of insulinoma INS-1 cells.
Spitzenberger F, etal., J Biol Chem 2003 Jul 11;278(28):26166-73.
14.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
15.
ICA69(null) nonobese diabetic mice develop diabetes, but resist disease acceleration by cyclophosphamide.
Winer S, etal., J Immunol. 2002 Jan 1;168(1):475-82.
Ica1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 37,622,759 - 37,771,055 (-) NCBI GRCr8 mRatBN7.2 4 36,656,475 - 36,804,705 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 36,656,475 - 36,804,298 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 41,623,730 - 41,765,233 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 37,549,925 - 37,691,432 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 35,962,394 - 36,103,901 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 34,635,509 - 34,780,187 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 34,635,506 - 34,780,193 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 34,493,594 - 34,639,924 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 33,680,878 - 33,830,443 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 33,799,417 - 33,948,647 (-) NCBI Celera 4 32,158,705 - 32,303,677 (-) NCBI Celera Cytogenetic Map 4 q21 NCBI
ICA1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 8,113,184 - 8,262,555 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 8,113,184 - 8,262,687 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 8,152,814 - 8,302,185 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 8,119,339 - 8,268,710 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 7,926,643 - 8,075,008 NCBI Celera 7 8,120,520 - 8,269,877 (-) NCBI Celera Cytogenetic Map 7 p21.3 NCBI HuRef 7 8,002,616 - 8,152,148 (-) NCBI HuRef CHM1_1 7 8,152,546 - 8,301,969 (-) NCBI CHM1_1 T2T-CHM13v2.0 7 8,231,684 - 8,381,157 (-) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 8,198,979 - 8,348,384 (-) NCBI
Ica1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 8,630,527 - 8,778,531 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 8,630,527 - 8,778,488 (-) Ensembl GRCm39 Ensembl GRCm38 6 8,630,527 - 8,778,540 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 8,630,527 - 8,778,488 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 8,580,527 - 8,728,484 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 8,580,527 - 8,728,095 (-) NCBI MGSCv36 mm8 Celera 6 8,763,268 - 8,911,580 (-) NCBI Celera Cytogenetic Map 6 A1 NCBI cM Map 6 4.38 NCBI
Ica1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955432 15,136,757 - 15,269,125 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955432 15,136,606 - 15,297,415 (-) NCBI ChiLan1.0 ChiLan1.0
ICA1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 13,013,277 - 13,167,399 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 61,337,989 - 61,492,116 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 8,838,319 - 8,992,433 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 8,187,748 - 8,340,829 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 8,188,479 - 8,314,556 (-) Ensembl panpan1.1 panPan2
ICA1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 14 23,673,739 - 23,816,850 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 14 23,673,758 - 23,796,462 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 14 23,248,756 - 23,391,657 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 14 23,488,679 - 23,631,110 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 14 23,483,120 - 23,630,707 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 14 23,640,101 - 23,783,180 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 14 23,379,186 - 23,521,194 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 14 23,631,393 - 23,773,055 (-) NCBI UU_Cfam_GSD_1.0
Ica1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 37,005,982 - 37,151,681 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936585 1,711,976 - 1,857,861 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936585 1,711,863 - 1,857,861 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ICA1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 78,332,393 - 78,515,087 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 78,364,478 - 78,515,092 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 86,173,296 - 86,215,276 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ICA1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 21 49,938,697 - 50,094,024 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 21 49,938,503 - 50,093,874 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666042 54,304,161 - 54,461,847 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ica1
.
Predicted Target Of
Count of predictions: 141 Count of miRNA genes: 115 Interacting mature miRNAs: 118 Transcripts: ENSRNOT00000011651 Prediction methods: Microtar, Rnahybrid, Targetscan Result types: miRGate_prediction
2302371 Stl22 Serum triglyceride level QTL 22 5.15 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 4 5218294 57114705 Rat 2303585 Bw86 Body weight QTL 86 4 body mass (VT:0001259) body weight (CMO:0000012) 4 14678065 59678065 Rat 8552906 Pigfal3 Plasma insulin-like growth factor 1 level QTL 3 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 4 10084089 55084089 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 8655949 Rf62 Renal function QTL 62 22 blood urea nitrogen amount (VT:0005265) plasma urea nitrogen level (CMO:0000586) 4 34430119 44463908 Rat 6478766 Anxrr47 Anxiety related response QTL 47 0.09637 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 4 10084089 55084089 Rat 8552782 Vie1 Viral induced encephalitis QTL 1 26.4 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 4 34430484 82490359 Rat 70222 Eae2 Experimental allergic encephalomyelitis QTL 2 4.3 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 4 21333343 39505420 Rat 631642 Stl2 Serum triglyceride level QTL 2 3.3 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 4 5219178 56647776 Rat 6478769 Anxrr48 Anxiety related response QTL 48 0.02514 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 10084089 55084089 Rat 631261 Tcas3 Tongue tumor susceptibility QTL 3 6.88 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 4 10814170 91360527 Rat 634323 Hc2 Hypercalciuria QTL 2 2.15 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 4 210796 45210796 Rat 2313401 Anxrr27 Anxiety related response QTL 27 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 4 17933508 62933508 Rat 8655961 Kidm43 Kidney mass QTL 43 18 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 4 36303261 103194984 Rat 631209 Bw2 Body weight QTL2 4.2 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 4 9940885 44463908 Rat 6909128 Pancm4 Pancreatic morphology QTL 4 11.35 pancreas mass (VT:0010144) pancreas wet weight (CMO:0000626) 4 26907285 75585128 Rat 8694374 Bw155 Body weight QTL 155 3.39 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 4 10084089 55084089 Rat 2303168 Bp330 Blood pressure QTL 330 4.25 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 5214602 146446691 Rat 8552801 Bw143 Body weight QTL 143 7.3 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 4 34430484 82490359 Rat 61412 Pia2 Pristane induced arthritis QTL 2 3.9 joint integrity trait (VT:0010548) post-insult time to onset of experimental arthritis (CMO:0001450) 4 21333343 62278020 Rat 6478724 Anxrr35 Anxiety related response QTL 35 0.00449 defecation behavior trait (VT:0010462) defecation measurement (CMO:0000997) 4 10084089 55084089 Rat 8655906 Rf60 Renal function QTL 60 3.8 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 4 29494195 81006281 Rat 61415 Eae11 Experimental allergic encephalomyelitis QTL 11 2.9 nervous system integrity trait (VT:0010566) post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422) 4 1 39505420 Rat 619616 Bp79 Blood pressure QTL 79 0.0292 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 5214602 78882945 Rat 7387227 Uae40 Urinary albumin excretion QTL 40 2.9 0.0052 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 4 17946999 62946999 Rat 6909122 Insul22 Insulin level QTL 22 4.63 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 4 26907285 75585128 Rat 8552809 Vie5 Viral induced encephalitis QTL 5 25.3 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 4 34430484 82490359 Rat 1358203 Stl19 Serum triglyceride level QTL 19 2.8 0.002 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 4 5218294 65958103 Rat 9590304 Scort17 Serum corticosterone level QTL 17 4.96 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 10084089 55084089 Rat 12798520 Anxrr55 Anxiety related response QTL 55 4.45 0.01 locomotor behavior trait (VT:0001392) number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715) 4 32583980 114627242 Rat 11530004 Niddm71 Non-insulin dependent diabetes mellitus QTL 71 0.001 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 4 32584199 52754138 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 1354665 Stl10 Serum triglyceride level QTL 10 3.57 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 4 21333343 44463908 Rat 1300141 Bp178 Blood pressure QTL 178 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 10024901 39524530 Rat
D4Got205
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 36,750,101 - 36,750,323 (+) MAPPER mRatBN7.2 Rnor_6.0 4 34,725,599 - 34,725,820 NCBI Rnor6.0 Rnor_5.0 4 34,584,684 - 34,584,905 UniSTS Rnor5.0 RGSC_v3.4 4 33,775,174 - 33,775,395 UniSTS RGSC3.4 Celera 4 32,249,385 - 32,249,609 UniSTS Cytogenetic Map 4 q21 UniSTS
BF419765
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 36,738,868 - 36,739,055 (+) MAPPER mRatBN7.2 Rnor_6.0 4 34,714,016 - 34,714,202 NCBI Rnor6.0 Rnor_5.0 4 34,573,101 - 34,573,287 UniSTS Rnor5.0 RGSC_v3.4 4 33,763,941 - 33,764,127 UniSTS RGSC3.4 Celera 4 32,238,183 - 32,238,369 UniSTS RH 3.4 Map 4 200.0 UniSTS Cytogenetic Map 4 q21 UniSTS
AA800371
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 36,788,748 - 36,788,912 (+) MAPPER mRatBN7.2 Rnor_6.0 4 34,764,181 - 34,764,344 NCBI Rnor6.0 Rnor_5.0 4 34,623,932 - 34,624,095 UniSTS Rnor5.0 RGSC_v3.4 4 33,814,557 - 33,814,720 UniSTS RGSC3.4 Celera 4 32,287,791 - 32,287,954 UniSTS RH 3.4 Map 4 200.5 UniSTS Cytogenetic Map 4 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000011651 ⟹ ENSRNOP00000011651
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 36,656,475 - 36,804,298 (-) Ensembl Rnor_6.0 Ensembl 4 34,635,506 - 34,780,193 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000077329 ⟹ ENSRNOP00000075191
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 36,656,475 - 36,804,298 (-) Ensembl Rnor_6.0 Ensembl 4 34,635,509 - 34,779,776 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000100899 ⟹ ENSRNOP00000086969
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 36,656,475 - 36,804,298 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000118007 ⟹ ENSRNOP00000095862
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 36,656,475 - 36,783,242 (-) Ensembl
RefSeq Acc Id:
NM_030844 ⟹ NP_110471
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 37,622,759 - 37,770,905 (-) NCBI mRatBN7.2 4 36,656,475 - 36,804,634 (-) NCBI Rnor_6.0 4 34,635,509 - 34,780,107 (-) NCBI Rnor_5.0 4 34,493,594 - 34,639,924 (-) NCBI RGSC_v3.4 4 33,680,878 - 33,830,443 (-) RGD Celera 4 32,158,705 - 32,303,677 (-) RGD
Sequence:
CGGGAAGACCCCAGGGAGTAGAGAGAGGGACACTCACGCCTCTCATCCCTGATCCGCCCCAAACAAGGAAAATGGTTCGATGTTATTAAAAATGAATCTTAAGAAGAAAAATGAATCACAGCAGTTAA
hide sequence
RefSeq Acc Id:
XM_006236092 ⟹ XP_006236154
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 37,622,759 - 37,770,716 (-) NCBI mRatBN7.2 4 36,656,475 - 36,804,425 (-) NCBI Rnor_6.0 4 34,635,509 - 34,779,908 (-) NCBI Rnor_5.0 4 34,493,594 - 34,639,924 (-) NCBI
Sequence:
CTGCGCTGCGGCGCGCACAGGCTCCGGGCTGCTATTCCGGCTGGCGGCGGCCGCTGCAGGAAGGACCGCTTCCTGCGCTCCCCGCCCCTTCCCTCGCCAGTGCTGACGCTGACGTCGGCGCAGGGAGC
hide sequence
RefSeq Acc Id:
XM_006236093 ⟹ XP_006236155
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 37,622,759 - 37,770,709 (-) NCBI mRatBN7.2 4 36,656,475 - 36,804,426 (-) NCBI Rnor_6.0 4 34,635,509 - 34,779,908 (-) NCBI Rnor_5.0 4 34,493,594 - 34,639,924 (-) NCBI
Sequence:
CTGCGCTGCGGCGCGCACAGGCTCCGGGCTGCTATTCCGGCTGGCGGCGGCCGCTGCAGGAAGGACCGCTTCCTGCGCTCCCCGCCCCTTCCCTCGCCAGTGCTGACGCTGACGTCGGCGCAGGGAGC
hide sequence
RefSeq Acc Id:
XM_006236094 ⟹ XP_006236156
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 37,622,759 - 37,770,725 (-) NCBI mRatBN7.2 4 36,656,475 - 36,804,426 (-) NCBI Rnor_6.0 4 34,635,509 - 34,779,908 (-) NCBI Rnor_5.0 4 34,493,594 - 34,639,924 (-) NCBI
Sequence:
CTGCGCTGCGGCGCGCACAGGCTCCGGGCTGCTATTCCGGCTGGCGGCGGCCGCTGCAGGAAGG
hide sequence
RefSeq Acc Id:
XM_006236095 ⟹ XP_006236157
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 37,622,759 - 37,771,055 (-) NCBI mRatBN7.2 4 36,656,475 - 36,804,702 (-) NCBI Rnor_6.0 4 34,635,509 - 34,780,187 (-) NCBI Rnor_5.0 4 34,493,594 - 34,639,924 (-) NCBI
Sequence:
TGGAACACCTGCCAGAGAGCAGGGGCGGGGTCATCTCTGGCAGCAGGTCCAAAAGCCGGGTACCCTAGAGATGGGGGTCACGGGAAGACCCCAGGGAGTAGAGAGAGGGACACTCACGCCTCTCATCC
hide sequence
RefSeq Acc Id:
XM_039108416 ⟹ XP_038964344
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 37,622,759 - 37,770,994 (-) NCBI mRatBN7.2 4 36,656,475 - 36,804,705 (-) NCBI
RefSeq Acc Id:
XM_063286738 ⟹ XP_063142808
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 37,622,759 - 37,770,994 (-) NCBI
RefSeq Acc Id:
XM_063286739 ⟹ XP_063142809
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 37,622,759 - 37,770,716 (-) NCBI
RefSeq Acc Id:
XM_063286740 ⟹ XP_063142810
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 37,622,759 - 37,770,994 (-) NCBI
RefSeq Acc Id:
XM_063286741 ⟹ XP_063142811
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 37,622,759 - 37,770,716 (-) NCBI
RefSeq Acc Id:
XM_063286742 ⟹ XP_063142812
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 37,622,759 - 37,770,992 (-) NCBI
RefSeq Acc Id:
XM_063286743 ⟹ XP_063142813
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 37,622,759 - 37,770,681 (-) NCBI
RefSeq Acc Id:
NP_110471 ⟸ NM_030844
- UniProtKB:
Q6P3W0 (UniProtKB/Swiss-Prot), Q63054 (UniProtKB/Swiss-Prot), Q6AZ05 (UniProtKB/TrEMBL), A6IDX8 (UniProtKB/TrEMBL), A0A0G2K9Z2 (UniProtKB/TrEMBL)
- Sequence:
MSGHKCYSWELQDRFAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFSSQQRLA
hide sequence
RefSeq Acc Id:
XP_006236157 ⟸ XM_006236095
- Peptide Label:
isoform X1
- UniProtKB:
Q6P3W0 (UniProtKB/Swiss-Prot), Q63054 (UniProtKB/Swiss-Prot), Q6AZ05 (UniProtKB/TrEMBL), A6IDX8 (UniProtKB/TrEMBL), A0A0G2K9Z2 (UniProtKB/TrEMBL)
- Sequence:
MSGHKCYSWELQDRFAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFSSQQRLA
hide sequence
RefSeq Acc Id:
XP_006236156 ⟸ XM_006236094
- Peptide Label:
isoform X1
- UniProtKB:
Q6P3W0 (UniProtKB/Swiss-Prot), Q63054 (UniProtKB/Swiss-Prot), Q6AZ05 (UniProtKB/TrEMBL), A6IDX8 (UniProtKB/TrEMBL), A0A0G2K9Z2 (UniProtKB/TrEMBL)
- Sequence:
MSGHKCYSWELQDRFAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFSSQQRLA
hide sequence
RefSeq Acc Id:
XP_006236154 ⟸ XM_006236092
- Peptide Label:
isoform X1
- UniProtKB:
Q6P3W0 (UniProtKB/Swiss-Prot), Q63054 (UniProtKB/Swiss-Prot), Q6AZ05 (UniProtKB/TrEMBL), A6IDX8 (UniProtKB/TrEMBL), A0A0G2K9Z2 (UniProtKB/TrEMBL)
- Sequence:
MSGHKCYSWELQDRFAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFSSQQRLA
hide sequence
RefSeq Acc Id:
XP_006236155 ⟸ XM_006236093
- Peptide Label:
isoform X1
- UniProtKB:
Q6P3W0 (UniProtKB/Swiss-Prot), Q63054 (UniProtKB/Swiss-Prot), Q6AZ05 (UniProtKB/TrEMBL), A6IDX8 (UniProtKB/TrEMBL), A0A0G2K9Z2 (UniProtKB/TrEMBL)
- Sequence:
MSGHKCYSWELQDRFAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFSSQQRLA
hide sequence
Ensembl Acc Id:
ENSRNOP00000011651 ⟸ ENSRNOT00000011651
Ensembl Acc Id:
ENSRNOP00000075191 ⟸ ENSRNOT00000077329
RefSeq Acc Id:
XP_038964344 ⟸ XM_039108416
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6A739 (UniProtKB/TrEMBL), A6IDX7 (UniProtKB/TrEMBL), F7FFT7 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000095862 ⟸ ENSRNOT00000118007
Ensembl Acc Id:
ENSRNOP00000086969 ⟸ ENSRNOT00000100899
RefSeq Acc Id:
XP_063142810 ⟸ XM_063286740
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6A739 (UniProtKB/TrEMBL), A6IDX7 (UniProtKB/TrEMBL), F7FFT7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063142808 ⟸ XM_063286738
- Peptide Label:
isoform X1
- UniProtKB:
Q6P3W0 (UniProtKB/Swiss-Prot), Q63054 (UniProtKB/Swiss-Prot), A0A0G2K9Z2 (UniProtKB/TrEMBL), A6IDX8 (UniProtKB/TrEMBL), Q6AZ05 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063142812 ⟸ XM_063286742
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6A739 (UniProtKB/TrEMBL), A6IDX7 (UniProtKB/TrEMBL), F7FFT7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063142811 ⟸ XM_063286741
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6A739 (UniProtKB/TrEMBL), A6IDX7 (UniProtKB/TrEMBL), F7FFT7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063142809 ⟸ XM_063286739
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6A739 (UniProtKB/TrEMBL), A6IDX7 (UniProtKB/TrEMBL), F7FFT7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063142813 ⟸ XM_063286743
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6A739 (UniProtKB/TrEMBL), A6IDX7 (UniProtKB/TrEMBL), F7FFT7 (UniProtKB/TrEMBL)
RGD ID: 13692880 Promoter ID: EPDNEW_R3400 Type: initiation region Name: Ica1_1 Description: islet cell autoantigen 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R3401 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 4 34,779,810 - 34,779,870 EPDNEW
RGD ID: 13692876 Promoter ID: EPDNEW_R3401 Type: initiation region Name: Ica1_2 Description: islet cell autoantigen 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R3400 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 4 34,780,155 - 34,780,215 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-01-20
Ica1
islet cell autoantigen 1
islet cell autoantigen 1, 69 kDa
Name updated
1299863 APPROVED
2002-08-07
Ica1
islet cell autoantigen 1, 69 kDa
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_cellular_localization
associated with membrane trafficking at the Golgi complex and immature secretory granules in neurosecretory cells
633043
gene_cellular_localization
associated with membrane trafficking at the Golgi complex and immature secretory granules in neurosecretory cells
724603
gene_expression
expressed in neurons and insulinoma INS-1 cells
724603
gene_protein
cytosolic protein 69 kDa in size
724603
