Advanced Search (OLGA)

Gene: Arf1 (ARF GTPase 1) Rattus norvegicus

Analyze

Symbol:

Arf1

Name:

ARF GTPase 1 (Ensembl:ADP-ribosylation factor 1)

RGD ID:

621270

Description:

Enables guanyl ribonucleotide binding activity; magnesium ion binding activity; and phospholipase D activator activity. Involved in several processes, including Golgi to transport vesicle transport; positive regulation of transport; and postsynapse organization. Located in Golgi apparatus; cytoplasmic vesicle; and peroxisomal membrane. Is active in glutamatergic synapse and postsynaptic density. Human ortholog(s) of this gene implicated in periventricular nodular heterotopia. Orthologous to human ARF1 (ARF GTPase 1); PARTICIPATES IN Arf family mediated signaling pathway; phosphatidylinositol 3-kinase class I signaling pathway; vascular endothelial growth factor signaling pathway; INTERACTS WITH 2,4,6-trinitrotoluene; bexarotene; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

ADP-ribosylation factor 1; MGC72830

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ARF1 (ARF GTPase 1)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, Panther, PhylomeDB
Mus musculus (house mouse):	Arf1 (ARF GTPase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Arf1 (ARF GTPase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ARF1 (ARF GTPase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ARF1 (ARF GTPase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Arf1 (ARF GTPase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ARF1 (ADP ribosylation factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ARF1 (ARF GTPase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Arf1 (ARF GTPase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ARF3 (ARF GTPase 3)	HGNC	OrthoDB
Homo sapiens (human):	ABCC1 (ATP binding cassette subfamily C member 1 (ABCC1 blood group))	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	ARF1 (ARF GTPase 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Arf1 (ARF GTPase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	arf1 (ADP-ribosylation factor 1)	Alliance	DIOPT (InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ARF1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ARF2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Arf79F	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	arf-1.2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ppp1r14c	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	arf5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	44,497,543 - 44,513,994 (-)	NCBI		GRCr8
mRatBN7.2	10	43,997,983 - 44,014,461 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	43,997,986 - 44,014,434 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	48,692,668 - 48,708,202 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	48,183,026 - 48,198,560 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	43,686,624 - 43,702,158 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	45,562,700 - 45,579,214 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	45,563,547 - 45,579,029 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	45,318,170 - 45,334,673 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	45,516,609 - 45,532,091 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	45,529,387 - 45,545,841 (-)	NCBI
Celera	10	43,262,080 - 43,277,562 (-)	NCBI		Celera
Cytogenetic Map	10	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

acute pancreatitis (ISO)

Breast Neoplasms (ISO)

Charcot-Marie-Tooth disease (ISO)

gastrointestinal stromal tumor (ISO)

multiple mitochondrial dysfunctions syndrome 3 (ISO)

Neoplasm Invasiveness (ISO)

paraplegia (ISO)

parathyroid carcinoma (ISO)

Periventricular Nodular Heterotopia 8 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-nicotine (ISO)

1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO)

17alpha-ethynylestradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,4,6-trinitrotoluene (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

5-fluorouracil (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

Aroclor 1254 (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bexarotene (EXP)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium atom (ISO)

caffeine (ISO)

captan (ISO)

carmustine (ISO)

chlorpyrifos (ISO)

choline (ISO)

cisplatin (ISO)

clofibrate (ISO)

copper atom (ISO)

copper(0) (ISO)

cyclosporin A (ISO)

DDT (EXP)

dexamethasone (ISO)

diarsenic trioxide (ISO)

dichlorine (EXP)

dorsomorphin (ISO)

enzyme inhibitor (ISO)

erlotinib hydrochloride (ISO)

ethanol (ISO)

flutamide (EXP)

folic acid (ISO)

folpet (ISO)

gemcitabine (ISO)

genistein (ISO)

haloperidol (EXP)

hydralazine (ISO)

hydrogen peroxide (ISO)

indometacin (ISO)

irinotecan (ISO)

ivermectin (ISO)

josamycin (ISO)

L-methionine (ISO)

N-formyl-L-methionyl-L-leucyl-L-phenylalanine (ISO)

nefazodone (EXP)

nicotine (ISO)

ozone (EXP)

p-chloromercuribenzoic acid (ISO)

paraquat (EXP)

phorbol 13-acetate 12-myristate (ISO)

pyrogallol (ISO)

resveratrol (ISO)

SB 431542 (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

tamoxifen (ISO)

temozolomide (ISO)

tetrachloromethane (ISO)

theophylline (ISO)

titanium dioxide (ISO)

trichostatin A (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vincristine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

actin filament organization (IMP)

dendritic spine organization (IMP)

Golgi to transport vesicle transport (IDA)

intracellular copper ion homeostasis (ISO)

intracellular protein transport (IBA)

long-term synaptic depression (IDA)

lysosomal membrane organization (IDA)

mitotic cleavage furrow ingression (ISO)

positive regulation of calcium ion-dependent exocytosis (IDA)

positive regulation of dendritic spine development (IMP)

positive regulation of endocytosis (IMP)

positive regulation of ER to Golgi vesicle-mediated transport (IMP)

positive regulation of late endosome to lysosome transport (IMP)

positive regulation of protein secretion (IMP)

positive regulation of sodium ion transmembrane transport (IMP)

postsynaptic actin cytoskeleton organization (IDA,IMP)

protein transport (IEA)

regulation of Arp2/3 complex-mediated actin nucleation (IDA)

regulation of phospholipid metabolic process (IDA)

regulation of receptor internalization (IDA)

synaptic vesicle budding (IMP)

very-low-density lipoprotein particle assembly (IMP)

vesicle-mediated transport (IBA,IEA,ISO)

Cellular Component

cell leading edge (ISO)

COPI-coated vesicle (IDA)

cytoplasm (IBA)

cytosol (ISO)

endomembrane system (ISO)

glutamatergic synapse (IDA,IMP)

Golgi apparatus (IEA,ISO)

Golgi membrane (IDA)

late endosome (IDA)

neuron projection (IEA)

peroxisomal membrane (IDA)

plasma membrane (IBA)

postsynaptic density (IDA,IEP,IMP)

protein-containing complex (ISO)

sarcomere (ISO)

trans-Golgi network (IDA)

Molecular Function

GDP binding (IDA)

GTP binding (IBA,IDA,IEA,ISO)

GTPase activity (IEA)

magnesium ion binding (IDA,ISO)

phospholipase D activator activity (IDA)

protein binding (IPI,ISO)

protein domain specific binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Arf family mediated signaling pathway (ISO)

phosphatidylinositol 3-kinase class I signaling pathway (ISO)

vascular endothelial growth factor signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	ARF-induced lysosomal lysis in vitro.	Arai K, etal., J Biochem. 1998 Apr;123(4):637-43.
2.	Role of ADP ribosylation factor 1 in the assembly and secretion of ApoB-100-containing lipoproteins.	Asp L, etal., Arterioscler Thromb Vasc Biol. 2005 Mar;25(3):566-70. Epub 2004 Dec 23.
3.	Formation of nascent secretory vesicles from the trans-Golgi network of endocrine cells is inhibited by tyrosine kinase and phosphatase inhibitors.	Austin CD and Shields D, J Cell Biol. 1996 Dec;135(6 Pt 1):1471-83.
4.	Membrane curvature induced by Arf1-GTP is essential for vesicle formation.	Beck R, etal., Proc Natl Acad Sci U S A. 2008 Aug 19;105(33):11731-6. doi: 10.1073/pnas.0805182105. Epub 2008 Aug 8.
5.	Translocation of Arf1 to the secretory granules in rat parotid acinar cells.	Dohke Y, etal., Arch Biochem Biophys. 1998 Sep 1;357(1):147-54.
6.	Differential expression and targeting of endogenous Arf1 and Arf6 small GTPases in kidney epithelial cells in situ.	El-Annan J, etal., Am J Physiol Cell Physiol. 2004 Apr;286(4):C768-78. Epub 2003 Dec 18.
7.	A function for the AP3 coat complex in synaptic vesicle formation from endosomes.	Faundez V, etal., Cell. 1998 May 1;93(3):423-32.
8.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
9.	The structure of rat ADP-ribosylation factor-1 (ARF-1) complexed to GDP determined from two different crystal forms.	Greasley SE, etal., Nat Struct Biol. 1995 Sep;2(9):797-806.
10.	Binding and functions of ADP-ribosylation factor on mammalian and yeast peroxisomes.	Lay D, etal., J Biol Chem. 2005 Oct 14;280(41):34489-99. Epub 2005 Aug 12.
11.	Effect of protein kinase A activity on the association of ADP-ribosylation factor 1 to golgi membranes.	Martin ME, etal., J Biol Chem. 2000 Jun 23;275(25):19050-9.
12.	Activation of rat brain phospholipase D by ADP-ribosylation factors 1,5, and 6: separation of ADP-ribosylation factor-dependent and oleate-dependent enzymes.	Massenburg D, etal., Proc Natl Acad Sci U S A. 1994 Nov 22;91(24):11718-22.
13.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
14.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
15.	ADP-ribosylation factor 1 protein regulates trypsinogen activation via organellar trafficking of procathepsin B protein and autophagic maturation in acute pancreatitis.	Orlichenko L, etal., J Biol Chem. 2012 Jul 13;287(29):24284-93. doi: 10.1074/jbc.M111.328815. Epub 2012 May 8.
16.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
17.	Interspecies relationships among ADP-ribosylation factors (ARFs): evidence of evolutionary pressure to maintain individual identities.	Price SR, etal., Mol Cell Biochem 1996 Jun 7;159(1):15-23.
18.	GOA pipeline	RGD automated data pipeline
19.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
20.	The small GTPase Arf1 modulates Arp2/3-mediated actin polymerization via PICK1 to regulate synaptic plasticity.	Rocca DL, etal., Neuron. 2013 Jul 24;79(2):293-307. doi: 10.1016/j.neuron.2013.05.003.
21.	Arf-1 (ADP-ribosylation factor-1) is involved in the activation of a mammalian Na+-selective current.	Straube S and Parekh AB, Biochem J 2004 Jan 15;377(Pt 2):539-44.
22.	Effects of brefeldin A and accessory proteins on association of ADP-ribosylation factors 1, 3, and 5 with Golgi.	Tsai SC, etal., J Biol Chem. 1993 May 25;268(15):10820-5.
23.	Activation of exocytosis by cross-linking of the IgE receptor is dependent on ADP-ribosylation factor 1-regulated phospholipase D in RBL-2H3 mast cells: evidence that the mechanism of activation is via regulation of phosphatidylinositol 4,5-bisphosphate synthesis.	Way G, etal., Biochem J. 2000 Feb 15;346 Pt 1:63-70.
24.	Role of Arf1 in endosomal trafficking of protein-metal complexes and cadmium-metallothionein-1 toxicity in kidney proximal tubule cells.	Wolff NA, etal., Toxicol Lett. 2011 Jun 24;203(3):210-8. doi: 10.1016/j.toxlet.2011.03.014. Epub 2011 Mar 21.
25.	Expression of a dominant allele of human ARF1 inhibits membrane traffic in vivo.	Zhang CJ, etal., J Cell Biol. 1994 Feb;124(3):289-300.

Additional References at PubMed

PMID:7890632	PMID:8947846	PMID:10022920	PMID:10623590	PMID:10747863	PMID:11092755	PMID:12477932	PMID:12668765	PMID:12679809	PMID:14728599	PMID:15489334	PMID:15616190
PMID:16101683	PMID:17562717	PMID:17693410	PMID:18693248	PMID:19199708	PMID:20458337	PMID:21034850	PMID:21187408	PMID:21423176	PMID:22573891	PMID:22681889	PMID:23533145
PMID:26446845	PMID:27535433	PMID:28389568

Genomics

Comparative Map Data

Arf1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	44,497,543 - 44,513,994 (-)	NCBI		GRCr8
mRatBN7.2	10	43,997,983 - 44,014,461 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	43,997,986 - 44,014,434 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	48,692,668 - 48,708,202 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	48,183,026 - 48,198,560 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	43,686,624 - 43,702,158 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	45,562,700 - 45,579,214 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	45,563,547 - 45,579,029 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	45,318,170 - 45,334,673 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	45,516,609 - 45,532,091 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	45,529,387 - 45,545,841 (-)	NCBI
Celera	10	43,262,080 - 43,277,562 (-)	NCBI		Celera
Cytogenetic Map	10	q22	NCBI

ARF1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	228,082,708 - 228,099,212 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	228,082,708 - 228,099,212 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	228,270,409 - 228,286,913 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	226,336,984 - 226,353,536 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	224,577,163 - 224,593,645	NCBI
Celera	1	201,460,593 - 201,477,145 (+)	NCBI		Celera
Cytogenetic Map	1	q42.13	NCBI
HuRef	1	198,785,590 - 198,802,034 (+)	NCBI		HuRef
CHM1_1	1	229,542,706 - 229,559,258 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	227,271,693 - 227,288,198 (+)	NCBI		T2T-CHM13v2.0

Arf1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	59,102,237 - 59,119,042 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	59,102,238 - 59,119,096 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	59,211,412 - 59,228,267 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	59,211,412 - 59,228,270 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	59,024,914 - 59,041,769 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	59,027,608 - 59,044,381 (-)	NCBI		MGSCv36	mm8
Celera	11	63,976,432 - 63,993,249 (-)	NCBI		Celera
Cytogenetic Map	11	B1.3	NCBI
cM Map	11	37.05	NCBI

Arf1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955581	319,942 - 335,112 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955581	319,942 - 335,112 (-)	NCBI	ChiLan1.0	ChiLan1.0

ARF1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	21,507,248 - 21,523,835 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	21,445,519 - 21,462,037 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	203,484,803 - 203,501,395 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	208,695,615 - 208,712,105 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	208,695,615 - 208,712,105 (+)	Ensembl	panpan1.1		panPan2

ARF1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	14	835,476 - 836,424 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	14	835,476 - 836,424 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	14	315,387 - 316,334 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	14	554,686 - 568,903 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	14	554,687 - 568,881 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	14	746,548 - 747,495 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	14	527,341 - 528,288 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	14	513,272 - 514,220 (-)	NCBI		UU_Cfam_GSD_1.0

Arf1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	87,776,242 - 87,778,336 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936864	117,510 - 119,612 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ARF1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	51,219,667 - 51,237,639 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	51,219,597 - 51,237,640 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	53,874,559 - 53,892,570 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ARF1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	25	1,628,836 - 1,644,502 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	25	1,628,751 - 1,644,499 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666055	1,510,307 - 1,525,996 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Arf1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624937	857,795 - 871,089 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Arf1
58 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	137
Count of miRNA genes:	108
Interacting mature miRNAs:	125
Transcripts:	ENSRNOT00000074900
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61441	Btemp1	Thermal response to stress QTL 1	4		body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	10	35392457	63642539	Rat
9589136	Insul27	Insulin level QTL 27	10.46	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	10	11474010	56474010	Rat
152025229	Scl83	Serum cholesterol level QTL 83	4.33		blood cholesterol amount (VT:0000180)		10	35710580	68663659	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31297439	76297439	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15275955	60275955	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	41142633	86142633	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
631557	Bp136	Blood pressure QTL 136		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	30632053	75632053	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42045676	104670812	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6375746	51375746	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	5801990	62146030	Rat
61332	Eau3	Experimental allergic uveoretinitis QTL 3		0.004	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	34490559	45579777	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	418344	45418344	Rat
61463	Bp12	Blood pressure QTL 12	6.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	41333258	86333258	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18167841	63167841	Rat
1581497	Esta1	Estrogen-induced thymic atrophy QTL 1			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	21329805	61345413	Rat
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28453136	73453136	Rat
1358897	Stresp6	Stress response QTL 6	4.17	0.022	blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	35392267	64155584	Rat
1331762	Rf40	Renal function QTL 40	3.873		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	10	29299504	64155584	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	26944628	71944628	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	42323132	87323132	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
9590310	Scort19	Serum corticosterone level QTL 19	6.3	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
10402859	Bp381	Blood pressure QTL 381		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
70198	BpQTLcluster9	Blood pressure QTL cluster 9	2.94		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	42323132	87323132	Rat
6893352	Bw100	Body weight QTL 100	0.33	0.6	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5387014	50387014	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5387014	50387014	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15028513	60430477	Rat
6893350	Bw99	Body weight QTL 99	0.87	0.16	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
2317043	Aia7	Adjuvant induced arthritis QTL 7	3.82		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	37565079	82565079	Rat
70224	Eae3	Experimental allergic encephalomyelitis QTL 3	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	26521957	61345413	Rat
2317042	Aia20	Adjuvant induced arthritis QTL 20	3.38		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	37565079	82565079	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5387014	50387014	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	19606483	64606483	Rat
1354614	Hpcl1	Hepatic cholesterol level QTL 1	3.3		liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	35392267	51793994	Rat
631532	Cm50	Cardiac mass QTL 50	6.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	17907113	51786432	Rat
1576319	Cia29	Collagen induced arthritis QTL 29			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	33973921	78973921	Rat
8552805	Bw145	Body weight QTL 145	2.2		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	10	41944526	78307017	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1600371	Mcs21	Mammary carcinoma susceptibility QTL 21	3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	28875650	52200160	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40035094	102359817	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
9590268	Scort13	Serum corticosterone level QTL 13	3.26	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31224026	75632053	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
6893342	Cm78	Cardiac mass QTL 78	0.1	0.88	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	42876766	79813922	Rat
2292441	Bp308	Blood pressure QTL 308			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	19606483	64606483	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat

Markers in Region

RH134612

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	43,997,921 - 43,998,116 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	45,562,639 - 45,562,833	NCBI	Rnor6.0
Rnor_5.0	10	45,318,109 - 45,318,303	UniSTS	Rnor5.0
RGSC_v3.4	10	45,515,701 - 45,515,895	UniSTS	RGSC3.4
Celera	10	43,261,172 - 43,261,366	UniSTS
RH 3.4 Map	10	503.4	UniSTS
Cytogenetic Map	10	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001414037	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001414038	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_022518	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269815	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC142478	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC061552	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213372	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217649	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219813	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232533	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L12380	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000080028 ⟹ ENSRNOP00000072575

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	43,997,986 - 44,014,434 (-)	Ensembl
Rnor_6.0 Ensembl	10	45,563,547 - 45,579,029 (-)	Ensembl

RefSeq Acc Id:

NM_001414037 ⟹ NP_001400966

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	44,497,543 - 44,513,994 (-)	NCBI
mRatBN7.2	10	43,997,983 - 44,014,434 (-)	NCBI

RefSeq Acc Id:

NM_001414038 ⟹ NP_001400967

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	44,497,543 - 44,513,994 (-)	NCBI
mRatBN7.2	10	43,997,983 - 44,014,434 (-)	NCBI

RefSeq Acc Id:

NM_022518 ⟹ NP_071963

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	44,497,543 - 44,513,994 (-)	NCBI
mRatBN7.2	10	43,997,983 - 44,014,434 (-)	NCBI
Rnor_6.0	10	45,563,547 - 45,579,029 (-)	NCBI
Rnor_5.0	10	45,318,170 - 45,334,673 (-)	NCBI
RGSC_v3.4	10	45,516,609 - 45,532,091 (-)	RGD
Celera	10	43,262,080 - 43,277,562 (-)	RGD

Sequence:

show sequence

GCGGCTGCTAAGGACCGAGTCTGGTCGGGCGGCCTGAGGTCTCTGGCCAGTATCGCTTCCACCT
GTCCACAAACATGGGGAATATCTTTGCAAACCTCTTCAAGGGCCTTTTTGGCAAAAAAGAAATG
CGCATTCTCATGGTGGGCCTGGATGCTGCAGGGAAGACAACAATTCTATACAAACTGAAGCTGG
GCGAAATTGTGACCACCATTCCCACCATTGGTTTCAACGTGGAGACTGTTGAATACAAGAATAT
CAGCTTCACCGTGTGGGATGTGGGTGGCCAGGACAAGATTCGGCCGCTGTGGCGCCACTACTTC
CAGAACACCCAAGGCTTGATCTTCGTAGTGGACAGCAATGACAGAGAGCGTGTGAACGAGGCCC
GTGAAGAGCTTATGAGGATGCTAGCTGAAGATGAGCTCCGAGATGCCGTTCTCTTGGTGTTTGC
CAACAAGCAGGACCTCCCCAATGCCATGAATGCGGCCGAAATCACAGACAAGCTGGGGCTGCAC
TCTCTACGCCACAGGAACTGGTACATTCAGGCTACCTGTGCCACCAGCGGAGACGGGCTCTATG
AAGGACTAGATTGGCTGTCTAATCAGCTCCGGAACCAGAAGTGAACCAGACCCCTCCTTCCCCC
TCACTTCCTCTTCTCCGCCCTCAGCTTTCCTCTCATGTGGCAAACGTGCGACTCTGTGGTCCTG
AGTGCCAGAAGCTGTCTCCATGGGTTGGTCACAGTGTGCATCGCACCGTGCTGTACATGTGCAG
ACGCAGCCTGCAGCCAGGTTTTTATTTAATGTAAATAGTTTCTGTTTCCACTGAGGCAGTTTCT
GGTACTCCTATGCAATATTACTTAGCTTTTTTTATTGTAAAAAGAGAATCAACTCACTGTCAGT
ACCT

hide sequence

RefSeq Acc Id:

XM_063269815 ⟹ XP_063125885

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	44,497,546 - 44,507,204 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001400966	(Get FASTA)	NCBI Sequence Viewer
	NP_001400967	(Get FASTA)	NCBI Sequence Viewer
	NP_071963	(Get FASTA)	NCBI Sequence Viewer
	XP_063125885	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA40685	(Get FASTA)	NCBI Sequence Viewer
	AAH61552	(Get FASTA)	NCBI Sequence Viewer
	EDM04595	(Get FASTA)	NCBI Sequence Viewer
	EDM04596	(Get FASTA)	NCBI Sequence Viewer
	EDM04597	(Get FASTA)	NCBI Sequence Viewer
	EDM04598	(Get FASTA)	NCBI Sequence Viewer
	EDM04599	(Get FASTA)	NCBI Sequence Viewer
	EDM04600	(Get FASTA)	NCBI Sequence Viewer
	EDM04601	(Get FASTA)	NCBI Sequence Viewer
	EDM04602	(Get FASTA)	NCBI Sequence Viewer
	EDM04603	(Get FASTA)	NCBI Sequence Viewer
	EDM04604	(Get FASTA)	NCBI Sequence Viewer
	EDM04605	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000072575.1
	ENSRNOP00000077987.1
	ENSRNOP00055042364
	ENSRNOP00060044568
	ENSRNOP00065008774
GenBank Protein	P84079	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_071963 ⟸ NM_022518
- UniProtKB:	P84079 (UniProtKB/Swiss-Prot), A6HEZ7 (UniProtKB/TrEMBL), A0A8I5ZKF2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFT VWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQ DLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK hide sequence

Ensembl Acc Id:

ENSRNOP00000072575 ⟸ ENSRNOT00000080028

RefSeq Acc Id:	NP_001400967 ⟸ NM_001414038
- UniProtKB:	P84079 (UniProtKB/Swiss-Prot), A6HEZ7 (UniProtKB/TrEMBL), A0A8I5ZKF2 (UniProtKB/TrEMBL)

RefSeq Acc Id:	NP_001400966 ⟸ NM_001414037
- UniProtKB:	P84079 (UniProtKB/Swiss-Prot), A6HEZ7 (UniProtKB/TrEMBL), A0A8I5ZKF2 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063125885 ⟸ XM_063269815
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I5ZKF2 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P84079-F1-model_v2	AlphaFold	P84079	1-181	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621270	AgrOrtholog
BioCyc Gene	G2FUF-24906	BioCyc
Ensembl Genes	ENSRNOG00000004807	UniProtKB/TrEMBL
	ENSRNOG00000060229	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00055029680	UniProtKB/Swiss-Prot
	ENSRNOG00060030926	UniProtKB/Swiss-Prot
	ENSRNOG00065007676	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000080028.2	UniProtKB/Swiss-Prot
	ENSRNOT00000113470.1	UniProtKB/TrEMBL
	ENSRNOT00055051399	UniProtKB/Swiss-Prot
	ENSRNOT00060053692	UniProtKB/Swiss-Prot
	ENSRNOT00065012012	UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:6889332	IMAGE-MGC_LOAD
InterPro	Arf1-5-like	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
	P-loop_NTPase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Small_GTP-bd_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Small_GTPase_ARF	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Small_GTPase_ARF/SAR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:64310	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:72830	IMAGE-MGC_LOAD
NCBI Gene	64310	ENTREZGENE
PANTHER	ADP RIBOSYLATION FACTOR-RELATED	UniProtKB/TrEMBL
	ADP-RIBOSYLATION FACTOR 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ADP-RIBOSYLATION FACTOR 2	UniProtKB/TrEMBL
	PTHR11711	UniProtKB/Swiss-Prot
Pfam	Arf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Arf1	PhenoGen
PRINTS	SAR1GTPBP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	ARF	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000004807	RatGTEx
	ENSRNOG00000060229	RatGTEx
	ENSRNOG00055029680	RatGTEx
	ENSRNOG00060030926	RatGTEx
	ENSRNOG00065007676	RatGTEx
SMART	ARF	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RAB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SAR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	P-loop containing nucleoside triphosphate hydrolases	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
UniProt	A0A8I5ZKF2	ENTREZGENE, UniProtKB/TrEMBL
	A6HEZ1_RAT	UniProtKB/TrEMBL
	A6HEZ2_RAT	UniProtKB/TrEMBL
	A6HEZ3_RAT	UniProtKB/TrEMBL
	A6HEZ5_RAT	UniProtKB/TrEMBL
	A6HEZ7	ENTREZGENE, UniProtKB/TrEMBL
	A6HF00_RAT	UniProtKB/TrEMBL
	ARF1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
UniProt Secondary	P10947	UniProtKB/Swiss-Prot
	P32889	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2024-11-07	Arf1	ARF GTPase 1	Arf1	ADP-ribosylation factor 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Arf1	ADP-ribosylation factor 1			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Arf1	ADP-ribosylation factor 1			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - PID (archival)