Advanced Search (OLGA)

Gene: Max (MYC associated factor X) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Max

Name:

MYC associated factor X

RGD ID:

621101

Description:

Enables DNA-binding transcription factor activity; identical protein binding activity; and sequence-specific DNA binding activity. Involved in several processes, including cellular response to peptide hormone stimulus; regulation of gene expression; and response to insulin. Located in PML body and dendrite. Human ortholog(s) of this gene implicated in lung small cell carcinoma and pheochromocytoma. Orthologous to human MAX (MYC associated factor X); PARTICIPATES IN mitogen activated protein kinase signaling pathway; small cell lung carcinoma pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

MGC124611; myc-associated factor X

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MAX (MYC associated factor X)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Max (Max protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Max (MYC associated factor X)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MAX (MYC associated factor X)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MAX (MYC associated factor X)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Max (MYC associated factor X)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MAX (MYC associated factor X)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MAX (MYC associated factor X)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Max (MYC associated factor X)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CRACR2B (calcium release activated channel regulator 2B)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	MAX (MYC associated factor X)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Max (Max protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	max (myc associated factor X)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mxl-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	Max	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mxl-3	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	max	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Related Pseudogenes:

Max-ps1

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	101,369,989 - 101,395,333 (-)	NCBI		GRCr8
mRatBN7.2	6	95,636,859 - 95,662,204 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	95,636,858 - 95,662,137 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	96,033,070 - 96,056,884 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	96,331,618 - 96,355,431 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	95,760,430 - 95,784,244 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	99,984,260 - 100,011,460 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	99,984,260 - 100,011,388 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	109,378,844 - 109,403,792 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	99,529,905 - 99,553,851 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	99,533,360 - 99,557,307 (-)	NCBI
Celera	6	94,056,185 - 94,080,083 (-)	NCBI		Celera
Cytogenetic Map	6	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Max	Rat	lung small cell carcinoma		ISO	MAX (Homo sapiens)	13793386	DNA:loss of heterozygosity:lung	RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Max	Rat	Hereditary Neoplastic Syndromes		ISO	MAX (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:1459463 more ...
Max	Rat	Hereditary Neoplastic Syndromes		ISO	MAX (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:1459463 more ...
Max	Rat	Hereditary Neoplastic Syndromes		ISO	MAX (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:1459463 more ...
Max	Rat	Hereditary Neoplastic Syndromes		ISO	MAX (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:1459463 more ...
Max	Rat	Hereditary Paraganglioma-Pheochromocytoma Syndromes		ISO	MAX (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hereditary Paraganglioma-Pheochromocytoma Syndromes	ClinVar	PMID:1459463 more ...
Max	Rat	Islet Cell Tumor Syndrome		ISO	MAX (Homo sapiens)	8554872	ClinVar Annotator: match by term: Chromaffinoma	ClinVar	PMID:21685915 more ...
Max	Rat	paraganglioma		ISO	MAX (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hereditary Paragangliomas and Pheochromocytomas	ClinVar	PMID:1459463 more ...
Max	Rat	paraganglioma		ISO	MAX (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:1459463 more ...
Max	Rat	paraganglioma		ISO	MAX (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hereditary Paragangliomas and Pheochromocytomas	ClinVar	PMID:1459463 more ...
Max	Rat	paraganglioma		ISO	MAX (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:1459463 more ...
Max	Rat	paraganglioma		ISO	MAX (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:1459463 more ...
Max	Rat	paraganglioma		ISO	MAX (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:1459463 more ...
Max	Rat	pheochromocytoma		ISO	MAX (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:1459463 more ...
Max	Rat	Polydactyly-Macrocephaly Syndrome		ISO	MAX (Homo sapiens)	8554872	ClinVar Annotator: match by term: Polydactyly-macrocephaly syndrome	ClinVar	PMID:25741868 more ...
Max	Rat	retinoblastoma		ISO	MAX (Homo sapiens)	8554872	ClinVar Annotator: match by term: Retinoblastoma	ClinVar	PMID:25741868 and PMID:28492532

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Max	Rat	nephroblastoma		ISO	MAX (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:28825729
Max	Rat	pheochromocytoma		ISO	MAX (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:21685915

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Max	Rat	pheochromocytoma		ISO	MAX (Homo sapiens)	7240710		OMIM
Max	Rat	Polydactyly-Macrocephaly Syndrome		ISO	MAX (Homo sapiens)	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Max	Rat	1,2-dimethylhydrazine	decreases expression	ISO	Max (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of MAX mRNA	CTD	PMID:22206623
Max	Rat	17beta-estradiol	increases expression	EXP		6480464	Estradiol results in increased expression of MAX mRNA	CTD	PMID:20068009
Max	Rat	17beta-estradiol	increases expression	ISO	MAX (Homo sapiens)	6480464	Estradiol results in increased expression of MAX mRNA	CTD	PMID:15223131 more ...
Max	Rat	17beta-estradiol	multiple interactions	ISO	MAX (Homo sapiens)	6480464	IGF1R mutant form promotes the reaction [Estradiol results in increased expression of MAX mRNA]	CTD	PMID:23094148
Max	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Max (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of MAX mRNA	CTD	PMID:21570461 and PMID:24058054
Max	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of MAX mRNA	CTD	PMID:33387578
Max	Rat	2,4-dinitrotoluene	affects expression	EXP		6480464	2 and 4-dinitrotoluene affects the expression of MAX mRNA	CTD	PMID:21346803
Max	Rat	4,4'-sulfonyldiphenol	affects methylation	ISO	Max (Mus musculus)	6480464	bisphenol S affects the methylation of MAX gene	CTD	PMID:31683443
Max	Rat	4-hydroxyphenyl retinamide	increases expression	ISO	Max (Mus musculus)	6480464	Fenretinide results in increased expression of MAX mRNA	CTD	PMID:28973697
Max	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of MAX mRNA	CTD	PMID:30047161
Max	Rat	acrylamide	increases expression	EXP		6480464	Acrylamide results in increased expression of MAX mRNA	CTD	PMID:28959563
Max	Rat	all-trans-retinoic acid	increases expression	ISO	MAX (Homo sapiens)	6480464	Tretinoin results in increased expression of MAX mRNA	CTD	PMID:16054129
Max	Rat	amitrole	decreases expression	EXP		6480464	Amitrole results in decreased expression of MAX mRNA	CTD	PMID:30047161
Max	Rat	amphetamine	increases expression	EXP		6480464	Amphetamine results in increased expression of MAX mRNA	CTD	PMID:30779732
Max	Rat	antirheumatic drug	decreases expression	ISO	MAX (Homo sapiens)	6480464	Antirheumatic Agents results in decreased expression of MAX mRNA	CTD	PMID:24449571
Max	Rat	Aroclor 1254	decreases expression	ISO	Max (Mus musculus)	6480464	Chlorodiphenyl (54% Chlorine) results in decreased expression of MAX mRNA	CTD	PMID:23650126
Max	Rat	arsane	multiple interactions	ISO	MAX (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of MAX mRNA	CTD	PMID:39836092
Max	Rat	arsenic atom	multiple interactions	ISO	MAX (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of MAX mRNA	CTD	PMID:39836092
Max	Rat	arsenous acid	decreases expression	ISO	MAX (Homo sapiens)	6480464	Arsenic Trioxide results in decreased expression of MAX mRNA	CTD	PMID:26046465
Max	Rat	arsenous acid	affects methylation	ISO	MAX (Homo sapiens)	6480464	Arsenic Trioxide affects the methylation of MAX promoter	CTD	PMID:26046465
Max	Rat	atrazine	increases expression	ISO	MAX (Homo sapiens)	6480464	Atrazine results in increased expression of MAX mRNA	CTD	PMID:22378314
Max	Rat	benzo[a]pyrene diol epoxide I	decreases expression	ISO	MAX (Homo sapiens)	6480464	7 more ...	CTD	PMID:19150397
Max	Rat	beta-lapachone	decreases expression	ISO	MAX (Homo sapiens)	6480464	beta-lapachone results in decreased expression of MAX mRNA	CTD	PMID:38218311
Max	Rat	beta-lapachone	increases expression	ISO	MAX (Homo sapiens)	6480464	beta-lapachone results in increased expression of MAX mRNA	CTD	PMID:38218311
Max	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of MAX mRNA	CTD	PMID:25181051
Max	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of MAX mRNA	CTD	PMID:34947998
Max	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of MAX gene	CTD	PMID:28505145
Max	Rat	cadmium dichloride	increases expression	ISO	MAX (Homo sapiens)	6480464	Cadmium Chloride results in increased expression of MAX mRNA	CTD	PMID:32512071
Max	Rat	cadmium dichloride	affects expression	EXP		6480464	Cadmium Chloride affects the expression of MAX mRNA	CTD	PMID:35525383
Max	Rat	casticin	decreases expression	ISO	Max (Mus musculus)	6480464	casticin results in decreased expression of MAX mRNA	CTD	PMID:28444820
Max	Rat	chlorpyrifos	increases expression	ISO	Max (Mus musculus)	6480464	Chlorpyrifos results in increased expression of MAX mRNA	CTD	PMID:37019170
Max	Rat	chromium(6+)	affects expression	ISO	Max (Mus musculus)	6480464	chromium hexavalent ion affects the expression of MAX mRNA	CTD	PMID:28472532
Max	Rat	copper atom	multiple interactions	ISO	MAX (Homo sapiens)	6480464	[Chelating Agents binds to Copper] which results in increased expression of MAX mRNA and [NSC 689534 binds to Copper] which results in increased expression of MAX mRNA	CTD	PMID:20971185 and PMID:30911355
Max	Rat	copper(0)	multiple interactions	ISO	MAX (Homo sapiens)	6480464	[Chelating Agents binds to Copper] which results in increased expression of MAX mRNA and [NSC 689534 binds to Copper] which results in increased expression of MAX mRNA	CTD	PMID:20971185 and PMID:30911355
Max	Rat	coumestrol	increases expression	ISO	MAX (Homo sapiens)	6480464	Coumestrol results in increased expression of MAX mRNA	CTD	PMID:19167446
Max	Rat	cyclosporin A	increases expression	ISO	MAX (Homo sapiens)	6480464	Cyclosporine results in increased expression of MAX mRNA	CTD	PMID:20106945
Max	Rat	diarsenic trioxide	affects methylation	ISO	MAX (Homo sapiens)	6480464	Arsenic Trioxide affects the methylation of MAX promoter	CTD	PMID:26046465
Max	Rat	diarsenic trioxide	decreases expression	ISO	MAX (Homo sapiens)	6480464	Arsenic Trioxide results in decreased expression of MAX mRNA	CTD	PMID:26046465
Max	Rat	dichlorine	multiple interactions	EXP		6480464	[Ozone co-treated with Chlorine] results in decreased expression of MAX mRNA	CTD	PMID:18636392
Max	Rat	dorsomorphin	multiple interactions	ISO	MAX (Homo sapiens)	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MAX mRNA	CTD	PMID:27188386
Max	Rat	doxorubicin	decreases expression	ISO	MAX (Homo sapiens)	6480464	Doxorubicin results in decreased expression of MAX mRNA	CTD	PMID:29803840
Max	Rat	elemental selenium	increases expression	ISO	MAX (Homo sapiens)	6480464	Selenium results in increased expression of MAX mRNA	CTD	PMID:19244175
Max	Rat	endosulfan	increases expression	ISO	MAX (Homo sapiens)	6480464	Endosulfan results in increased expression of MAX mRNA	CTD	PMID:30090376
Max	Rat	FR900359	increases phosphorylation	ISO	MAX (Homo sapiens)	6480464	FR900359 results in increased phosphorylation of MAX protein	CTD	PMID:37730182
Max	Rat	fulvestrant	increases methylation	ISO	MAX (Homo sapiens)	6480464	Fulvestrant results in increased methylation of MAX gene	CTD	PMID:31601247
Max	Rat	genistein	increases expression	ISO	MAX (Homo sapiens)	6480464	Genistein results in increased expression of MAX mRNA	CTD	PMID:26865667
Max	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of MAX mRNA	CTD	PMID:33387578
Max	Rat	indole-3-methanol	affects expression	EXP		6480464	indole-3-carbinol affects the expression of MAX mRNA	CTD	PMID:21396975
Max	Rat	lead(0)	increases expression	ISO	MAX (Homo sapiens)	6480464	Lead results in increased expression of MAX mRNA	CTD	PMID:19921347
Max	Rat	manganese atom	multiple interactions	ISO	MAX (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of MAX mRNA	CTD	PMID:39836092
Max	Rat	manganese(0)	multiple interactions	ISO	MAX (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of MAX mRNA	CTD	PMID:39836092
Max	Rat	manganese(II) chloride	multiple interactions	ISO	MAX (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of MAX mRNA	CTD	PMID:39836092
Max	Rat	mangiferin	decreases expression	ISO	Max (Mus musculus)	6480464	mangiferin results in decreased expression of MAX mRNA	CTD	PMID:15135318
Max	Rat	methoxychlor	decreases expression	EXP		6480464	Methoxychlor results in decreased expression of MAX mRNA	CTD	PMID:23303685
Max	Rat	methoxychlor	increases methylation	EXP		6480464	Methoxychlor results in increased methylation of MAX gene	CTD	PMID:23303685
Max	Rat	N-methyl-N'-nitro-N-nitrosoguanidine	increases expression	ISO	MAX (Homo sapiens)	6480464	Methylnitronitrosoguanidine results in increased expression of MAX mRNA	CTD	PMID:12634122
Max	Rat	ozone	multiple interactions	EXP		6480464	[Ozone co-treated with Chlorine] results in decreased expression of MAX mRNA	CTD	PMID:18636392
Max	Rat	paracetamol	affects expression	ISO	Max (Mus musculus)	6480464	Acetaminophen affects the expression of MAX mRNA	CTD	PMID:17562736
Max	Rat	pirinixic acid	multiple interactions	ISO	Max (Mus musculus)	6480464	[pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of MAX mRNA	CTD	PMID:19710929
Max	Rat	resveratrol	decreases expression	ISO	Max (Mus musculus)	6480464	resveratrol results in decreased expression of MAX protein	CTD	PMID:25505154
Max	Rat	SB 431542	multiple interactions	ISO	MAX (Homo sapiens)	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MAX mRNA	CTD	PMID:27188386
Max	Rat	selenium atom	increases expression	ISO	MAX (Homo sapiens)	6480464	Selenium results in increased expression of MAX mRNA	CTD	PMID:19244175
Max	Rat	silicon dioxide	increases expression	ISO	MAX (Homo sapiens)	6480464	Silicon Dioxide analog results in increased expression of MAX mRNA	CTD	PMID:25895662
Max	Rat	sodium arsenite	multiple interactions	ISO	MAX (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of MAX mRNA	CTD	PMID:39836092
Max	Rat	sulfadimethoxine	decreases expression	EXP		6480464	Sulfadimethoxine results in decreased expression of MAX mRNA	CTD	PMID:30047161
Max	Rat	sunitinib	increases expression	ISO	MAX (Homo sapiens)	6480464	Sunitinib results in increased expression of MAX mRNA	CTD	PMID:31533062
Max	Rat	thapsigargin	multiple interactions	ISO	MAX (Homo sapiens)	6480464	4-methoxycinnamate methyl ester promotes the reaction [Thapsigargin results in decreased expression of MAX mRNA] more ...	CTD	PMID:19442820
Max	Rat	thapsigargin	decreases expression	ISO	MAX (Homo sapiens)	6480464	Thapsigargin results in decreased expression of MAX mRNA	CTD	PMID:19442820
Max	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of MAX mRNA	CTD	PMID:34492290
Max	Rat	titanium dioxide	decreases methylation	ISO	Max (Mus musculus)	6480464	titanium dioxide results in decreased methylation of MAX gene and titanium dioxide results in decreased methylation of MAX promoter	CTD	PMID:35295148
Max	Rat	valproic acid	affects expression	ISO	MAX (Homo sapiens)	6480464	Valproic Acid affects the expression of MAX mRNA	CTD	PMID:25979313
Max	Rat	valproic acid	multiple interactions	ISO	MAX (Homo sapiens)	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MAX mRNA	CTD	PMID:27188386
Max	Rat	valproic acid	increases expression	ISO	MAX (Homo sapiens)	6480464	Valproic Acid results in increased expression of MAX mRNA	CTD	PMID:22083351 more ...
Max	Rat	vincristine	decreases expression	ISO	MAX (Homo sapiens)	6480464	Vincristine results in decreased expression of MAX mRNA	CTD	PMID:23649840
Max	Rat	zinc atom	increases expression	EXP		6480464	Zinc deficiency results in increased expression of MAX mRNA	CTD	PMID:11717422
Max	Rat	zinc(0)	increases expression	EXP		6480464	Zinc deficiency results in increased expression of MAX mRNA	CTD	PMID:11717422
Max	Rat	zoledronic acid	increases expression	ISO	MAX (Homo sapiens)	6480464	zoledronic acid results in increased expression of MAX mRNA	CTD	PMID:20977926

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Max	Rat	cellular response to peptide hormone stimulus		IEP		2316822	adrenomedullin	RGD
Max	Rat	cellular response to starvation		IEP		2316822	serum deprivation	RGD
Max	Rat	negative regulation of gene expression		IDA		2316831		RGD
Max	Rat	negative regulation of transcription by RNA polymerase II	involved_in	ISO	MAX (Homo sapiens)	1624291	PMID:10723141 and PMID:8521822	RGD	PMID:10723141 and PMID:8521822
Max	Rat	neuron apoptotic process		IEP		2316820		RGD
Max	Rat	positive regulation of DNA-templated transcription	involved_in	ISO	Max (Mus musculus)	1624291	PMID:20434984	RGD	PMID:20434984
Max	Rat	positive regulation of DNA-templated transcription	involved_in	ISO	MAX (Homo sapiens)	1624291	PMID:8425218	RGD	PMID:8425218
Max	Rat	positive regulation of transcription by RNA polymerase II	involved_in	ISO	Max (Mus musculus)	1624291	PMID:10601024	RGD	PMID:10601024
Max	Rat	positive regulation of transcription by RNA polymerase II	involved_in	IBA	MGI:108398 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Max	Rat	protein-containing complex assembly		IDA		2306213	Hdac1 more ...	RGD
Max	Rat	regulation of DNA-templated transcription		IMP		2290581		RGD
Max	Rat	regulation of DNA-templated transcription	acts_upstream_of_or_within	ISO	Max (Mus musculus)	1624291	MGI:104987 more ...	RGD	PMID:8521822
Max	Rat	regulation of DNA-templated transcription	involved_in	IEA	InterPro:IPR046347	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Max	Rat	regulation of transcription by RNA polymerase II	involved_in	ISO	MAX (Homo sapiens)	1624291	PMID:8425218	RGD	PMID:8425218
Max	Rat	regulation of transcription by RNA polymerase II	involved_in	ISO	Max (Mus musculus)	1624291	PMID:8521822	RGD	PMID:8521822
Max	Rat	response to axon injury		IEP		2316820		RGD
Max	Rat	response to insulin		IEP		2316824		RGD
Max	Rat	retina development in camera-type eye		IEP		2316820		RGD

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Max	Rat	cell projection	located_in	IEA	UniProtKB-KW:KW-0966	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Max	Rat	chromatin	located_in	ISO	MAX (Homo sapiens)	1624291	PMID:12837246	RGD	PMID:12837246
Max	Rat	dendrite		IDA		2316820		RGD
Max	Rat	dendrite	located_in	IEA	UniProtKB-SubCell:SL-0283	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Max	Rat	Mad-Max complex	part_of	ISO	MAX (Homo sapiens)	1624291	PMID:12553908	RGD	PMID:12553908
Max	Rat	MLL1 complex	part_of	ISS	UniProtKB:P61244	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Max	Rat	MLL1 complex	part_of	ISO	MAX (Homo sapiens)	1624291	PMID:15960975	RGD	PMID:15960975
Max	Rat	Myc-Max complex	part_of	ISO	MAX (Homo sapiens)	1624291	PMID:12553908	RGD	PMID:12553908
Max	Rat	Myc-Max complex	part_of	ISO	Max (Mus musculus)	1624291	PMID:20434984	RGD	PMID:20434984
Max	Rat	nucleus	located_in	ISO	Max (Mus musculus)	1624291	PMID:20434984 and PMID:22770845	RGD	PMID:20434984 and PMID:22770845
Max	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Max	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Max	Rat	nucleus	located_in	ISO	MAX (Homo sapiens)	1624291	PMID:10723141 and PMID:15358760	RGD	PMID:10723141 and PMID:15358760
Max	Rat	nucleus		IDA		2316820		RGD
Max	Rat	PML body		IDA		2316819		RGD
Max	Rat	protein-DNA complex	part_of	ISO	MAX (Homo sapiens)	1624291	PMID:16171389 and PMID:9399572	RGD	PMID:16171389 and PMID:9399572
Max	Rat	RNA polymerase II transcription regulator complex	part_of	ISO	MAX (Homo sapiens)	1624291	PMID:8425219 and PMID:8521822	RGD	PMID:8425219 and PMID:8521822
Max	Rat	RNA polymerase II transcription regulator complex	part_of	IBA	MGI:96921 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Max	Rat	DNA binding	enables	ISO	MAX (Homo sapiens)	1624291	PMID:9399572	RGD	PMID:9399572
Max	Rat	DNA binding	enables	ISO	Max (Mus musculus)	1624291	PMID:12970171 and PMID:8521822	RGD	PMID:12970171 and PMID:8521822
Max	Rat	DNA binding	enables	IEA	UniProtKB-KW:KW-0238	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Max	Rat	DNA-binding transcription factor activity		IMP		2290581		RGD
Max	Rat	DNA-binding transcription factor activity	enables	IBA	FB:FBgn0017578 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Max	Rat	DNA-binding transcription factor activity	enables	IEA	InterPro:IPR046347	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Max	Rat	DNA-binding transcription factor activity, RNA polymerase II-specific	enables	ISO	MAX (Homo sapiens)	1624291	PMID:8425218	RGD	PMID:8425218
Max	Rat	DNA-binding transcription factor binding	enables	ISO	MAX (Homo sapiens)	1624291	UniProtKB:P01106 and PMID:15674325	RGD	PMID:15674325
Max	Rat	DNA-binding transcription repressor activity, RNA polymerase II-specific	contributes_to	ISO	MAX (Homo sapiens)	1624291	PMID:8521822	RGD	PMID:8521822
Max	Rat	DNA-binding transcription repressor activity, RNA polymerase II-specific	enables	ISO	MAX (Homo sapiens)	1624291	PMID:26070438	RGD	PMID:26070438
Max	Rat	DNA-binding transcription repressor activity, RNA polymerase II-specific	enables	ISS	UniProtKB:P61244	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Max	Rat	E-box binding	enables	ISO	MAX (Homo sapiens)	1624291	PMID:16171389	RGD	PMID:16171389
Max	Rat	identical protein binding		IPI	Max (Rattus norvegicus)	2316831	homodimerization	RGD
Max	Rat	identical protein binding	enables	ISO	MAX (Homo sapiens)	1624291	UniProtKB:P61244 more ...	RGD	PMID:25609649 and PMID:9184233
Max	Rat	protein binding	enables	ISO	Max (Mus musculus)	1624291	UniProtKB:P01108 more ...	RGD	PMID:20211142 more ...
Max	Rat	protein binding	enables	ISO	MAX (Homo sapiens) and UniProtKB:P61244-2	1624291	UniProtKB:P50539 more ...	RGD	PMID:25416956
Max	Rat	protein binding	enables	ISO	MAX (Homo sapiens) and UniProtKB:P61244-4	1624291	UniProtKB:A0A6Q8PF08 more ...	RGD	PMID:32814053
Max	Rat	protein binding	enables	IPI	UniProtKB:P01106	8553449	PMID:11891322	IntAct
Max	Rat	protein binding	enables	IPI	UniProtKB:Q9QZM5	8553800	PMID:17304222	IntAct
Max	Rat	protein binding	enables	ISO	MAX (Homo sapiens)	1624291	UniProtKB:O75367 more ...	RGD	PMID:10597290 more ...
Max	Rat	protein dimerization activity	enables	IEA	InterPro:IPR036638	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Max	Rat	protein dimerization activity	enables	IEA	InterPro:IPR011598 and InterPro:IPR036638	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Max	Rat	protein-containing complex binding		IPI	Myc (Rattus norvegicus)	2290581	heterodimerization	RGD
Max	Rat	protein-containing complex binding		IDA		2306213	Hdac1 more ...	RGD
Max	Rat	protein-containing complex binding	NOT	IDA		2316831	heterodimerization and truncated variant	RGD
Max	Rat	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	ISO	Max (Mus musculus)	1624291	PMID:8521822	RGD	PMID:8521822
Max	Rat	RNA polymerase II transcription regulatory region sequence-specific DNA binding	contributes_to	ISO	MAX (Homo sapiens)	1624291	PMID:8425219 and PMID:8521822	RGD	PMID:8425219 and PMID:8521822
Max	Rat	sequence-specific DNA binding		IDA		2290581		RGD
Max	Rat	sequence-specific double-stranded DNA binding	enables	ISO	MAX (Homo sapiens)	1624291	PMID:28473536	RGD	PMID:28473536

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Max	Rat	mitogen activated protein kinase signaling pathway		IEA		6907045		KEGG	rno:04010
Max	Rat	small cell lung carcinoma pathway		IEA		6907045		KEGG	rno:05222

#	Reference Title	Reference Citation
1.	Involvement of c-myc and max in CNS beta-endorphin modulation of hepatic ornithine decarboxylase responsiveness to insulin in rat pups.	Bartolome JV, etal., Life Sci. 1999;64(5):PL87-91.
2.	Small-molecule antagonists of Myc/Max dimerization inhibit Myc-induced transformation of chicken embryo fibroblasts.	Berg T, etal., Proc Natl Acad Sci U S A. 2002 Mar 19;99(6):3830-5. Epub 2002 Mar 12.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	The nerve growth factor-responsive PC12 cell line does not express the Myc dimerization partner Max.	Hopewell R and Ziff EB, Mol Cell Biol. 1995 Jul;15(7):3470-8.
5.	Molecular cloning and sequencing of rat Max cDNA: castration-induced expression of the 2 kb transcript in male accessory sex organs of rats.	Izawa M Biochim Biophys Acta 1993 Dec 14;1216(3):492-4.
6.	c-Myc and ChREBP regulate glucose-mediated expression of the L-type pyruvate kinase gene in INS-1-derived 832/13 cells.	Jason Collier J, etal., Am J Physiol Endocrinol Metab. 2007 Jul;293(1):E48-56. Epub 2007 Mar 6.
7.	Induction of a novel histone deacetylase 1/c-Myc/Mnt/Max complex formation is implicated in parity-induced refractoriness to mammary carcinogenesis.	Matsuoka Y, etal., Cancer Sci. 2008 Feb;99(2):309-15.
8.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
9.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
11.	Early nuclear exclusion of the transcription factor max is associated with retinal ganglion cell death independent of caspase activity.	Petrs-Silva H, etal., J Cell Physiol. 2004 Feb;198(2):179-87.
12.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
13.	Abelson interacting protein 1 (Abi-1) is essential for dendrite morphogenesis and synapse formation.	Proepper C, etal., EMBO J. 2007 Mar 7;26(5):1397-409. Epub 2007 Feb 15.
14.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
15.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
16.	MAX inactivation in small cell lung cancer disrupts MYC-SWI/SNF programs and is synthetic lethal with BRG1.	Romero OA, etal., Cancer Discov. 2014 Mar;4(3):292-303. doi: 10.1158/2159-8290.CD-13-0799. Epub 2013 Dec 20.
17.	Induction of max by adrenomedullin and calcitonin gene-related peptide antagonizes endothelial apoptosis.	Shichiri M, etal., Mol Endocrinol. 1999 Aug;13(8):1353-63.
18.	c-Myc localization within the nucleus: evidence for association with the PML nuclear body.	Smith KP, etal., J Cell Biochem. 2004 Dec 15;93(6):1282-96.
19.	Expression and subcellular localization of the Myc superfamily proteins: c-Myc, Max, Mad1 and Mxi1 in the epiphyseal plate cartilage chondrocytes of growing rats.	Wang Y, etal., Cell Mol Biol (Noisy-le-grand). 1997 Mar;43(2):175-88.

PMID:8425219	PMID:8521822	PMID:9399572	PMID:10601024	PMID:12477932	PMID:12837246	PMID:12970171	PMID:15358760	PMID:15960975	PMID:16150871	PMID:16171389	PMID:18601921
PMID:20197614	PMID:22770845	PMID:26070438	PMID:35103748

Max
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	101,369,989 - 101,395,333 (-)	NCBI		GRCr8
mRatBN7.2	6	95,636,859 - 95,662,204 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	95,636,858 - 95,662,137 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	96,033,070 - 96,056,884 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	96,331,618 - 96,355,431 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	95,760,430 - 95,784,244 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	99,984,260 - 100,011,460 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	99,984,260 - 100,011,388 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	109,378,844 - 109,403,792 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	99,529,905 - 99,553,851 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	99,533,360 - 99,557,307 (-)	NCBI
Celera	6	94,056,185 - 94,080,083 (-)	NCBI		Celera
Cytogenetic Map	6	q24	NCBI

MAX
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	65,006,101 - 65,102,695 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	65,006,174 - 65,102,695 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	14	65,472,819 - 65,569,413 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	64,542,645 - 64,638,980 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	14	64,542,644 - 64,638,980	NCBI
Celera	14	45,527,481 - 45,623,823 (-)	NCBI		Celera
Cytogenetic Map	14	q23.3	NCBI
HuRef	14	45,642,154 - 45,738,669 (-)	NCBI		HuRef
CHM1_1	14	65,411,018 - 65,507,560 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	14	59,210,965 - 59,307,534 (-)	NCBI		T2T-CHM13v2.0

Max
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	76,984,045 - 77,009,123 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	76,984,043 - 77,008,975 (-)	Ensembl		GRCm39 Ensembl
GRCm38	12	76,937,269 - 76,962,323 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	76,937,269 - 76,962,201 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	12	78,038,256 - 78,063,235 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	12	77,856,109 - 77,881,025 (-)	NCBI		MGSCv36	mm8
Celera	12	78,019,503 - 78,044,521 (-)	NCBI		Celera
Cytogenetic Map	12	C3	NCBI
cM Map	12	33.78	NCBI

Max
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955466	4,816,568 - 4,842,659 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955466	4,816,568 - 4,842,659 (+)	NCBI	ChiLan1.0	ChiLan1.0

MAX
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	66,113,395 - 66,216,485 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	65,329,908 - 65,432,998 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	45,588,366 - 45,683,828 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	64,467,753 - 64,562,671 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	64,535,120 - 64,562,671 (-)	Ensembl	panpan1.1		panPan2

MAX
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	39,441,216 - 39,465,703 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	39,380,686 - 39,465,959 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	39,133,226 - 39,157,709 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	39,664,047 - 39,688,532 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	39,603,427 - 39,688,561 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	39,284,778 - 39,309,267 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	39,357,282 - 39,381,777 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	39,716,473 - 39,740,975 (-)	NCBI		UU_Cfam_GSD_1.0

Max
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	65,435,802 - 65,462,758 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936495	8,728,940 - 8,755,799 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936495	8,728,941 - 8,755,742 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MAX
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	89,142,969 - 89,168,201 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	89,142,966 - 89,168,265 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	95,519,256 - 95,544,583 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MAX
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	42,288,891 - 42,314,711 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	42,291,106 - 42,314,605 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666053	30,463,237 - 30,488,861 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Max
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624734	35,925,827 - 35,952,375 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Max
61 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	746
Count of miRNA genes:	267
Interacting mature miRNAs:	322
Transcripts:	ENSRNOT00000010954, ENSRNOT00000041442
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
12801411	Schws8	Schwannoma susceptibility QTL 8			nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	94968928	139968928	Rat
1331799	Bp211	Blood pressure QTL 211	3.66407		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	72202632	130919985	Rat
634330	Pia16	Pristane induced arthritis QTL 16	3.9		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	6	45790088	104200226	Rat
1331789	Rf37	Renal function QTL 37	3.224		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	6	72202632	115200186	Rat
1331725	Bp212	Blood pressure QTL 212	3.52475		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	93701310	128713626	Rat
1331722	Thshl1	Thyroid stimulating hormone level QTL 1	11.7	0.0001	blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	6	89762877	106752806	Rat
4145119	Mcs25	Mammary carcinoma susceptibility QTL 25		0.0001	mammary gland integrity trait (VT:0010552)	ratio of deaths to total study population during a period of time (CMO:0001023)	6	10894415	110548006	Rat
70176	Mcsm1	Mammary carcinoma susceptibility modifier QTL 1			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	58632962	103632962	Rat
1581563	Uae33	Urinary albumin excretion QTL 33			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	72227641	130729205	Rat
10054138	Gmadr3	Adrenal mass QTL 3	3.68	0.00045	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	6	85140138	130140138	Rat
1558641	Cm47	Cardiac mass QTL 47	2.9	0.001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	6	57730540	104085867	Rat
61414	Pia3	Pristane induced arthritis QTL 3	4.5		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	6	94968928	137848904	Rat
724524	Uae2	Urinary albumin excretion QTL 2	2.7	0.0005	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	73463459	109394713	Rat
737827	Hcar11	Hepatocarcinoma resistance QTL 11	4.4		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	6	82523650	110548006	Rat
1641904	Alcrsp4	Alcohol response QTL 4			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	6	67262953	112262953	Rat
724513	Uae14	Urinary albumin excretion QTL 14	6.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	85311061	133478515	Rat
2303624	Vencon5	Ventilatory control QTL 5	4.45		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	6	88047916	133047916	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	15107216	107351382	Rat
731173	Uae22	Urinary albumin excretion QTL 22	10.1		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
2293837	Kiddil1	Kidney dilation QTL 1	3.7		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	81132889	104393926	Rat
2293842	Kiddil3	Kidney dilation QTL 3	4.3		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	81132889	104393926	Rat
10054123	Srcrt6	Stress Responsive Cort QTL 6	2.5	0.0043	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	85140138	130140138	Rat
724536	Uae7	Urinary albumin excretion QTL 7	3.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	72202632	130729475	Rat
70196	BpQTLcluster7	Blood pressure QTL cluster 7	6.82		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	72202632	117202632	Rat
1581550	Pur8	Proteinuria QTL 8			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	72227641	130729205	Rat
1576302	Schws4	Schwannoma susceptibility QTL 4		0.0078	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	83190345	106747639	Rat
1300075	Glom7	Glomerulus QTL 7	5.6	0.0000002	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	6	71201409	116201409	Rat
738034	Anxrr5	Anxiety related response QTL 5	5.9		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	6	84130881	129130881	Rat
2290393	Uae37	Urinary albumin excretion QTL 37		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
12801471	Schws9	Schwannoma susceptibility QTL 9			nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	61747639	106747639	Rat
6893332	Cm74	Cardiac mass QTL 74	0.4	0.64	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	6	57730540	104085867	Rat
1300076	Glom8	Glomerulus QTL 8	7	9e-09	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	6	86894788	131894788	Rat

D6Got122

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	95,646,538 - 95,646,660 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	99,995,804 - 99,995,925	NCBI	Rnor6.0
Rnor_5.0	6	109,388,151 - 109,388,272	UniSTS	Rnor5.0
RGSC_v3.4	6	99,538,348 - 99,538,470	RGD	RGSC3.4
RGSC_v3.4	6	99,538,349 - 99,538,470	UniSTS	RGSC3.4
RGSC_v3.1	6	99,541,805 - 99,541,926	RGD
Celera	6	94,064,677 - 94,064,798	UniSTS
RH 3.4 Map	6	673.4	RGD
RH 3.4 Map	6	673.4	UniSTS
Cytogenetic Map	6	q24	UniSTS

BI277538

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	52,947,739 - 52,948,041 (+)	MAPPER	mRatBN7.2
mRatBN7.2	6	95,636,962 - 95,637,145 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	99,984,365 - 99,984,547	NCBI	Rnor6.0
Rnor_6.0	6	55,706,624 - 55,706,925	NCBI	Rnor6.0
Rnor_5.0	6	65,321,005 - 65,321,306	UniSTS	Rnor5.0
Rnor_5.0	6	109,378,949 - 109,379,131	UniSTS	Rnor5.0
RGSC_v3.4	6	54,941,318 - 54,941,619	UniSTS	RGSC3.4
RGSC_v3.4	6	99,528,751 - 99,528,933	UniSTS	RGSC3.4
Celera	6	94,055,031 - 94,055,213	UniSTS
Celera	6	52,090,030 - 52,090,333	UniSTS
RH 3.4 Map	6	669.3	UniSTS
Cytogenetic Map	6	q16	UniSTS
Cytogenetic Map	6	q24	UniSTS

RH128859

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	95,636,903 - 95,637,083 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	99,984,306 - 99,984,485	NCBI	Rnor6.0
Rnor_5.0	6	109,378,890 - 109,379,069	UniSTS	Rnor5.0
RGSC_v3.4	6	99,528,692 - 99,528,871	UniSTS	RGSC3.4
Celera	6	94,054,972 - 94,055,151	UniSTS
Cytogenetic Map	6	q24	UniSTS

AI237355

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	52,949,383 - 52,949,578 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	55,708,268 - 55,708,458	NCBI	Rnor6.0
RH 3.4 Map	6	362.7	UniSTS
Cytogenetic Map	6	q24	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001411963	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_022210	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NR_177987	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NR_177988	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NR_177989	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063262440	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063262441	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063262442	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_593084	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC099778	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D14447	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D14448	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212266	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220892	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000010954 ⟹ ENSRNOP00000010954

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	95,636,858 - 95,662,128 (-)	Ensembl
Rnor_6.0 Ensembl	6	99,984,260 - 100,011,388 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000041442 ⟹ ENSRNOP00000040275

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	6	99,985,519 - 100,011,226 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000083286 ⟹ ENSRNOP00000072268

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	6	99,985,519 - 100,011,226 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000106817 ⟹ ENSRNOP00000086002

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	95,636,862 - 95,662,137 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000107085 ⟹ ENSRNOP00000082617

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	95,636,862 - 95,662,137 (-)	Ensembl

RefSeq Acc Id:

NM_001411963 ⟹ NP_001398892

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	101,369,989 - 101,395,290 (-)	NCBI
mRatBN7.2	6	95,636,859 - 95,662,161 (-)	NCBI

RefSeq Acc Id:

NM_022210 ⟹ NP_071546

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	101,369,989 - 101,395,290 (-)	NCBI
mRatBN7.2	6	95,636,859 - 95,662,161 (-)	NCBI
Rnor_6.0	6	99,985,519 - 100,011,226 (-)	NCBI
Rnor_5.0	6	109,378,844 - 109,403,792 (-)	NCBI
RGSC_v3.4	6	99,529,905 - 99,553,851 (-)	RGD
Celera	6	94,056,185 - 94,080,083 (-)	RGD

Sequence:

show sequence

ATGAGCGATAACGATGACATCGAGGTGGAGAGCGACGAAGAGCAACCGAGGTTTCAATCTGCGGCTGACAAACGGGCTCACCATAATGCACTGGAACGAAAACGTAGGGACCACATCAAAGACAGCTT
TCACAGTTTGCGGGACTCAGTCCCATCACTCCAAGGAGAGAAGGCATCCCGGGCCCAAATCCTAGACAAAGCAACAGAGTATATCCAGTATATGCGAAGGAAAAACCATACGCACCAGCAAGACATTG
ATGACCTCAAGCGGCAGAATGCTCTTCTGGAGCAACAAGTCCGTGCACTGGAGAAGGCAAGATCAAGTGCCCAACTGCAGACCAACTACCCCTCCTCAGACAACAGCCTCTACACCAACGCCAAGGGC
GGCACCATCTCTGCCTTCGATGGGGGTTCAGACTCCAGCTCAGAGTCCGAGCCTGAGGAGCCCCAGAACAGGAAGAAACTGCGGATGGAGGCCAGCTAA

hide sequence

RefSeq Acc Id:

NR_177987

RefSeq Status:

VALIDATED

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	101,369,989 - 101,395,290 (-)	NCBI
mRatBN7.2	6	95,636,859 - 95,662,161 (-)	NCBI

RefSeq Acc Id:

NR_177988

RefSeq Status:

VALIDATED

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	101,369,989 - 101,395,290 (-)	NCBI
mRatBN7.2	6	95,636,859 - 95,662,161 (-)	NCBI

RefSeq Acc Id:

NR_177989

RefSeq Status:

VALIDATED

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	101,369,989 - 101,395,290 (-)	NCBI
mRatBN7.2	6	95,636,859 - 95,662,161 (-)	NCBI

RefSeq Acc Id:

XM_063262440 ⟹ XP_063118510

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	101,369,989 - 101,395,333 (-)	NCBI

RefSeq Acc Id:

XM_063262441 ⟹ XP_063118511

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	101,369,989 - 101,395,001 (-)	NCBI

RefSeq Acc Id:

XM_063262442 ⟹ XP_063118512

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	101,369,989 - 101,395,325 (-)	NCBI

RefSeq Acc Id:

XR_593084

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	101,371,268 - 101,395,333 (-)	NCBI
mRatBN7.2	6	95,638,138 - 95,662,204 (-)	NCBI
Rnor_6.0	6	99,985,511 - 100,011,460 (-)	NCBI

Sequence:

show sequence

CCCGGTCACGTGTTAGGGGGCCGATCGGGCGTGCGTGCCGCCGTTGATCCGGTGCTACAGTGAGGTGGTTGTCGCCCGTGTTGTGTGTGTGTGAGTGTGTGAGTGAGTGAGCGAGTGAGTGAGTGAGT
GTGTGCGTGGGGGCACTCGGCTTGTTGTTGTCGGTGACTTCCCCCTTCCCTCCACCCCTCCCCTCCCCGGCCGCCGCTGCAGTGGCCGCTCCCTGGGCCGTAGGAAATGAGCGATAACGATGACATCG
AGGTGGAGAGCGACGAAGAGCAACCGAGGTTTCAATCTGCGGCTGACAAACGGGCTCACCATAATGCACTGGAACGAAAACGTAGGGACCACATCAAAGACAGCTTTCACAGTTTGCGGGACTCAGTC
CCATCACTCCAAGGAGAGAAGGCATCCCGGGCCCAAATCCTAGACAAAGCAACAGAGTATATCCAGTATATGCGAAGGAAAAACCATACGCACCAGCAAGACATTGATGACCTCAAGCGGCAGAATGC
TCTTCTGGAGCAACAAGGGGAAAGCGAGAGCTGATCAAGTTCTTTGTTCCTGGGGAATTCACTTCTCTTCCTCCCTCATGGAAGATGCAAGTAAAAGGAAATGCAAGTAACCACCTGGTCCGTGCACT
GGAGAAGGCAAGATCAAGTGCCCAACTGCAGACCAACTACCCCTCCTCAGACAACAGCCTCTACACCAACGCCAAGGGCGGCACCATCTCTGCCTTCGATGGGGGTTCAGACTCCAGCTCAGAGTCCG
AGCCTGAGGAGCCCCAGAACAGGAAGAAACTGCGGATGGAGGCCAGCTAAGCCATGCG

hide sequence


Protein RefSeqs	NP_001398892	(Get FASTA)	NCBI Sequence Viewer
	NP_071546	(Get FASTA)	NCBI Sequence Viewer
	XP_063118510	(Get FASTA)	NCBI Sequence Viewer
	XP_063118511	(Get FASTA)	NCBI Sequence Viewer
	XP_063118512	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH99778	(Get FASTA)	NCBI Sequence Viewer
	BAA03337	(Get FASTA)	NCBI Sequence Viewer
	BAA03338	(Get FASTA)	NCBI Sequence Viewer
	EDM03679	(Get FASTA)	NCBI Sequence Viewer
	EDM03680	(Get FASTA)	NCBI Sequence Viewer
	EDM03681	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000010954
	ENSRNOP00000086002
	ENSRNOP00000086002.1
GenBank Protein	P52164	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_071546 ⟸ NM_022210
- Peptide Label:	isoform 1
- UniProtKB:	P52164 (UniProtKB/Swiss-Prot), A6HCC6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDNSLYTNAKG GTISAFDGGSDSSSESEPEEPQNRKKLRMEAS hide sequence

Ensembl Acc Id:

ENSRNOP00000040275 ⟸ ENSRNOT00000041442

Ensembl Acc Id:

ENSRNOP00000072268 ⟸ ENSRNOT00000083286

Ensembl Acc Id:

ENSRNOP00000010954 ⟸ ENSRNOT00000010954

Ensembl Acc Id:

ENSRNOP00000086002 ⟸ ENSRNOT00000106817

Protein Domains

bHLH

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P52164-F1-model_v2	AlphaFold	P52164	1-160	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13694690

Promoter ID:

EPDNEW_R5208

Type:

initiation region

Name:

Max_1

Description:

MYC associated factor X

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	6	100,011,404 - 100,011,464	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-37040	BioCyc
Ensembl Genes	ENSRNOG00000008049	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000010954	ENTREZGENE
	ENSRNOT00000106817	ENTREZGENE
	ENSRNOT00000106817.1	UniProtKB/Swiss-Prot
	ENSRNOT00000107085	ENTREZGENE
Gene3D-CATH	4.10.280.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7933028	IMAGE-MGC_LOAD
InterPro	bHLH_dom	UniProtKB/Swiss-Prot
	HLH_DNA-bd_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:60661	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:124611	IMAGE-MGC_LOAD
NCBI Gene	60661	ENTREZGENE
PANTHER	PROTEIN MAX	UniProtKB/Swiss-Prot
	PTHR10328	UniProtKB/Swiss-Prot
Pfam	HLH	UniProtKB/Swiss-Prot
PharmGKB	MAX	RGD
PhenoGen	Max	PhenoGen
PROSITE	BHLH	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000008049	RatGTEx
SMART	HLH	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF47459	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZV85	ENTREZGENE, UniProtKB/TrEMBL
	A6HCC4_RAT	UniProtKB/TrEMBL
	A6HCC5	ENTREZGENE, UniProtKB/TrEMBL
	A6HCC6	ENTREZGENE, UniProtKB/TrEMBL
	MAX_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q499S8	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-10-24	Max	MYC associated factor X	Max	Max protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Max	Max protein		Max	Name updated	1299863	APPROVED
2002-08-07	Max	Max			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)