Il1r2 (interleukin 1 receptor type 2)

Gene: Il1r2 (interleukin 1 receptor type 2) Rattus norvegicus

Analyze

Symbol:

Il1r2

Name:

interleukin 1 receptor type 2

RGD ID:

621147

Description:

Predicted to enable interleukin-1 binding activity and interleukin-1 receptor activity. Predicted to be involved in cytokine-mediated signaling pathway. Predicted to act upstream of or within negative regulation of gene expression and negative regulation of interleukin-1-mediated signaling pathway. Predicted to be located in cytoplasm. Human ortholog(s) of this gene implicated in aggressive periodontitis; esophageal cancer; lung cancer; and organ system cancer. Orthologous to human IL1R2 (interleukin 1 receptor type 2); PARTICIPATES IN interleukin-1 signaling pathway; cytokine mediated signaling pathway; Entamoebiasis pathway; INTERACTS WITH (+)-schisandrin B; 1-benzylpiperazine; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

CD121 antigen-like family member B; IL-1 type II receptor; IL-1R-2; IL-1R-beta; IL-1RT-2; IL-1RT2; interleukin 1 receptor, type II; interleukin-1 receptor beta; interleukin-1 receptor type 2; interleukin-1 receptor type II

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	49,879,928 - 49,920,374 (+)	NCBI		GRCr8
mRatBN7.2	9	42,384,280 - 42,424,726 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	42,384,433 - 42,424,725 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	50,886,244 - 50,926,603 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	56,008,981 - 56,049,339 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	54,285,126 - 54,325,423 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	46,840,646 - 46,881,241 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	46,840,992 - 46,881,264 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	46,526,290 - 46,566,513 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	39,279,397 - 39,319,672 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	39,280,810 - 39,321,085 (+)	NCBI
Celera	9	40,130,004 - 40,170,463 (+)	NCBI		Celera
Cytogenetic Map	9	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

aggressive periodontitis (ISO)

allergic disease (ISO)

ankylosing spondylitis (ISO)

Chemical and Drug Induced Liver Injury (ISO)

cholangiocarcinoma (ISO)

esophageal cancer (ISO)

genetic disease (ISO)

liver disease (ISO)

lung adenocarcinoma (ISO)

lung cancer (ISO)

Lung Neoplasms (ISO)

organ system cancer (ISO)

pneumonia (ISO)

Presbycusis (ISO)

ulcerative colitis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,2-dimethylhydrazine (ISO)

1-benzylpiperazine (EXP)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-amino-2-deoxy-D-glucopyranose (EXP)

2-hydroxypropanoic acid (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

4,4'-diaminodiphenylmethane (ISO)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

acetylsalicylic acid (ISO)

aflatoxin B1 (ISO)

aldehydo-D-glucosamine (EXP)

amitrole (EXP)

ammonium chloride (EXP)

amphetamine (EXP)

amphotericin B (ISO)

antirheumatic drug (ISO)

aripiprazole (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

benzene (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

Benzo[k]fluoranthene (ISO)

benzyl bromide (ISO)

beta-D-glucosamine (EXP)

beta-naphthoflavone (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP)

cadmium atom (ISO)

cadmium dichloride (EXP)

calcitriol (ISO)

capecitabine (ISO)

carbon nanotube (EXP,ISO)

CGP 52608 (ISO)

choline (ISO)

cobalt dichloride (ISO)

copper atom (EXP)

copper(0) (EXP)

cyclosporin A (ISO)

cylindrospermopsin (ISO)

decabromodiphenyl ether (EXP)

dexamethasone (ISO)

dextran sulfate (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (EXP)

diclofenac (EXP,ISO)

dicrotophos (ISO)

diethylstilbestrol (ISO)

dimethylarsinous acid (ISO)

dioxygen (EXP,ISO)

elemental selenium (ISO)

erlotinib hydrochloride (ISO)

ethyl methanesulfonate (ISO)

eugenol (ISO)

farnesol (ISO)

folic acid (ISO)

formaldehyde (ISO)

furan (EXP)

genistein (ISO)

geraniol (ISO)

glutaraldehyde (ISO)

glyphosate (ISO)

hydrogen peroxide (ISO)

indometacin (EXP)

isotretinoin (ISO)

L-methionine (ISO)

lipopolysaccharide (ISO)

malathion (EXP)

manganese(II) chloride (EXP)

methimazole (EXP)

methotrexate (ISO)

methyl methanesulfonate (ISO)

Muraglitazar (EXP)

mycophenolic acid (ISO)

mycotoxin (ISO)

N-methyl-4-phenylpyridinium (EXP)

N-nitrosodiethylamine (ISO)

nickel atom (ISO)

nickel sulfate (ISO)

nitrobenzenes (EXP)

ochratoxin A (ISO)

oxaliplatin (EXP)

ozone (EXP,ISO)

paracetamol (EXP,ISO)

paraquat (EXP)

perfluorohexanesulfonic acid (ISO)

phenobarbital (ISO)

phorbol 13-acetate 12-myristate (ISO)

pirinixic acid (ISO)

progesterone (ISO)

quartz (EXP)

quercetin (ISO)

rac-lactic acid (ISO)

resorcinol (ISO)

selenium atom (ISO)

silicon dioxide (EXP,ISO)

silver atom (ISO)

silver(0) (ISO)

simvastatin (EXP)

sodium arsenite (ISO)

sodium dodecyl sulfate (ISO)

Soman (EXP)

sulfadimethoxine (EXP)

Tesaglitazar (EXP)

testosterone (EXP,ISO)

tetrachloromethane (EXP)

thioacetamide (EXP)

titanium dioxide (EXP,ISO)

TMC-120A (ISO)

topotecan (EXP)

triptonide (ISO)

troglitazone (EXP,ISO)

urethane (ISO)

valproic acid (ISO)

vanadyl sulfate (ISO)

zinc atom (ISO)

zinc(0) (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cytokine-mediated signaling pathway (IEA)

negative regulation of cytokine production involved in inflammatory response (IEA,ISO)

negative regulation of interleukin-1 alpha production (IEA,ISO)

negative regulation of interleukin-1-mediated signaling pathway (IEA,ISO)

negative regulation of protein processing (IEA,ISO)

protein processing (IEA,ISO)

Cellular Component

cytoplasm (IEA,ISO)

extracellular region (IEA)

membrane (IEA)

plasma membrane (IEA)

Molecular Function

interleukin-1 binding (IBA,IEA,ISO)

interleukin-1 receptor activity (IBA,ISO)

interleukin-1, type II, blocking receptor activity (IEA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

cytokine mediated signaling pathway (IEA)

Entamoebiasis pathway (IEA)

interleukin-1 signaling pathway (ISO)

mitogen activated protein kinase signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Evidence of associations between cytokine gene polymorphisms and quality of life in patients with cancer and their family caregivers.	Alexander K, etal., Oncol Nurs Forum. 2014 Sep;41(5):E267-81. doi: 10.1188/14.ONF.E267-E281.
2.	Interleukin-1 stimulates the expression of type I and type II interleukin-1 receptors in the rat insulinoma cell line Rinm5F; sequencing a rat type II interleukin-1 receptor cDNA.	Bristulf J, etal., Eur Cytokine Netw 1994 May-Jun;5(3):319-30.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Global characterization of T cells in non-small-cell lung cancer by single-cell sequencing.	Guo X, etal., Nat Med. 2018 Jul;24(7):978-985. doi: 10.1038/s41591-018-0045-3. Epub 2018 Jun 25.
5.	Fetal thymus graft prevents age-related hearing loss and up regulation of the IL-1 receptor type II gene in CD4(+) T cells.	Iwai H and Inaba M, J Neuroimmunol. 2012 Sep 15;250(1-2):1-8. doi: 10.1016/j.jneuroim.2012.05.007. Epub 2012 May 29.
6.	Interleukin-1 receptor gene variants are associated with aggressive periodontitis in the Japanese.	Kamei H, etal., Arch Oral Biol. 2014 Jul;59(7):756-63. doi: 10.1016/j.archoralbio.2014.04.006. Epub 2014 Apr 20.
7.	IL1R2 Polymorphisms are Associated with Increased Risk of Esophageal Cancer.	Liu J, etal., Curr Mol Med. 2020;20(5):379-387. doi: 10.2174/1566524019666191025091204.
8.	Identification of key genes and pathways associated with cholangiocarcinoma development based on weighted gene correlation network analysis.	Liu J, etal., PeerJ. 2019 Oct 31;7:e7968. doi: 10.7717/peerj.7968. eCollection 2019.
9.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
10.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
12.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
13.	GOA pipeline	RGD automated data pipeline
14.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
15.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
16.	The IL-1 family: regulators of immunity.	Sims JE and Smith DE, Nat Rev Immunol. 2010 Feb;10(2):89-102. Epub 2010 Jan 18.
17.	Soluble interleukin-1 receptor type II levels in gingival crevicular fluid in aggressive and chronic periodontitis.	Suzuki M, etal., J Periodontol. 2008 Mar;79(3):495-500. doi: 10.1902/jop.2008.070111 .
18.	Association between IL-1R2 polymorphisms and lung cancer risk in the Chinese Han population: A case-control study.	Wang C, etal., Mol Genet Genomic Med. 2019 May;7(5):e644. doi: 10.1002/mgg3.644. Epub 2019 Mar 20.
19.	An Immune-Related Signature Predicts Survival in Patients With Lung Adenocarcinoma.	Zhang M, etal., Front Oncol. 2019 Dec 10;9:1314. doi: 10.3389/fonc.2019.01314. eCollection 2019.

Additional References at PubMed

PMID:12477932	PMID:23395675	PMID:27440742	PMID:34575945	PMID:35087030

Genomics

Comparative Map Data

Il1r2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	49,879,928 - 49,920,374 (+)	NCBI		GRCr8
mRatBN7.2	9	42,384,280 - 42,424,726 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	42,384,433 - 42,424,725 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	50,886,244 - 50,926,603 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	56,008,981 - 56,049,339 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	54,285,126 - 54,325,423 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	46,840,646 - 46,881,241 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	46,840,992 - 46,881,264 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	46,526,290 - 46,566,513 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	39,279,397 - 39,319,672 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	39,280,810 - 39,321,085 (+)	NCBI
Celera	9	40,130,004 - 40,170,463 (+)	NCBI		Celera
Cytogenetic Map	9	q22	NCBI

IL1R2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	101,991,960 - 102,028,544 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	101,991,960 - 102,028,544 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	102,608,422 - 102,645,006 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	101,974,738 - 102,011,317 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	102,073,976 - 102,103,400	NCBI
Celera	2	96,809,517 - 96,846,098 (+)	NCBI		Celera
Cytogenetic Map	2	q11.2	NCBI
HuRef	2	96,372,116 - 96,408,738 (+)	NCBI		HuRef
CHM1_1	2	102,612,636 - 102,649,275 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	102,450,049 - 102,486,842 (+)	NCBI		T2T-CHM13v2.0

Il1r2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	40,123,872 - 40,164,390 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	40,113,239 - 40,164,391 (+)	Ensembl		GRCm39 Ensembl
GRCm38	1	40,084,692 - 40,125,230 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	40,074,079 - 40,125,231 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	40,141,613 - 40,182,070 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	40,029,314 - 40,069,771 (+)	NCBI		MGSCv36	mm8
Celera	1	39,891,137 - 39,931,702 (+)	NCBI		Celera
Cytogenetic Map	1	B	NCBI
cM Map	1	18.65	NCBI

Il1r2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955470	7,518,663 - 7,559,470 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955470	7,518,565 - 7,562,219 (+)	NCBI	ChiLan1.0	ChiLan1.0

IL1R2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	12	26,203,743 - 26,240,437 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2A	26,206,507 - 26,242,837 (-)	NCBI		NHGRI_mPanPan1
PanPan1.1	2A	103,015,318 - 103,078,308 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2A	103,042,328 - 103,078,190 (+)	Ensembl	panpan1.1		panPan2

IL1R2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	40,967,532 - 41,003,659 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	40,896,669 - 41,034,113 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	40,892,186 - 40,928,279 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	41,832,945 - 41,869,144 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	10	41,820,543 - 41,869,408 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	10	41,546,904 - 41,582,999 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	41,828,893 - 41,865,064 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	42,020,863 - 42,057,056 (-)	NCBI		UU_Cfam_GSD_1.0

Il1r2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024406292	90,416,062 - 90,484,706 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936713	701,155 - 716,650 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936713	679,680 - 716,801 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

IL1R2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	52,367,437 - 52,406,334 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	52,367,434 - 52,406,393 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	54,901,383 - 54,919,899 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

IL1R2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	5,672,434 - 5,708,270 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	14	5,673,163 - 5,708,372 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	173,354,598 - 173,390,365 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Il1r2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624749	6,511,584 - 6,586,511 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624749	6,549,112 - 6,586,409 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Il1r2
246 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	184
Count of miRNA genes:	152
Interacting mature miRNAs:	168
Transcripts:	ENSRNOT00000019415
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298088	Edpm11	Estrogen-dependent pituitary mass QTL 11	2.5		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	9	1	43718459	Rat
1641911	Alcrsp13	Alcohol response QTL 13			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	9	1	43718459	Rat
10054125	Srcrt7	Stress Responsive Cort QTL 7	3.33	0.0011	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	9	1	87073594	Rat
1331757	Cdexp1	CD45RC expression in CD8 T cells QTL 1	4.3		CD8-positive T cell quantity (VT:0008077)	blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990)	9	1024537	67509080	Rat
1354650	Despr5	Despair related QTL 5	4.01	0.0017	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	9	1254084	46254084	Rat
2303559	Gluco54	Glucose level QTL 54	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	9	1254084	46254084	Rat
61425	Cia15	Collagen induced arthritis QTL 15	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	9	5109826	42921101	Rat
631211	Bw4	Body weight QTL4	5.31		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	9	5109826	50109826	Rat
11353947	Bp392	Blood pressure QTL 392			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	7283252	52283252	Rat
9589133	Insul26	Insulin level QTL 26	17.96	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	9	8952560	53952560	Rat
7411609	Foco16	Food consumption QTL 16	25.6	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	8952560	53952560	Rat
1600365	Mcs20	Mammary carcinoma susceptibility QTL 20	3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	9	13533770	42791750	Rat
631680	Cm11	Cardiac mass QTL 11	3.1	0.00089	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	9	20430519	65430519	Rat
70186	Niddm26	Non-insulin dependent diabetes mellitus QTL 26	3.87		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	9	22071169	86369743	Rat
631643	Bp120	Blood pressure QTL 120	3	0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	22071200	67071200	Rat
1598823	Memor16	Memory QTL 16	1.9		exploratory behavior trait (VT:0010471)	difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678)	9	22133322	49968732	Rat
7207805	Bmd88	Bone mineral density QTL 88	4		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	9	23754024	58157242	Rat
1300180	Bw14	Body weight QTL 14	3.776		body mass (VT:0001259)	body weight (CMO:0000012)	9	23754024	61381613	Rat
7207814	Bmd91	Bone mineral density QTL 91	3.5		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	9	23754144	83851531	Rat
70218	Cm28	Cardiac mass QTL 28	8.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	9	25268044	79271759	Rat
724544	Uae9	Urinary albumin excretion QTL 9	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	9	25268044	114175309	Rat
731164	Uae25	Urinary albumin excretion QTL 25	3.5	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	25661188	100929786	Rat
1641894	Alcrsp12	Alcohol response QTL 12			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	9	27468639	72468639	Rat
7411656	Foco26	Food consumption QTL 26	9.8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	32535505	77535505	Rat
7411571	Bw138	Body weight QTL 138	14.3	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	9	32535505	77535505	Rat
1598834	Memor11	Memory QTL 11	2.5		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	9	36962359	77814038	Rat
8662828	Vetf6	Vascular elastic tissue fragility QTL 6	3.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	9	36962359	92058970	Rat
2290450	Scl57	Serum cholesterol level QTL 57	4.15		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	9	36962359	95410867	Rat
6903941	Pur31	Proteinuria QTL 31		0.036	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	9	40194188	85194188	Rat
11353949	Bp393	Blood pressure QTL 393			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	40194188	85194188	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium
Low	3	8	32	22	19	22	1	2	16	14	28	11	1
Below cutoff		35	25	19		19	7	9	55	16	12		7

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053953	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008766983	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008766984	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017596248	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039082947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC091564	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473965	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228742	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229102	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	Z22812	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000019415 ⟹ ENSRNOP00000019415

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	42,384,433 - 42,424,725 (+)	Ensembl
Rnor_6.0 Ensembl	9	46,840,992 - 46,881,264 (+)	Ensembl

RefSeq Acc Id:

NM_053953 ⟹ NP_446405

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	49,880,075 - 49,920,374 (+)	NCBI
mRatBN7.2	9	42,384,429 - 42,424,726 (+)	NCBI
Rnor_6.0	9	46,841,024 - 46,881,236 (+)	NCBI
Rnor_5.0	9	46,526,290 - 46,566,513 (+)	NCBI
RGSC_v3.4	9	39,279,397 - 39,319,672 (+)	RGD
Celera	9	40,130,004 - 40,170,463 (+)	RGD

Sequence:

show sequence

CATCATAGAAGGTGAAAGTCTGTCCTGATTGAGCCTTCCTCAGCAGCCAAGAAACTGCAAGGTA
CACGAATGCAGAGCTCCAGGCTCCGAGGGTCCTGTGCACTCTGGAAGTTGGTGTGGACGATGTT
CATCTTGCTTGTGTTAGTAACTGGGGTTTCAGCTTTCACCACTCCAGCAGTGGTGCACACAGGA
AGGGTTTCTGAGTCTCCCGTTACATCAGAGAAGCACCCAGTTCTTGGAGACGATTGCTGGTTTC
GTGGCAGAGATTTCAAATCGGAATTGAGGCTGGAAGGTGAGCCCGTGGTCCTGAGGTGCCCCCT
GGTACCTCATTCAGACACCTCCAGCAGTTCCCGCAGCCTTCTGACATGGAGTAAATCGGACTCT
TCTCAGCTGATCCCAGGAGATGAGCCAAGGATGTGGGTGAAGGATGATACGCTCTGGGTTCTGC
CAGCAGTTCAGCAGGACTCTGGTACCTACATCTGCACATTCAGAAACGCGTCCCACTGTGAACA
AATGTCTCTGGAACTCAAGGTCTTTAAGAATACCGAAGCCTCTTTCCCTCTCGTCTCCTACTTG
CAAATCTCAGCTCTCTCCTCCACCGGGTTACTTGTGTGCCCTGACCTGAAAGAGTTCATCTCCA
GCAGAACTGATGGAAAGATACAGTGGTATAAGGGCTCCATCCTCTTGGATAAAGGCAATAAGAA
ATTTCTGAGTGCGGGAGACCCCACACGCCTATTGATATCCAACACATCCATGGGAGATGCAGGC
TATTACAGATGTGTTATGACATTTACCTACGAGGGCAAGGAATACAACATCACTAGGAATATTG
AACTCCGGGTCAAAGGAATAACCACAGAACCCATCCCTGTGATCATTTCTCCCCTGGAGACAAT
ACCAGCATCTTTGGGGTCAAGACTGATAGTCCCGTGCAAGGTGTTCCTGGGAACTGGTACATCT
TCCAACACCATCGTGTGGTGGATGGCTAACAGCACGTTTATCTCAGTGGCCTACCCAAGAGGCC
GTGTGACTGAGGGGCTACACCACCAGTACTCAGAGAATGATGAGAACTACGTGGAAGTGTCGCT
GATTTTTGATCCAGTCACAAAGGAGGATCTAAATACAGATTTTAAATGTGTTGCCACGAATCCA
CGGAGTTTTCAGTCACTCCATACCACAGTCAAAGAAGTTTCTTCCACGTTCTCCTGGGGCATCG
CGCTGGCACCTCTGTCTCTGATCATCTTGGTTGTGGGGGCGATATGGATTCGCAGAAGGTGTAA
ACGCCAGGCTGGAAAGACGTATGGGCTGACCAAGCTACCGACTGACAACCAGGACTTCCCTTCC
AGCCCAAACCAAATAAAGGAAATGAAATAATAAAAA

hide sequence

RefSeq Acc Id:

XM_039082947 ⟹ XP_038938875

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	49,879,928 - 49,917,401 (+)	NCBI
mRatBN7.2	9	42,384,280 - 42,421,753 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_446405	(Get FASTA)	NCBI Sequence Viewer
	XP_038938875	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH91564	(Get FASTA)	NCBI Sequence Viewer
	CAA80465	(Get FASTA)	NCBI Sequence Viewer
	EDL99182	(Get FASTA)	NCBI Sequence Viewer
	EDL99183	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000019415
	ENSRNOP00000019415.4
GenBank Protein	P43303	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_446405 ⟸ NM_053953
- Peptide Label:	precursor
- UniProtKB:	Q5BJ99 (UniProtKB/Swiss-Prot), P43303 (UniProtKB/Swiss-Prot), A0A0H2UHL7 (UniProtKB/TrEMBL), A6INM7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MFILLVLVTGVSAFTTPAVVHTGRVSESPVTSEKHPVLGDDCWFRGRDFKSELRLEGEPVVLRC PLVPHSDTSSSSRSLLTWSKSDSSQLIPGDEPRMWVKDDTLWVLPAVQQDSGTYICTFRNASHC EQMSLELKVFKNTEASFPLVSYLQISALSSTGLLVCPDLKEFISSRTDGKIQWYKGSILLDKGN KKFLSAGDPTRLLISNTSMGDAGYYRCVMTFTYEGKEYNITRNIELRVKGITTEPIPVIISPLE TIPASLGSRLIVPCKVFLGTGTSSNTIVWWMANSTFISVAYPRGRVTEGLHHQYSENDENYVEV SLIFDPVTKEDLNTDFKCVATNPRSFQSLHTTVKEVSSTFSWGIALAPLSLIILVVGAIWIRRR CKRQAGKTYGLTKLPTDNQDFPSSPNQIKEMK hide sequence

RefSeq Acc Id:

ENSRNOP00000019415 ⟸ ENSRNOT00000019415

RefSeq Acc Id:	XP_038938875 ⟸ XM_039082947
- Peptide Label:	isoform X1

Protein Domains

Ig-like Ig-like C2-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P43303-F1-model_v2	AlphaFold	P43303	1-416	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696628

Promoter ID:

EPDNEW_R7153

Type:

single initiation site

Name:

Il1r2_1

Description:

interleukin 1 receptor type 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	9	46,841,028 - 46,841,088	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621147	AgrOrtholog
BioCyc Gene	G2FUF-27730	BioCyc
Ensembl Genes	ENSRNOG00000014378	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000019415	ENTREZGENE
	ENSRNOT00000019415.6	UniProtKB/TrEMBL
Gene3D-CATH	2.60.40.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7445971	IMAGE-MGC_LOAD
InterPro	Ig-like_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig-like_fold	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig_sub	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig_sub2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	IL-1_rcpt_fam	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	IL-1_rcpt_I/II-typ	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	IL-1_rcpt_II-typ	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Immunoglobulin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:117022	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:114281	IMAGE-MGC_LOAD
NCBI Gene	117022	ENTREZGENE
PANTHER	INTERLEUKIN-1 RECEPTOR TYPE 2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11890	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	PF00047	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Il1r2	PhenoGen
PRINTS	INTRLEUKN1R2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	INTRLKN1R12F	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	IG_LIKE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000014378	RatGTEx
SMART	IGc2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SM00409	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF48726	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0H2UHL7	ENTREZGENE, UniProtKB/TrEMBL
	A6INM7	ENTREZGENE, UniProtKB/TrEMBL
	A6INM8_RAT	UniProtKB/TrEMBL
	IL1R2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q5BJ99	ENTREZGENE
UniProt Secondary	Q5BJ99	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-08	Il1r2	interleukin 1 receptor type 2	Il1r2	interleukin 1 receptor, type II	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Il1r2	interleukin 1 receptor, type II			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Il1r2	interleukin 1 receptor, type II			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_regulation	expression is induced by Interleukin 1	728991

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)