Symbol:
Gpc2
Name:
glypican 2
RGD ID:
621363
Description:
Involved in neuron differentiation; positive regulation of neuron projection development; and smoothened signaling pathway. Predicted to be located in endoplasmic reticulum. Predicted to be active in cell surface and synapse. Orthologous to human GPC2 (glypican 2); PARTICIPATES IN Hedgehog signaling pathway; glypican signaling pathway; INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,2',5,5'-tetrachlorobiphenyl.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
cerebroglycan; glypican 2 (cerebroglycan); glypican-2; HSPG M13
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
GPC2 (glypican 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Gpc2 (glypican 2 cerebroglycan) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Gpc2 (glypican 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
GPC2 (glypican 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
GPC2 (glypican 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Gpc2 (glypican 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
GPC2 (glypican 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
GPC2 (glypican 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Gpc2 (glypican 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
CCL25 (C-C motif chemokine ligand 25) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
GPC2 (glypican 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Gpc2 (glypican 2 cerebroglycan)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
gpc2 (glypican 2)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PhylomeDB)
Caenorhabditis elegans (roundworm):
gpn-1
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
dlp
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
gpc2
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 22,391,489 - 22,397,822 (-) NCBI GRCr8 mRatBN7.2 12 17,277,875 - 17,284,297 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 17,277,875 - 17,284,208 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 18,244,924 - 18,251,250 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 18,868,646 - 18,874,972 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 17,922,063 - 17,928,389 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 19,593,041 - 19,599,374 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 19,593,041 - 19,599,374 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 21,649,636 - 21,655,969 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 17,858,354 - 17,864,687 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 17,847,875 - 17,854,209 (-) NCBI Celera 12 19,202,336 - 19,208,665 (-) NCBI Celera Cytogenetic Map 12 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Gpc2 Rat 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of GPC2 mRNA CTD PMID:15212814 Gpc2 Rat 17beta-estradiol multiple interactions ISO GPC2 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of GPC2 mRNA CTD PMID:30165855 Gpc2 Rat 17beta-estradiol multiple interactions EXP 6480464 [Testosterone co-treated with Estradiol] results in increased expression of GPC2 mRNA CTD PMID:32741896 Gpc2 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Gpc2 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Gpc2 Rat 2,2',5,5'-tetrachlorobiphenyl increases expression EXP 6480464 2 more ... CTD PMID:23829299 Gpc2 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Gpc2 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Gpc2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of GPC2 mRNA CTD PMID:19490992 and PMID:33387578 Gpc2 Rat 4,4'-sulfonyldiphenol decreases methylation ISO Gpc2 (Mus musculus) 6480464 bisphenol S results in decreased methylation of GPC2 exon CTD PMID:33297965 Gpc2 Rat 4,4'-sulfonyldiphenol affects methylation ISO Gpc2 (Mus musculus) 6480464 bisphenol S affects the methylation of GPC2 gene CTD PMID:31683443 Gpc2 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of GPC2 mRNA CTD PMID:24780913 Gpc2 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of GPC2 mRNA CTD PMID:31881176 Gpc2 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of GPC2 mRNA CTD PMID:28959563 Gpc2 Rat acrylamide decreases expression ISO GPC2 (Homo sapiens) 6480464 Acrylamide results in decreased expression of GPC2 mRNA CTD PMID:32763439 Gpc2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of GPC2 mRNA CTD PMID:16483693 Gpc2 Rat atrazine increases expression ISO GPC2 (Homo sapiens) 6480464 Atrazine results in increased expression of GPC2 mRNA CTD PMID:22378314 Gpc2 Rat benzo[a]pyrene increases expression ISO GPC2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of GPC2 mRNA CTD PMID:32234424 Gpc2 Rat bis(2-ethylhexyl) phthalate increases expression ISO Gpc2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of GPC2 mRNA CTD PMID:28085963 Gpc2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of GPC2 mRNA CTD PMID:25181051 Gpc2 Rat bisphenol A decreases expression ISO Gpc2 (Mus musculus) 6480464 bisphenol A results in decreased expression of GPC2 mRNA CTD PMID:32156529 Gpc2 Rat bisphenol A increases methylation ISO Gpc2 (Mus musculus) 6480464 bisphenol A results in increased methylation of GPC2 promoter CTD PMID:27312807 Gpc2 Rat butanal increases expression ISO GPC2 (Homo sapiens) 6480464 butyraldehyde results in increased expression of GPC2 mRNA CTD PMID:26079696 Gpc2 Rat cadmium atom multiple interactions ISO GPC2 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of GPC2 mRNA CTD PMID:35301059 Gpc2 Rat cadmium dichloride multiple interactions ISO GPC2 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of GPC2 mRNA CTD PMID:35301059 Gpc2 Rat CGP 52608 multiple interactions ISO GPC2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to GPC2 gene] CTD PMID:28238834 Gpc2 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of GPC2 mRNA CTD PMID:26577399 Gpc2 Rat dexamethasone decreases expression ISO GPC2 (Homo sapiens) 6480464 Dexamethasone results in decreased expression of GPC2 mRNA CTD PMID:25047013 Gpc2 Rat dorsomorphin multiple interactions ISO GPC2 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of GPC2 mRNA CTD PMID:27188386 Gpc2 Rat exemestane increases expression ISO GPC2 (Homo sapiens) 6480464 exemestane results in increased expression of GPC2 mRNA CTD PMID:17254854 Gpc2 Rat folic acid decreases expression ISO Gpc2 (Mus musculus) 6480464 Folic Acid results in decreased expression of GPC2 mRNA CTD PMID:25629700 Gpc2 Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of GPC2 mRNA CTD PMID:24915197 Gpc2 Rat monosodium L-glutamate increases expression EXP 6480464 Sodium Glutamate results in increased expression of GPC2 mRNA CTD PMID:20928830 Gpc2 Rat niclosamide increases expression ISO GPC2 (Homo sapiens) 6480464 Niclosamide results in increased expression of GPC2 mRNA CTD PMID:36318118 Gpc2 Rat O-methyleugenol increases expression ISO GPC2 (Homo sapiens) 6480464 methyleugenol results in increased expression of GPC2 mRNA CTD PMID:32234424 Gpc2 Rat ozone multiple interactions ISO GPC2 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of GPC2 mRNA CTD PMID:35430440 Gpc2 Rat paracetamol increases expression ISO GPC2 (Homo sapiens) 6480464 Acetaminophen results in increased expression of GPC2 mRNA CTD PMID:29067470 Gpc2 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of GPC2 mRNA CTD PMID:33387578 Gpc2 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of GPC2 mRNA CTD PMID:32680482 Gpc2 Rat PCB138 multiple interactions ISO Gpc2 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Gpc2 Rat PCB138 decreases expression EXP 6480464 2 more ... CTD PMID:23829299 Gpc2 Rat pentanal increases expression ISO GPC2 (Homo sapiens) 6480464 pentanal results in increased expression of GPC2 mRNA CTD PMID:26079696 Gpc2 Rat phenylmercury acetate multiple interactions ISO GPC2 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of GPC2 mRNA CTD PMID:27188386 Gpc2 Rat SB 431542 multiple interactions ISO GPC2 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Gpc2 Rat sodium arsenite increases expression ISO GPC2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of GPC2 mRNA CTD PMID:38568856 Gpc2 Rat sunitinib decreases expression ISO GPC2 (Homo sapiens) 6480464 Sunitinib results in decreased expression of GPC2 mRNA CTD PMID:31533062 Gpc2 Rat testosterone multiple interactions EXP 6480464 [Testosterone co-treated with Estradiol] results in increased expression of GPC2 mRNA CTD PMID:32741896 Gpc2 Rat titanium dioxide decreases expression ISO Gpc2 (Mus musculus) 6480464 titanium dioxide results in decreased expression of GPC2 mRNA CTD PMID:29264374 Gpc2 Rat titanium dioxide decreases methylation ISO Gpc2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of GPC2 promoter alternative form CTD PMID:35295148 Gpc2 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of GPC2 mRNA CTD PMID:33387578 Gpc2 Rat trichostatin A affects expression ISO GPC2 (Homo sapiens) 6480464 trichostatin A affects the expression of GPC2 mRNA CTD PMID:28542535 Gpc2 Rat triphenyl phosphate affects expression ISO GPC2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of GPC2 mRNA CTD PMID:37042841 Gpc2 Rat tunicamycin decreases expression ISO GPC2 (Homo sapiens) 6480464 Tunicamycin results in decreased expression of GPC2 mRNA CTD PMID:22378314 Gpc2 Rat urethane decreases expression ISO GPC2 (Homo sapiens) 6480464 Urethane results in decreased expression of GPC2 mRNA CTD PMID:28818685 Gpc2 Rat valproic acid affects expression ISO GPC2 (Homo sapiens) 6480464 Valproic Acid affects the expression of GPC2 mRNA CTD PMID:25979313 Gpc2 Rat valproic acid decreases expression ISO GPC2 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of GPC2 mRNA CTD PMID:23179753 and PMID:24935251 Gpc2 Rat vorinostat decreases expression ISO GPC2 (Homo sapiens) 6480464 vorinostat results in decreased expression of GPC2 mRNA CTD PMID:27188386
Imported Annotations - PID (archival)
17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrylamide (EXP,ISO) ammonium chloride (EXP) atrazine (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) butanal (ISO) cadmium atom (ISO) cadmium dichloride (ISO) CGP 52608 (ISO) Cuprizon (EXP) dexamethasone (ISO) dorsomorphin (ISO) exemestane (ISO) folic acid (ISO) glycidol (EXP) monosodium L-glutamate (EXP) niclosamide (ISO) O-methyleugenol (ISO) ozone (ISO) paracetamol (EXP,ISO) paraquat (EXP) PCB138 (EXP,ISO) pentanal (ISO) phenylmercury acetate (ISO) SB 431542 (ISO) sodium arsenite (ISO) sunitinib (ISO) testosterone (EXP) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) tunicamycin (ISO) urethane (ISO) valproic acid (ISO) vorinostat (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Glypican-2 binds to midkine: the role of glypican-2 in neuronal cell adhesion and neurite outgrowth.
Kurosawa N, etal., Glycoconj J. 2001 Jun;18(6):499-507.
3.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
4.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.
HB-GAM (pleiotrophin) reverses inhibition of neural regeneration by the CNS extracellular matrix.
Paveliev M, etal., Sci Rep. 2016 Sep 27;6:33916. doi: 10.1038/srep33916.
6.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
7.
GOA pipeline
RGD automated data pipeline
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
9.
Comprehensive gene review and curation
RGD comprehensive gene curation
10.
Cerebroglycan: an integral membrane heparan sulfate proteoglycan that is unique to the developing nervous system and expressed specifically during neuronal differentiation.
Stipp CS, etal., J Cell Biol 1994 Jan;124(1-2):149-60.
11.
Dally-like core protein and its mammalian homologues mediate stimulatory and inhibitory effects on Hedgehog signal response.
Williams EH, etal., Proc Natl Acad Sci U S A. 2010 Mar 30;107(13):5869-74. Epub 2010 Mar 15.
Gpc2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 22,391,489 - 22,397,822 (-) NCBI GRCr8 mRatBN7.2 12 17,277,875 - 17,284,297 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 17,277,875 - 17,284,208 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 18,244,924 - 18,251,250 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 18,868,646 - 18,874,972 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 17,922,063 - 17,928,389 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 19,593,041 - 19,599,374 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 19,593,041 - 19,599,374 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 21,649,636 - 21,655,969 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 17,858,354 - 17,864,687 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 17,847,875 - 17,854,209 (-) NCBI Celera 12 19,202,336 - 19,208,665 (-) NCBI Celera Cytogenetic Map 12 q11 NCBI
GPC2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 100,169,606 - 100,177,381 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 100,169,606 - 100,177,381 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 99,767,229 - 99,775,004 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 99,605,165 - 99,612,926 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 99,411,879 - 99,419,641 NCBI Celera 7 94,502,575 - 94,510,340 (-) NCBI Celera Cytogenetic Map 7 q22.1 NCBI HuRef 7 94,402,023 - 94,409,735 (-) NCBI HuRef CHM1_1 7 99,697,303 - 99,705,068 (-) NCBI CHM1_1 T2T-CHM13v2.0 7 101,409,400 - 101,417,191 (-) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 99,127,317 - 99,135,078 (-) NCBI
Gpc2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 138,271,918 - 138,278,288 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 138,271,917 - 138,278,267 (-) Ensembl GRCm39 Ensembl GRCm38 5 138,273,657 - 138,280,026 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 138,273,655 - 138,280,005 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 138,714,888 - 138,721,165 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 138,503,448 - 138,509,725 (-) NCBI MGSCv36 mm8 Celera 5 135,256,511 - 135,262,788 (-) NCBI Celera Cytogenetic Map 5 G2 NCBI cM Map 5 77.0 NCBI
Gpc2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955573 630,859 - 637,296 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955573 630,859 - 637,296 (+) NCBI ChiLan1.0 ChiLan1.0
GPC2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 118,088,532 - 118,096,221 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 166,353,164 - 166,363,059 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 92,204,355 - 92,213,750 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 105,637,059 - 105,645,115 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 105,637,682 - 105,644,888 (-) Ensembl panpan1.1 panPan2
GPC2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 9,354,181 - 9,361,361 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 9,354,535 - 9,361,375 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 11,057,530 - 11,065,347 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 9,287,230 - 9,295,035 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 9,288,223 - 9,295,049 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 9,139,687 - 9,147,491 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 9,118,759 - 9,126,553 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 9,299,810 - 9,307,638 (+) NCBI UU_Cfam_GSD_1.0
Gpc2
GPC2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 8,169,343 - 8,175,580 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 8,169,229 - 8,175,848 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 7,346,211 - 7,352,851 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GPC2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 28 12,892,092 - 12,899,288 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 28 12,892,057 - 12,898,657 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666070 3,381,153 - 3,388,396 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Gpc2
.
Predicted Target Of
Count of predictions: 433 Count of miRNA genes: 228 Interacting mature miRNAs: 269 Transcripts: ENSRNOT00000001849 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61443 Btemp2 Thermal response to stress QTL 2 3.3 0.000094 body temperature trait (VT:0005535) core body temperature (CMO:0001036) 12 15025183 20794014 Rat 8552964 Pigfal17 Plasma insulin-like growth factor 1 level QTL 17 3.5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 9590147 Scort7 Serum corticosterone level QTL 7 13.61 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 12 1 42110980 Rat 1549829 Scl48 Serum cholesterol level QTL 48 5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 12 9603277 46669029 Rat 61331 Eau2 Experimental allergic uveoretinitis QTL 2 0.0005 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 12 8525423 28064601 Rat 2293684 Bmd26 Bone mineral density QTL 26 4.4 0.0002 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 12 15872653 32974238 Rat 6893681 Bw109 Body weight QTL 109 2.3 0.004 body mass (VT:0001259) body weight (CMO:0000012) 12 1 23297788 Rat 1302792 Scl21 Serum cholesterol level QTL 21 3.8 0.0011 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 12 7196730 46669029 Rat 1598855 Bp294 Blood pressure QTL 294 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 1 34851688 Rat 1600391 Edcs2 Endometrial carcinoma susceptibility QTL2 3.5 0.01 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 12 6833190 17870186 Rat 10755457 Coatc14 Coat color QTL 14 0.01759 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 12 1 22591684 Rat 1331761 Bp218 Blood pressure QTL 218 2.973 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 45055165 Rat 8694179 Bw150 Body weight QTL 150 2.9 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7411545 Bw128 Body weight QTL 128 5.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7411547 Bw129 Body weight QTL 129 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 5564495 46669029 Rat 1300157 Rf21 Renal function QTL 21 4.4 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 12 9318216 32103380 Rat 737979 Pia22 Pristane induced arthritis QTL 22 53.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 1 44465750 Rat 2300186 Bmd59 Bone mineral density QTL 59 7.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 12 10474137 46669029 Rat 7411660 Foco28 Food consumption QTL 28 10.9 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 1331755 Bp219 Blood pressure QTL 219 3.041 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 28064557 Rat 2312418 Kidm41 Kidney mass QTL 41 3.7 0.0001 kidney mass (VT:0002707) single kidney wet weight to body weight ratio (CMO:0000622) 12 1 19611090 Rat 7411641 Foco19 Food consumption QTL 19 27.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 1549912 Bp268 Blood pressure QTL 268 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 13182736 46669029 Rat 2302060 Pia37 Pristane induced arthritis QTL 37 6.1 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 13198157 46669029 Rat 1641928 Alcrsp5 Alcohol response QTL 5 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 12 12812385 46669029 Rat 8552912 Pigfal6 Plasma insulin-like growth factor 1 level QTL 6 5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564498 46669029 Rat 10059594 Kidm46 Kidney mass QTL 46 3.79 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 12 6107579 46669029 Rat 1581516 Cm56 Cardiac mass QTL 56 4.2 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 12 1 29333307 Rat 9590086 Insglur6 Insulin/glucose ratio QTL 6 18.97 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 12 1 42110980 Rat 8552918 Pigfal7 Plasma insulin-like growth factor 1 level QTL 7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 1549902 Bp269 Blood pressure QTL 269 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 13182736 46669029 Rat 61404 Bw120 Body weight QTL 120 5.1 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 12 12351619 46669029 Rat 1331786 Kidm11 Kidney mass QTL 11 3.571 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 12 11073825 24234895 Rat 2293699 Bss49 Bone structure and strength QTL 49 5.61 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 12 10474137 46669029 Rat 634351 Apr5 Acute phase response QTL 5 6.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 12 1 44503507 Rat 634350 Apr4 Acute phase response QTL 4 6 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 1172005 46172005 Rat 61416 Pia4 Pristane induced arthritis QTL 4 8.4 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 12 13635523 30827399 Rat 7204484 Bp358 Blood pressure QTL 358 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 13008296 19212979 Rat 7387292 Kidm42 Kidney mass QTL 42 3.03 0.0004 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 12 1 36247923 Rat 61421 Cia12 Collagen induced arthritis QTL 12 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 13635523 35682913 Rat 2303569 Gluco44 Glucose level QTL 44 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 12812385 46669029 Rat 7411586 Foco5 Food consumption QTL 5 5.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 2303575 Insul14 Insulin level QTL 14 4 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 12 1 42450532 Rat 7411588 Foco6 Food consumption QTL 6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2302042 Pia38 Pristane induced arthritis QTL 38 3.5 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 1 44503507 Rat 7411595 Foco9 Food consumption QTL 9 4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 7411597 Foco10 Food consumption QTL 10 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2293086 Iddm30 Insulin dependent diabetes mellitus QTL 30 3.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 8449490 28302290 Rat 631543 Bp83 Blood pressure QTL 83 5.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 15550826 38478808 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000001849 ⟹ ENSRNOP00000001849
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 17,277,875 - 17,284,208 (-) Ensembl Rnor_6.0 Ensembl 12 19,593,041 - 19,599,374 (-) Ensembl
RefSeq Acc Id:
NM_138511 ⟹ NP_612520
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 22,391,489 - 22,397,822 (-) NCBI mRatBN7.2 12 17,277,875 - 17,284,208 (-) NCBI Rnor_6.0 12 19,593,041 - 19,599,374 (-) NCBI Rnor_5.0 12 21,649,636 - 21,655,969 (-) NCBI RGSC_v3.4 12 17,858,354 - 17,864,687 (-) RGD Celera 12 19,202,336 - 19,208,665 (-) RGD
Sequence:
GATCATTGGCGGGCTCCAGCTTCGGGTCCCGCCCCCTGTCCCGCTCCCCGGCTCCCATTGTCTCCGCAGATGCCTCCTAGTCCAGCTACCGTGCTGGGGCTGTTCAGTTTTGGGGGGGACGCTCGTAT
hide sequence
RefSeq Acc Id:
XM_039089051 ⟹ XP_038944979
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 22,392,246 - 22,397,796 (-) NCBI mRatBN7.2 12 17,278,637 - 17,284,297 (-) NCBI
RefSeq Acc Id:
XM_039089052 ⟹ XP_038944980
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 22,391,489 - 22,396,739 (-) NCBI mRatBN7.2 12 17,277,875 - 17,283,123 (-) NCBI
RefSeq Acc Id:
XM_039089053 ⟹ XP_038944981
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 22,391,489 - 22,396,741 (-) NCBI mRatBN7.2 12 17,277,875 - 17,283,116 (-) NCBI
RefSeq Acc Id:
XM_039089054 ⟹ XP_038944982
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 22,391,489 - 22,395,015 (-) NCBI mRatBN7.2 12 17,277,875 - 17,281,414 (-) NCBI
RefSeq Acc Id:
NP_612520 ⟸ NM_138511
- Peptide Label:
precursor
- UniProtKB:
P51653 (UniProtKB/Swiss-Prot), A6KSU6 (UniProtKB/TrEMBL), A6KSU5 (UniProtKB/TrEMBL)
- Sequence:
MSAVRPLLLLLLPLCPGPGPGHGSEAKVVRSCAETRQVLGARGYSLNLIPPSLISGEHLQICPQEYTCCSSETEQKLIRDAEVTFRGLVEDSGSFLIHTLAARHRKFNEFFREMLSISQHSLAQLFSH
hide sequence
Ensembl Acc Id:
ENSRNOP00000001849 ⟸ ENSRNOT00000001849
RefSeq Acc Id:
XP_038944980 ⟸ XM_039089052
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_038944981 ⟸ XM_039089053
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_038944982 ⟸ XM_039089054
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_038944979 ⟸ XM_039089051
- Peptide Label:
isoform X1
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-09-26
Gpc2
glypican 2
Gpc2
glypican 2 (cerebroglycan)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Gpc2
glypican 2 (cerebroglycan)
cerebroglycan
Name updated
1299863 APPROVED
2002-08-07
Gpc2
cerebroglycan
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_domains
has five potential heparan sulfite attachment sites
gene_expression
expressed only in nerve tissue
728608
gene_expression
mRNA expressed in immature neurons, disappearing after completion of cell migration and axon outgrowth
728608
gene_product
member of integral membrane heparan sulfate proteoglycans (HSPGs), characterized by glycosylphosphatidylinositol (GPI) linkage and conserved structural motifs
728608
gene_protein
protein has predicted mass of 58.6 kDa
728608
