Symbol:
Hyou1
Name:
hypoxia up-regulated 1
RGD ID:
621146
Description:
Predicted to enable adenyl-nucleotide exchange factor activity. Involved in negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway and response to hypoxia. Located in smooth endoplasmic reticulum. Human ortholog(s) of this gene implicated in immunodeficiency 59. Orthologous to human HYOU1 (hypoxia up-regulated 1); PARTICIPATES IN codeine and morphine pharmacodynamics pathway; codeine and morphine pharmacokinetics pathway; etoposide pharmacodynamics pathway; INTERACTS WITH (+)-schisandrin B; 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine; 17alpha-ethynylestradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
150 kDa oxygen-regulated protein; Cab140; hypoxia up-regulated protein 1; ORP-150; Orp150; oxygen regulated protein (150kD)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
HYOU1 (hypoxia up-regulated 1) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, Panther
Mus musculus (house mouse):
Hyou1 (hypoxia up-regulated 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Hyou1 (hypoxia up-regulated 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
HYOU1 (hypoxia up-regulated 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
HYOU1 (hypoxia up-regulated 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Hyou1 (hypoxia up-regulated 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
HYOU1 (hypoxia up-regulated 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
HYOU1 (hypoxia up-regulated 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Hyou1 (hypoxia up-regulated 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Hyou1 (hypoxia up-regulated 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
HYOU1 (hypoxia up-regulated 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
hyou1 (hypoxia up-regulated 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG2918
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
LHS1
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|PhylomeDB)
Caenorhabditis elegans (roundworm):
T14G8.3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
T24H7.2
Alliance
DIOPT (InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
hyou1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 53,602,882 - 53,614,998 (+) NCBI GRCr8 mRatBN7.2 8 44,706,073 - 44,718,189 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 44,706,263 - 44,718,186 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 50,202,146 - 50,214,290 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 48,480,862 - 48,493,006 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 46,351,091 - 46,363,246 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 48,699,796 - 48,711,912 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 48,699,769 - 48,711,910 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 47,318,767 - 47,330,883 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 47,346,753 - 47,358,869 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 47,355,708 - 47,366,413 (+) NCBI Celera 8 44,292,303 - 44,304,419 (+) NCBI Celera Cytogenetic Map 8 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Hyou1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of HYOU1 mRNA] CTD PMID:31150632 Hyou1 Rat (1->4)-beta-D-glucan multiple interactions ISO Hyou1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of HYOU1 mRNA CTD PMID:36331819 Hyou1 Rat 1,2-dichloroethane increases expression ISO Hyou1 (Mus musculus) 6480464 ethylene dichloride results in increased expression of HYOU1 mRNA CTD PMID:28189721 and PMID:28960355 Hyou1 Rat 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine increases expression EXP 6480464 chlorcyclizine results in increased expression of HYOU1 mRNA CTD PMID:21058326 Hyou1 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of HYOU1 mRNA CTD PMID:17351261 Hyou1 Rat 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of HYOU1 mRNA CTD PMID:20170705 and PMID:26865667 Hyou1 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of HYOU1 mRNA CTD PMID:26496021 Hyou1 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of HYOU1 mRNA CTD PMID:32145629 Hyou1 Rat 17beta-estradiol increases expression ISO Hyou1 (Mus musculus) 6480464 Estradiol results in increased expression of HYOU1 mRNA CTD PMID:30077407 and PMID:39298647 Hyou1 Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one increases expression ISO HYOU1 (Homo sapiens) 6480464 Metribolone results in increased expression of HYOU1 protein CTD PMID:17152098 Hyou1 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO HYOU1 (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of HYOU1 mRNA CTD PMID:29581250 Hyou1 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Hyou1 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Hyou1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Hyou1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of HYOU1 mRNA CTD PMID:21570461 Hyou1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Hyou1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of HYOU1 mRNA CTD PMID:26290441 Hyou1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of HYOU1 mRNA CTD PMID:20959002 Hyou1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression EXP 6480464 2 more ... CTD PMID:19954255 Hyou1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of HYOU1 mRNA CTD PMID:21346803 Hyou1 Rat 2-amino-2-deoxy-D-glucopyranose decreases expression ISO Hyou1 (Mus musculus) 6480464 Glucosamine results in decreased expression of HYOU1 mRNA CTD PMID:17178593 Hyou1 Rat 2-palmitoylglycerol increases expression ISO HYOU1 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of HYOU1 mRNA CTD PMID:37199045 Hyou1 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Hyou1 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of HYOU1 mRNA CTD PMID:26251327 Hyou1 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin analog results in increased expression of HYOU1 protein CTD PMID:26072098 Hyou1 Rat 4,4'-sulfonyldiphenol increases expression ISO Hyou1 (Mus musculus) 6480464 bisphenol S results in increased expression of HYOU1 mRNA CTD PMID:39298647 Hyou1 Rat 4,4'-sulfonyldiphenol affects methylation ISO Hyou1 (Mus musculus) 6480464 bisphenol S affects the methylation of HYOU1 gene CTD PMID:31683443 Hyou1 Rat 4,4'-sulfonyldiphenol increases expression ISO HYOU1 (Homo sapiens) 6480464 bisphenol S results in increased expression of HYOU1 protein CTD PMID:34186270 Hyou1 Rat 4,4'-sulfonyldiphenol increases methylation ISO Hyou1 (Mus musculus) 6480464 bisphenol S results in increased methylation of HYOU1 exon CTD PMID:33297965 Hyou1 Rat acrolein multiple interactions ISO HYOU1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of HYOU1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of HYOU1 mRNA CTD PMID:32699268 Hyou1 Rat aldehydo-D-glucosamine decreases expression ISO Hyou1 (Mus musculus) 6480464 Glucosamine results in decreased expression of HYOU1 mRNA CTD PMID:17178593 Hyou1 Rat aldehydo-D-glucose decreases expression ISO Hyou1 (Mus musculus) 6480464 Glucose results in decreased expression of HYOU1 mRNA CTD PMID:17178593 Hyou1 Rat alpha-pinene multiple interactions ISO HYOU1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of HYOU1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of HYOU1 mRNA CTD PMID:32699268 Hyou1 Rat aminoglutethimide increases expression ISO HYOU1 (Homo sapiens) 6480464 Aminoglutethimide results in increased expression of HYOU1 protein CTD PMID:26102013 Hyou1 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of HYOU1 mRNA CTD PMID:38685447 Hyou1 Rat ammonium chloride increases expression EXP 6480464 Ammonium Chloride results in increased expression of HYOU1 mRNA CTD PMID:12420312 Hyou1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of HYOU1 mRNA CTD PMID:16483693 Hyou1 Rat arsane multiple interactions ISO HYOU1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of HYOU1 mRNA CTD PMID:39836092 Hyou1 Rat arsenic atom multiple interactions ISO HYOU1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of HYOU1 mRNA CTD PMID:39836092 Hyou1 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of HYOU1 gene CTD PMID:35440735 Hyou1 Rat benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of HYOU1 mRNA CTD PMID:21839799 Hyou1 Rat benzo[a]pyrene affects methylation ISO HYOU1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of HYOU1 3' UTR CTD PMID:27901495 Hyou1 Rat beta-D-glucosamine decreases expression ISO Hyou1 (Mus musculus) 6480464 Glucosamine results in decreased expression of HYOU1 mRNA CTD PMID:17178593 Hyou1 Rat bicalutamide increases expression ISO HYOU1 (Homo sapiens) 6480464 bicalutamide results in increased expression of HYOU1 mRNA CTD PMID:15638997 Hyou1 Rat bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of HYOU1 protein CTD PMID:16400681 Hyou1 Rat bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of HYOU1 mRNA CTD PMID:36005737 Hyou1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Hyou1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of HYOU1 mRNA CTD PMID:21318169 Hyou1 Rat bisphenol A affects expression ISO HYOU1 (Homo sapiens) 6480464 bisphenol A affects the expression of HYOU1 mRNA CTD PMID:20170705 and PMID:30903817 Hyou1 Rat bisphenol A decreases expression ISO HYOU1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of HYOU1 protein CTD PMID:34186270 Hyou1 Rat bisphenol A increases methylation ISO HYOU1 (Homo sapiens) 6480464 bisphenol A results in increased methylation of HYOU1 gene CTD PMID:31601247 Hyou1 Rat bisphenol A increases expression ISO HYOU1 (Homo sapiens) 6480464 bisphenol A results in increased expression of HYOU1 protein CTD PMID:33670352 Hyou1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of HYOU1 mRNA CTD PMID:32145629 Hyou1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of HYOU1 mRNA CTD PMID:25181051 Hyou1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of HYOU1 mRNA CTD PMID:26496021 Hyou1 Rat bisphenol AF increases expression ISO HYOU1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of HYOU1 protein CTD PMID:34186270 Hyou1 Rat Bisphenol B increases expression ISO HYOU1 (Homo sapiens) 6480464 bisphenol B results in increased expression of HYOU1 protein CTD PMID:34186270 Hyou1 Rat bisphenol F increases expression ISO Hyou1 (Mus musculus) 6480464 bisphenol F results in increased expression of HYOU1 mRNA CTD PMID:38685157 Hyou1 Rat bisphenol F increases expression ISO HYOU1 (Homo sapiens) 6480464 bisphenol F results in increased expression of HYOU1 protein CTD PMID:34186270 Hyou1 Rat cadmium atom multiple interactions ISO HYOU1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of HYOU1 protein CTD PMID:33040242 Hyou1 Rat cadmium dichloride multiple interactions ISO HYOU1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of HYOU1 protein CTD PMID:33040242 Hyou1 Rat cadmium dichloride increases expression ISO HYOU1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of HYOU1 mRNA CTD PMID:38568856 Hyou1 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of HYOU1 mRNA CTD PMID:25993096 Hyou1 Rat carbon nanotube increases expression ISO Hyou1 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of HYOU1 mRNA CTD PMID:25620056 Hyou1 Rat ceruletide increases expression EXP 6480464 Ceruletide results in increased expression of HYOU1 protein CTD PMID:18024178 Hyou1 Rat choline multiple interactions ISO Hyou1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of HYOU1 mRNA and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of HYOU1 gene CTD PMID:20938992 Hyou1 Rat chromium(6+) affects expression ISO Hyou1 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of HYOU1 mRNA CTD PMID:28472532 Hyou1 Rat cisplatin decreases expression ISO HYOU1 (Homo sapiens) 6480464 Cisplatin results in decreased expression of HYOU1 mRNA CTD PMID:27594783 Hyou1 Rat cobalt dichloride decreases expression ISO HYOU1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of HYOU1 mRNA CTD PMID:19320972 Hyou1 Rat copper atom multiple interactions ISO HYOU1 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of HYOU1 mRNA CTD PMID:20971185 Hyou1 Rat copper(0) multiple interactions ISO HYOU1 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of HYOU1 mRNA CTD PMID:20971185 Hyou1 Rat coumarin increases expression EXP 6480464 coumarin results in increased expression of HYOU1 mRNA CTD PMID:18480146 Hyou1 Rat cyclophosphamide decreases expression EXP 6480464 Cyclophosphamide results in decreased expression of HYOU1 mRNA CTD PMID:11906922 Hyou1 Rat cyclosporin A increases expression ISO HYOU1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of HYOU1 mRNA CTD PMID:19159671 more ... Hyou1 Rat D-glucose decreases expression ISO Hyou1 (Mus musculus) 6480464 Glucose results in decreased expression of HYOU1 mRNA CTD PMID:17178593 Hyou1 Rat deguelin increases expression ISO HYOU1 (Homo sapiens) 6480464 deguelin results in increased expression of HYOU1 mRNA CTD PMID:33512557 Hyou1 Rat diallyl trisulfide decreases expression ISO HYOU1 (Homo sapiens) 6480464 diallyl trisulfide results in decreased expression of HYOU1 protein CTD PMID:19550292 Hyou1 Rat diazinon increases methylation ISO HYOU1 (Homo sapiens) 6480464 Diazinon results in increased methylation of HYOU1 gene CTD PMID:22964155 Hyou1 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of HYOU1 mRNA CTD PMID:21266533 Hyou1 Rat dicrotophos increases expression ISO HYOU1 (Homo sapiens) 6480464 dicrotophos results in increased expression of HYOU1 mRNA CTD PMID:28302478 Hyou1 Rat dimethylarsinous acid increases expression ISO HYOU1 (Homo sapiens) 6480464 dimethylarsinous acid results in increased expression of HYOU1 mRNA CTD PMID:23487506 Hyou1 Rat doxorubicin increases expression ISO HYOU1 (Homo sapiens) 6480464 Doxorubicin results in increased expression of HYOU1 mRNA CTD PMID:29803840 Hyou1 Rat doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of HYOU1 mRNA CTD PMID:30261314 Hyou1 Rat endosulfan affects expression EXP 6480464 Endosulfan affects the expression of HYOU1 mRNA CTD PMID:29391264 Hyou1 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of HYOU1 mRNA CTD PMID:31464424 Hyou1 Rat enzyme inhibitor multiple interactions ISO HYOU1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of HYOU1 protein CTD PMID:23301498 Hyou1 Rat epoxiconazole decreases expression ISO Hyou1 (Mus musculus) 6480464 epoxiconazole results in decreased expression of HYOU1 mRNA CTD PMID:35436446 Hyou1 Rat ethanol multiple interactions ISO Hyou1 (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of HYOU1 mRNA CTD PMID:30319688 Hyou1 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of HYOU1 mRNA CTD PMID:30307764 Hyou1 Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of HYOU1 mRNA CTD PMID:18035473 Hyou1 Rat folic acid multiple interactions ISO Hyou1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of HYOU1 mRNA and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of HYOU1 gene CTD PMID:20938992 Hyou1 Rat folpet decreases expression ISO Hyou1 (Mus musculus) 6480464 folpet results in decreased expression of HYOU1 mRNA CTD PMID:31558096 Hyou1 Rat genistein increases expression ISO HYOU1 (Homo sapiens) 6480464 Genistein results in increased expression of HYOU1 mRNA CTD PMID:26865667 Hyou1 Rat genistein increases expression ISO Hyou1 (Mus musculus) 6480464 Genistein results in increased expression of HYOU1 mRNA CTD PMID:32186404 Hyou1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of HYOU1 mRNA CTD PMID:33387578 Hyou1 Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of HYOU1 mRNA CTD PMID:24136188 Hyou1 Rat glucose decreases expression ISO Hyou1 (Mus musculus) 6480464 Glucose results in decreased expression of HYOU1 mRNA CTD PMID:17178593 Hyou1 Rat gold atom multiple interactions ISO Hyou1 (Mus musculus) 6480464 [Gold co-treated with Polyethylene Glycols] results in increased expression of HYOU1 mRNA CTD PMID:19695318 Hyou1 Rat gold(0) multiple interactions ISO Hyou1 (Mus musculus) 6480464 [Gold co-treated with Polyethylene Glycols] results in increased expression of HYOU1 mRNA CTD PMID:19695318 Hyou1 Rat GW 4064 increases expression ISO Hyou1 (Mus musculus) 6480464 GW 4064 results in increased expression of HYOU1 protein CTD PMID:23178280 Hyou1 Rat inulin multiple interactions ISO Hyou1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of HYOU1 mRNA CTD PMID:36331819 Hyou1 Rat isoprenaline decreases expression ISO Hyou1 (Mus musculus) 6480464 Isoproterenol results in decreased expression of HYOU1 mRNA CTD PMID:20003209 Hyou1 Rat ivermectin decreases expression ISO HYOU1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of HYOU1 protein CTD PMID:32959892 Hyou1 Rat kojic acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with kojic acid co-treated with Diethylnitrosamine] results in decreased expression of HYOU1 mRNA CTD PMID:18544905 Hyou1 Rat L-methionine multiple interactions ISO Hyou1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of HYOU1 mRNA and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of HYOU1 gene CTD PMID:20938992 Hyou1 Rat lead diacetate decreases expression ISO Hyou1 (Mus musculus) 6480464 lead acetate results in decreased expression of HYOU1 mRNA CTD PMID:21829687 Hyou1 Rat lipopolysaccharide increases expression ISO Hyou1 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of HYOU1 mRNA CTD PMID:15919760 Hyou1 Rat Mesaconitine increases expression EXP 6480464 mesaconitine results in increased expression of HYOU1 protein CTD PMID:37182599 Hyou1 Rat metformin increases expression EXP 6480464 Metformin results in increased expression of HYOU1 mRNA CTD PMID:31324951 Hyou1 Rat methylmercury chloride increases expression ISO HYOU1 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of HYOU1 mRNA CTD PMID:34089799 Hyou1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with kojic acid co-treated with Diethylnitrosamine] results in decreased expression of HYOU1 mRNA CTD PMID:18544905 Hyou1 Rat nickel atom increases expression ISO HYOU1 (Homo sapiens) 6480464 Nickel results in increased expression of HYOU1 mRNA CTD PMID:24768652 and PMID:25583101 Hyou1 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of HYOU1 mRNA CTD PMID:24136188 Hyou1 Rat nitrates multiple interactions ISO Hyou1 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of HYOU1 mRNA CTD PMID:35964746 Hyou1 Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of HYOU1 mRNA CTD PMID:20638522 Hyou1 Rat orotic acid increases expression EXP 6480464 Orotic Acid results in increased expression of HYOU1 mRNA CTD PMID:17203948 Hyou1 Rat ozone multiple interactions ISO HYOU1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of HYOU1 mRNA more ... CTD PMID:32699268 Hyou1 Rat ozone decreases expression ISO HYOU1 (Homo sapiens) 6480464 Ozone results in decreased expression of HYOU1 mRNA CTD PMID:23033980 Hyou1 Rat paracetamol increases expression ISO Hyou1 (Mus musculus) 6480464 Acetaminophen results in increased expression of HYOU1 mRNA CTD PMID:29246445 Hyou1 Rat paracetamol increases expression ISO HYOU1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of HYOU1 mRNA CTD PMID:29067470 Hyou1 Rat paracetamol multiple interactions ISO Hyou1 (Mus musculus) 6480464 PANX1 gene mutant form inhibits the reaction [Acetaminophen results in increased expression of HYOU1 mRNA] CTD PMID:29246445 Hyou1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Hyou1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of HYOU1 mRNA more ... CTD PMID:36331819 Hyou1 Rat perfluorooctanoic acid increases expression ISO Hyou1 (Mus musculus) 6480464 perfluorooctanoic acid results in increased expression of HYOU1 mRNA CTD PMID:32578922 Hyou1 Rat phenobarbital multiple interactions ISO Hyou1 (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in decreased expression of HYOU1 mRNA] CTD PMID:19482888 Hyou1 Rat phenobarbital affects expression ISO Hyou1 (Mus musculus) 6480464 Phenobarbital affects the expression of HYOU1 mRNA CTD PMID:23091169 Hyou1 Rat phenobarbital decreases expression ISO Hyou1 (Mus musculus) 6480464 Phenobarbital results in decreased expression of HYOU1 mRNA CTD PMID:19482888 Hyou1 Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of HYOU1 mRNA CTD PMID:19162173 Hyou1 Rat pirinixic acid decreases expression ISO Hyou1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of HYOU1 mRNA CTD PMID:17426115 more ... Hyou1 Rat pirinixic acid multiple interactions ISO Hyou1 (Mus musculus) 6480464 PPARA protein affects the reaction [pirinixic acid results in decreased expression of HYOU1 mRNA] CTD PMID:21318169 Hyou1 Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of HYOU1 mRNA CTD PMID:19162173 Hyou1 Rat procymidone decreases expression EXP 6480464 procymidone results in decreased expression of HYOU1 mRNA CTD PMID:15686871 Hyou1 Rat progesterone increases expression ISO HYOU1 (Homo sapiens) 6480464 Progesterone results in increased expression of HYOU1 mRNA CTD PMID:18037150 Hyou1 Rat Propiverine affects binding EXP 6480464 propiverine binds to HYOU1 protein CTD PMID:29273565 Hyou1 Rat resveratrol increases expression ISO Hyou1 (Mus musculus) 6480464 resveratrol results in increased expression of HYOU1 protein CTD PMID:25505154 Hyou1 Rat rotenone increases oxidation EXP 6480464 Rotenone results in increased oxidation of HYOU1 protein CTD PMID:30951809 Hyou1 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of HYOU1 mRNA CTD PMID:28374803 Hyou1 Rat silicon dioxide decreases expression ISO Hyou1 (Mus musculus) 6480464 Silicon Dioxide results in decreased expression of HYOU1 mRNA CTD PMID:19073995 Hyou1 Rat sodium arsenite decreases expression ISO HYOU1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of HYOU1 mRNA CTD PMID:28595984 and PMID:34032870 Hyou1 Rat sodium arsenite increases expression ISO Hyou1 (Mus musculus) 6480464 sodium arsenite results in increased expression of HYOU1 mRNA CTD PMID:37682722 Hyou1 Rat sodium arsenite multiple interactions ISO HYOU1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of HYOU1 mRNA CTD PMID:39836092 Hyou1 Rat sodium dichromate decreases expression ISO Hyou1 (Mus musculus) 6480464 sodium bichromate results in decreased expression of HYOU1 mRNA CTD PMID:31558096 Hyou1 Rat sunitinib increases expression ISO HYOU1 (Homo sapiens) 6480464 Sunitinib results in increased expression of HYOU1 mRNA CTD PMID:31533062 Hyou1 Rat temozolomide increases expression ISO HYOU1 (Homo sapiens) 6480464 Temozolomide results in increased expression of HYOU1 mRNA CTD PMID:31758290 Hyou1 Rat testosterone decreases expression ISO Hyou1 (Mus musculus) 6480464 Testosterone deficiency results in decreased expression of HYOU1 mRNA CTD PMID:33848595 Hyou1 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of HYOU1 mRNA CTD PMID:31150632 Hyou1 Rat tetrachloromethane increases expression ISO Hyou1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of HYOU1 mRNA CTD PMID:31919559 Hyou1 Rat tetrachloromethane decreases expression ISO Hyou1 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of HYOU1 mRNA CTD PMID:29987408 Hyou1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of HYOU1 mRNA] CTD PMID:31150632 Hyou1 Rat thapsigargin increases expression ISO HYOU1 (Homo sapiens) 6480464 Thapsigargin results in increased expression of HYOU1 mRNA and Thapsigargin results in increased expression of HYOU1 protein CTD PMID:22378314 and PMID:29453283 Hyou1 Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of HYOU1 protein CTD PMID:35544339 Hyou1 Rat thifluzamide increases expression ISO HYOU1 (Homo sapiens) 6480464 thifluzamide results in increased expression of HYOU1 mRNA CTD PMID:33512557 Hyou1 Rat titanium dioxide increases expression ISO Hyou1 (Mus musculus) 6480464 titanium dioxide results in increased expression of HYOU1 mRNA CTD PMID:23557971 Hyou1 Rat titanium dioxide decreases methylation ISO HYOU1 (Homo sapiens) 6480464 titanium dioxide results in decreased methylation of HYOU1 promoter CTD PMID:34973136 Hyou1 Rat titanium dioxide decreases methylation ISO Hyou1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of HYOU1 gene and titanium dioxide results in decreased methylation of HYOU1 promoter CTD PMID:35295148 Hyou1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of HYOU1 mRNA CTD PMID:33387578 Hyou1 Rat triphenyl phosphate affects expression ISO HYOU1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of HYOU1 mRNA CTD PMID:37042841 Hyou1 Rat triptonide increases expression ISO Hyou1 (Mus musculus) 6480464 triptonide results in increased expression of HYOU1 mRNA CTD PMID:33045310 Hyou1 Rat tungsten decreases expression ISO Hyou1 (Mus musculus) 6480464 Tungsten results in decreased expression of HYOU1 mRNA CTD PMID:30912803 Hyou1 Rat tunicamycin increases expression ISO HYOU1 (Homo sapiens) 6480464 Tunicamycin results in increased expression of HYOU1 mRNA and Tunicamycin results in increased expression of HYOU1 protein CTD PMID:22378314 more ... Hyou1 Rat valproic acid increases expression ISO HYOU1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of HYOU1 mRNA CTD PMID:23179753 Hyou1 Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of HYOU1 mRNA CTD PMID:29427782 Hyou1 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of HYOU1 mRNA CTD PMID:15686871 and PMID:23034163 Hyou1 Rat zinc atom increases expression ISO HYOU1 (Homo sapiens) 6480464 Zinc deficiency results in increased expression of HYOU1 mRNA CTD PMID:22171008 Hyou1 Rat zinc(0) increases expression ISO HYOU1 (Homo sapiens) 6480464 Zinc deficiency results in increased expression of HYOU1 mRNA CTD PMID:22171008
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) 1,2-dichloroethane (ISO) 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP) 2,4-dinitrotoluene (EXP) 2-amino-2-deoxy-D-glucopyranose (ISO) 2-palmitoylglycerol (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-sulfonyldiphenol (ISO) acrolein (ISO) aldehydo-D-glucosamine (ISO) aldehydo-D-glucose (ISO) alpha-pinene (ISO) aminoglutethimide (ISO) amitrole (EXP) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) atrazine (EXP) benzo[a]pyrene (EXP,ISO) beta-D-glucosamine (ISO) bicalutamide (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) carbon nanotube (ISO) ceruletide (EXP) choline (ISO) chromium(6+) (ISO) cisplatin (ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) coumarin (EXP) cyclophosphamide (EXP) cyclosporin A (ISO) D-glucose (ISO) deguelin (ISO) diallyl trisulfide (ISO) diazinon (ISO) dibutyl phthalate (EXP) dicrotophos (ISO) dimethylarsinous acid (ISO) doxorubicin (EXP,ISO) endosulfan (EXP) enzyme inhibitor (ISO) epoxiconazole (ISO) ethanol (ISO) fenvalerate (EXP) flavonoids (EXP) folic acid (ISO) folpet (ISO) genistein (ISO) gentamycin (EXP) glafenine (EXP) glucose (ISO) gold atom (ISO) gold(0) (ISO) GW 4064 (ISO) inulin (ISO) isoprenaline (ISO) ivermectin (ISO) kojic acid (EXP) L-methionine (ISO) lead diacetate (ISO) lipopolysaccharide (ISO) Mesaconitine (EXP) metformin (EXP) methylmercury chloride (ISO) N-nitrosodiethylamine (EXP) nickel atom (ISO) nimesulide (EXP) nitrates (ISO) nitrofen (EXP) orotic acid (EXP) ozone (ISO) paracetamol (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) pirinixic acid (EXP,ISO) pregnenolone 16alpha-carbonitrile (EXP) procymidone (EXP) progesterone (ISO) Propiverine (EXP) resveratrol (ISO) rotenone (EXP) silicon dioxide (ISO) sodium arsenite (ISO) sodium dichromate (ISO) sunitinib (ISO) temozolomide (ISO) testosterone (ISO) tetrachloromethane (EXP,ISO) thapsigargin (EXP,ISO) thifluzamide (ISO) titanium dioxide (ISO) trichloroethene (EXP) triphenyl phosphate (ISO) triptonide (ISO) tungsten (ISO) tunicamycin (ISO) valproic acid (EXP,ISO) vinclozolin (EXP) zinc atom (ISO) zinc(0) (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
An interaction map of endoplasmic reticulum chaperones and foldases.
Jansen G, etal., Mol Cell Proteomics. 2012 Sep;11(9):710-23. doi: 10.1074/mcp.M111.016550. Epub 2012 Jun 4.
3.
Purification and characterization of a novel stress protein, the 150-kDa oxygen-regulated protein (ORP150), from cultured rat astrocytes and its expression in ischemic mouse brain.
Kuwabara K, etal., J Biol Chem 1996 Mar 1;271(9):5025-32.
4.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
5.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
7.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
8.
GOA pipeline
RGD automated data pipeline
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
11.
ORP150 protects against hypoxia/ischemia-induced neuronal death.
Tamatani M, etal., Nat Med. 2001 Mar;7(3):317-23.
Hyou1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 53,602,882 - 53,614,998 (+) NCBI GRCr8 mRatBN7.2 8 44,706,073 - 44,718,189 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 44,706,263 - 44,718,186 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 50,202,146 - 50,214,290 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 48,480,862 - 48,493,006 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 46,351,091 - 46,363,246 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 48,699,796 - 48,711,912 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 48,699,769 - 48,711,910 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 47,318,767 - 47,330,883 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 47,346,753 - 47,358,869 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 47,355,708 - 47,366,413 (+) NCBI Celera 8 44,292,303 - 44,304,419 (+) NCBI Celera Cytogenetic Map 8 q22 NCBI
HYOU1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 119,044,188 - 119,057,205 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 119,044,188 - 119,057,227 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 118,914,899 - 118,927,916 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 118,420,110 - 118,433,122 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 11 116,072,540 - 116,085,596 (-) NCBI Celera Cytogenetic Map 11 q23.3 NCBI HuRef 11 114,854,557 - 114,867,575 (-) NCBI HuRef CHM1_1 11 118,801,167 - 118,814,197 (-) NCBI CHM1_1 T2T-CHM13v2.0 11 119,064,550 - 119,077,556 (-) NCBI T2T-CHM13v2.0
Hyou1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 44,290,840 - 44,303,662 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 44,290,787 - 44,303,666 (+) Ensembl GRCm39 Ensembl GRCm38 9 44,379,490 - 44,392,369 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 44,379,490 - 44,392,369 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 44,187,573 - 44,200,452 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 44,130,580 - 44,143,364 (+) NCBI MGSCv36 mm8 Celera 9 41,627,066 - 41,639,919 (+) NCBI Celera Cytogenetic Map 9 A5.2 NCBI cM Map 9 24.84 NCBI
Hyou1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955412 20,148,953 - 20,161,172 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955412 20,149,104 - 20,161,378 (-) NCBI ChiLan1.0 ChiLan1.0
HYOU1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 119,749,015 - 119,762,064 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 120,852,712 - 120,865,769 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 113,882,418 - 113,895,438 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 117,812,050 - 117,825,091 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 117,812,975 - 117,824,005 (-) Ensembl panpan1.1 panPan2
HYOU1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 14,795,750 - 14,808,203 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 14,795,750 - 14,807,262 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 14,848,571 - 14,860,968 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 14,738,891 - 14,751,288 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 14,738,464 - 14,751,437 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 14,876,904 - 14,889,447 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 14,780,910 - 14,793,451 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 14,821,311 - 14,832,539 (+) NCBI UU_Cfam_GSD_1.0
Hyou1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 101,084,483 - 101,101,869 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936542 4,005,610 - 4,018,135 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936542 4,005,616 - 4,018,135 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
HYOU1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 46,264,933 - 46,276,995 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 46,264,929 - 46,277,056 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 51,300,063 - 51,312,075 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
HYOU1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 110,418,497 - 110,431,636 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 110,417,942 - 110,431,590 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666043 15,603,358 - 15,616,849 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Hyou1
.
Confirmed Target Of
Mir27a rno-miR-27a-3p Mirtarbase external_info Microarray Functional MTI (Weak) 18258830
Predicted Target Of
Count of predictions: 231 Count of miRNA genes: 142 Interacting mature miRNAs: 180 Transcripts: ENSRNOT00000044613 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
1298065 Scl16 Serum cholesterol level QTL 16 3.8 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30856404 75856404 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 1578769 Uae31 Urinary albumin excretion QTL 31 3.3 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 30848154 101699754 Rat 1298079 Activ2 Activity QTL 2 9.5 0.000001 voluntary movement trait (VT:0003491) rearing measurement (CMO:0001515) 8 41866876 86866876 Rat 11556286 Cm81 Cardiac mass QTL 81 0.01 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 30848154 61290444 Rat 70161 Bp62 Blood pressure QTL 62 2.9 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 42692684 90165460 Rat 1578765 Klgr1 Kidney lesion grade QTL 1 3.3 0.0001 kidney morphology trait (VT:0002135) organ lesion measurement (CMO:0000677) 8 30848154 101699754 Rat 1582222 Epfw2 Epididymal fat weight QTL 2 3.2 0.0005 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 8 31737729 76737729 Rat 1354627 Despr14 Despair related QTL 14 0.0056 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 8 7688955 52688955 Rat 61464 Niddm11 Non-insulin dependent diabetes mellitus QTL 11 3.1 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 35582032 80582032 Rat 1578755 Pur5 Proteinuria QTL 5 3.3 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 8 30848154 101699754 Rat 1300146 Rf17 Renal function QTL 17 2.9 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 8 28242912 73242912 Rat 8662823 Vetf5 Vascular elastic tissue fragility QTL 5 1.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 8 28242912 99525068 Rat 2313088 Bss75 Bone structure and strength QTL 75 3.1 0.0001 body length (VT:0001256) body length, nose to rump (CMO:0000079) 8 30848154 82460899 Rat 1358896 Bp262 Blood pressure QTL 262 2.89 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 27205715 99103503 Rat 731182 Uae24 Urinary albumin excretion QTL 24 6.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 19331152 93965294 Rat 724514 Uae15 Urinary albumin excretion QTL 15 2.9 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 29502665 70386295 Rat 61353 Bp35 Blood pressure QTL 35 0.001 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 8 30848154 61290444 Rat 631842 Inf1 Infertility severity QTL 1 4.1 0.001 seminal gland mass (VT:0010524) seminal vesicle wet weight (CMO:0001603) 8 22662330 67662330 Rat 737824 Hcar10 Hepatocarcinoma resistance QTL 10 2.9 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 8 40713066 82925667 Rat 1359033 Bp273 Blood pressure QTL 273 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 61290444 Rat 1331769 Rf39 Renal function QTL 39 3.871 urine output (VT:0003620) timed urine volume (CMO:0000260) 8 41866876 75097878 Rat 61358 Bp39 Blood pressure QTL 39 2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 35551938 80551938 Rat 1358906 Bp253 Blood pressure QTL 253 4 0.0004 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 40713066 93965294 Rat 1358907 Cm40 Cardiac mass QTL 40 1.89 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 27205715 99103503 Rat 1331744 Bp217 Blood pressure QTL 217 3.398 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 58482492 Rat 2316950 Scl66 Serum cholesterol level QTL 66 4.1 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30848259 105647037 Rat 1358892 Kidm26 Kidney mass QTL 26 3.69 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 27205715 99103503 Rat 1359021 Bp271 Blood pressure QTL 271 1.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 26644912 46711092 Rat 631216 Stl9 Serum triglyceride level QTL 9 4.71 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 8 41867010 70386132 Rat 61373 Mcs4 Mammary carcinoma susceptibility QTL 4 1.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 8 16290444 61290444 Rat 2313057 Bss76 Bone structure and strength QTL 76 3 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 8 30848154 82460899 Rat 12879878 Bw183 Body weight QTL 183 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 43296169 98968765 Rat 1549908 Neudeg1 Neurodegradation QTL 1 5.5 0 nervous system integrity trait (VT:0010566) logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986) 8 30188867 94457446 Rat 12879879 Cm99 Cardiac mass QTL 99 0.001 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 43296169 98968765 Rat 2317030 Wbc5 White blood cell count QTL 5 3.21 0.005 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 8 8736635 53736635 Rat 1331804 Cm30 Cardiac mass QTL 30 3.77443 heart mass (VT:0007028) heart wet weight (CMO:0000069) 8 28242912 53961020 Rat 2313067 Bss77 Bone structure and strength QTL 77 3.1 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 8 30848154 82460899 Rat 2317032 Ginf2 Gastrointestinal inflammation QTL 2 3.21 0.005 liver integrity trait (VT:0010547) liver granuloma severity score (CMO:0002157) 8 4705810 49705810 Rat 2301416 Bp315 Blood pressure QTL 315 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 7670578 52670578 Rat 12879880 Cm100 Cardiac mass QTL 100 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 43296169 98968765 Rat 12879881 Cm101 Cardiac mass QTL 101 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 8 43296169 98968765 Rat 12879882 Am8 Aortic mass QTL 8 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 43296169 98968765 Rat 2317036 Livw3 Liver weight QTL 3 2.43 0.01 liver mass (VT:0003402) liver weight to body weight ratio (CMO:0000633) 8 4705810 49705810 Rat 12879883 Kidm65 Kidney mass QTL 65 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 43296169 98968765 Rat 12880023 Bw184 Body weight QTL 184 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 2097640 47097640 Rat 5684993 Bmd84 Bone mineral density QTL 84 4.1 tibia mineral mass (VT:1000283) bone mineral content (CMO:0001554) 8 42692684 50095447 Rat 12880028 Cm103 Cardiac mass QTL 103 0.02 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 2097640 47097640 Rat 2317051 Aia18 Adjuvant induced arthritis QTL 18 2.42 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 8 8736635 53736635 Rat 2317048 Ginf1 Gastrointestinal inflammation QTL 1 3.52 0.005 cecum mucosa thickness (VT:0010234) enterocolitis severity score (CMO:0002138) 8 4705810 49705810 Rat 12880025 Cm102 Cardiac mass QTL 102 0.044 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 8 2097640 47097640 Rat 1558646 Swd5 Spike wave discharge measurement QTL 5 3.45 0.00036 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge frequency (CMO:0001742) 8 14906751 59906751 Rat 2302278 Gluco36 Glucose level QTL 36 4.2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 29502665 50095447 Rat 12880044 Am9 Aortic mass QTL 9 0.007 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 2097640 47097640 Rat 631648 Stl5 Serum triglyceride level QTL 5 4 0.0003 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 27205715 54998217 Rat 1331838 Niddm61 Non-insulin dependent diabetes mellitus QTL 61 3.53 0.0004 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 36469535 99083736 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 631271 Lecl1 Lens clarity QTL 1 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 8 18984168 84531599 Rat 2303564 Gluco43 Glucose level QTL 43 3 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 26130187 71130187 Rat 1598824 Memor4 Memory QTL 4 2.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 8 9712220 53356647 Rat 2313046 Bss78 Bone structure and strength QTL 78 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 8 30848154 82460899 Rat 1354595 Despr4 Despair related QTL 4 2.16 0.0036 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 8 7688955 52688955 Rat 2303572 Insul13 Insulin level QTL 13 2 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 8 26130187 71130187 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000044613 ⟹ ENSRNOP00000039172
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 44,706,263 - 44,718,186 (+) Ensembl Rnor_6.0 Ensembl 8 48,699,769 - 48,711,910 (+) Ensembl
RefSeq Acc Id:
NM_001034028 ⟹ NP_001029200
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 53,602,882 - 53,614,998 (+) NCBI mRatBN7.2 8 44,706,073 - 44,718,189 (+) NCBI Rnor_6.0 8 48,699,796 - 48,711,912 (+) NCBI Rnor_5.0 8 47,318,767 - 47,330,883 (+) NCBI RGSC_v3.4 8 47,346,753 - 47,358,869 (+) RGD Celera 8 44,292,303 - 44,304,419 (+) RGD
Sequence:
CGCCGCGTCCGGGGCCGGCTGGTACGCGAGACGCTGCTAAGAGGGTCACAATGGCAGCTACAGTAAGGAGGCAGAGGCCAAGGAGGCTACTCTGTTGGGCCTTGGTGGCTGTCCTCTTGGCAGACCTG
hide sequence
RefSeq Acc Id:
NM_138867 ⟹ NP_620222
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 53,603,072 - 53,614,998 (+) NCBI mRatBN7.2 8 44,706,263 - 44,718,189 (+) NCBI Rnor_6.0 8 48,699,986 - 48,711,912 (+) NCBI Rnor_5.0 8 47,318,767 - 47,330,883 (+) NCBI RGSC_v3.4 8 47,346,753 - 47,358,869 (+) RGD Celera 8 44,292,493 - 44,304,419 (+) NCBI
Sequence:
TGAGGATGGAGCAGCGGTCGGGCCGCGGCTCCTAGGGGAGGCAGCGTGCTAGCTTCGGGGGCGGGCCAGTAGCGGGAGCGAGGGCCGTACGGACACCGGTCCCTTCGGCCTTGAAGTTCAGGCGCTGA
hide sequence
RefSeq Acc Id:
XM_006242884 ⟹ XP_006242946
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 53,602,923 - 53,614,996 (+) NCBI mRatBN7.2 8 44,706,122 - 44,718,189 (+) NCBI Rnor_6.0 8 48,699,845 - 48,711,910 (+) NCBI Rnor_5.0 8 47,318,767 - 47,330,883 (+) NCBI
Sequence:
GGCCACTGTAACAGTTTGCAAACGAAGGGGAGTTGTGAAGGGCCTGGGGTTGGGGTCGTGCTGC
hide sequence
RefSeq Acc Id:
XM_006242885 ⟹ XP_006242947
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 53,602,922 - 53,614,996 (+) NCBI mRatBN7.2 8 44,706,127 - 44,718,187 (+) NCBI Rnor_6.0 8 48,699,844 - 48,711,910 (+) NCBI Rnor_5.0 8 47,318,767 - 47,330,883 (+) NCBI
Sequence:
TGGCCACTGTAACAGTTTGCAAACGAAGGGGAGTTGTGAAGGGCCTGGGGTTGGGGTCGTGCTGCCGGCCCTGTGGGGTCACAATGGCAGCTACAGTAAGGAGGCAGAGGCCAAGGAGGCTACTCTGT
hide sequence
RefSeq Acc Id:
NP_001029200 ⟸ NM_001034028
- Peptide Label:
precursor
- UniProtKB:
Q6P136 (UniProtKB/TrEMBL), F1LN18 (UniProtKB/TrEMBL), A0A8J8XLC6 (UniProtKB/TrEMBL)
- Sequence:
MAATVRRQRPRRLLCWALVAVLLADLLALSDTLAVMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVTVTLKENERFLGDSAAGMAIKNPKATLRYFQHLLGKQADNPHVALYRSRFPEHELNVD
hide sequence
RefSeq Acc Id:
NP_620222 ⟸ NM_138867
- Peptide Label:
precursor
- UniProtKB:
Q6P136 (UniProtKB/TrEMBL), F1LN18 (UniProtKB/TrEMBL), A0A8J8XLC6 (UniProtKB/TrEMBL)
- Sequence:
MAATVRRQRPRRLLCWALVAVLLADLLALSDTLAVMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVTVTLKENERFLGDSAAGMAIKNPKATLRYFQHLLGKQADNPHVALYRSRFPEHELNVD
hide sequence
RefSeq Acc Id:
XP_006242946 ⟸ XM_006242884
- Peptide Label:
isoform X1
- UniProtKB:
Q6P136 (UniProtKB/TrEMBL), F1LN18 (UniProtKB/TrEMBL), A0A8J8XLC6 (UniProtKB/TrEMBL)
- Sequence:
MAATVRRQRPRRLLCWALVAVLLADLLALSDTLAVMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVTVTLKENERFLGDSAAGMAIKNPKATLRYFQHLLGKQADNPHVALYRSRFPEHELNVD
hide sequence
RefSeq Acc Id:
XP_006242947 ⟸ XM_006242885
- Peptide Label:
isoform X1
- UniProtKB:
Q6P136 (UniProtKB/TrEMBL), F1LN18 (UniProtKB/TrEMBL), A0A8J8XLC6 (UniProtKB/TrEMBL)
- Sequence:
MAATVRRQRPRRLLCWALVAVLLADLLALSDTLAVMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVTVTLKENERFLGDSAAGMAIKNPKATLRYFQHLLGKQADNPHVALYRSRFPEHELNVD
hide sequence
Ensembl Acc Id:
ENSRNOP00000039172 ⟸ ENSRNOT00000044613
RGD ID: 13695893 Promoter ID: EPDNEW_R6417 Type: initiation region Name: Hyou1_1 Description: hypoxia up-regulated 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 48,699,786 - 48,699,846 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Hyou1
hypoxia up-regulated 1
Orp150
oxygen regulated protein (150kD)
Symbol and Name updated
1299863 APPROVED
2002-08-07
Orp150
oxygen regulated protein (150kD)
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_cellular_localization
localized to the endoplasmic reticulum
633350
gene_expression
expressed only in hypoxic astrocytes
633350
