Advanced Search (OLGA)

Gene: H3f3b (H3.3 histone B) Rattus norvegicus

Analyze

Symbol:

H3f3b

Name:

H3.3 histone B

RGD ID:

621095

Description:

Predicted to enable RNA polymerase II cis-regulatory region sequence-specific DNA binding activity; RNA polymerase II core promoter sequence-specific DNA binding activity; and nucleosomal DNA binding activity. Predicted to be a structural constituent of chromatin. Involved in response to hormone. Predicted to be located in chromosome, telomeric region. Predicted to be part of nucleosome. Predicted to be active in nucleus. Human ortholog(s) of this gene implicated in Bryant-Li-Bhoj neurodevelopmental syndrome 2. Orthologous to several human genes including H3-3B (H3.3 histone B); PARTICIPATES IN histone modification pathway; systemic lupus erythematosus pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene; 4-tert-Octylphenol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

H3 histone family member 3B; H3 histone, family 3B; H3-3b; H3.3B; histone H3.3; MGC105794

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	H3-3B (H3.3 histone B)	RGD	RGD
Mus musculus (house mouse):	H3f3b (H3.3 histone B)	RGD	RGD
Chinchilla lanigera (long-tailed chinchilla):	H3f3b (H3 histone, family 3B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LOC100988671 (histone H3.3A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	LOC101963257 (histone H3.3A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	H3-3B (H3.3 histone B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	H3-3B (H3.3 histone B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	LOC101698172 (histone H3.3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	LOC116909029 (histone H3.3A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	H3-3A (H3.3 histone A)	HGNC	HomoloGene, Panther, PhylomeDB
Homo sapiens (human):	H3-5 (H3.5 histone)	HGNC	Panther
Alliance orthologs ³
Homo sapiens (human):	H3-3B (H3.3 histone B)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	H3-3B (H3.3 histone B)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	H3f3b (H3.3 histone B)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	H3f3a (H3.3 histone A)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	H3-5 (H3.5 histone)	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	h3f3a (H3 histone, family 3A)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	h3f3a (H3 histone, family 3A)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	h3f3d (H3 histone, family 3D)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	h3f3d (H3 histone, family 3D)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	h3f3c (H3 histone, family 3C)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	h3f3c (H3 histone, family 3C)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	si:ch1073-429i10.3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	si:ch1073-429i10.3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	h3f3b.1 (H3 histone, family 3B.1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	h3f3b.1 (H3 histone, family 3B.1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	HHT1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	HHT1	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His3.3A	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His3.3B	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	HHT2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	HHT2	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	his-71	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	his-72	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)
Caenorhabditis elegans (roundworm):	his-72	Alliance	DIOPT (OMA\|OrthoFinder\|OrthoInspector\|PANTHER)
Caenorhabditis elegans (roundworm):	his-74	Alliance	DIOPT (Ensembl Compara\|OMA\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	h3-3b	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	h3-3a	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	101,755,404 - 101,764,616 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	101,755,404 - 101,757,636 (-)	Ensembl				GRCr8
mRatBN7.2	10	101,256,484 - 101,258,716 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	92,533,298 - 92,544,908 (-)	Ensembl				mRatBN7.2
mRatBN7.2 Ensembl	10	101,256,480 - 101,258,709 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	106,317,943 - 106,320,175 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	105,781,026 - 105,783,258 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	101,177,427 - 101,179,659 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	104,573,666 - 104,575,890 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	104,573,664 - 104,575,890 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	103,709,482 - 103,711,706 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	106,130,320 - 106,132,544 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	99,830,619 - 99,832,836 (-)	NCBI		Celera
RGSC_v3.1	10	106,144,823 - 106,147,045 (-)	NCBI
Cytogenetic Map	10	q32.1	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Animal Mammary Neoplasms (ISO)

Bryant-Li-Bhoj neurodevelopmental syndrome 2 (ISO)

carcinoma (ISO)

chondroblastoma (ISO)

Developmental Disabilities (ISO)

Experimental Mammary Neoplasms (ISO)

genetic disease (ISO)

Neurodevelopmental Disorders (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-diaminotoluene (ISO)

2,6-dinitrotoluene (EXP)

2-methylcholine (ISO)

3-methylcholanthrene (ISO)

4-tert-Octylphenol (EXP)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP)

6-propyl-2-thiouracil (EXP)

acrolein (ISO)

acrylamide (EXP)

aflatoxin B1 (EXP)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

amiodarone (EXP)

ammonium chloride (EXP)

amphetamine (EXP)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

atrazine (EXP)

benzbromarone (EXP)

benzene (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (ISO)

Butylbenzyl phthalate (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbamazepine (ISO)

CGP 52608 (ISO)

chlorpyrifos (EXP,ISO)

chromium(6+) (ISO)

ciguatoxin CTX1B (ISO)

cisplatin (ISO)

clofibrate (EXP,ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

DDE (ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP,ISO)

dicrotophos (ISO)

diethyl phthalate (ISO)

diethylstilbestrol (EXP)

diisobutyl phthalate (ISO)

diisononyl phthalate (ISO)

diuron (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

Enterolactone (ISO)

ethanol (ISO)

flutamide (EXP)

folic acid (ISO)

formaldehyde (ISO)

fumonisin B1 (ISO)

gentamycin (EXP)

L-ethionine (EXP)

lead diacetate (ISO)

Mesaconitine (EXP)

methotrexate (ISO)

nefazodone (EXP)

omeprazole (EXP)

ozone (ISO)

p-tert-Amylphenol (EXP)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

PhIP (EXP)

pinosylvin (ISO)

pirinixic acid (EXP,ISO)

pregnenolone 16alpha-carbonitrile (ISO)

resveratrol (EXP,ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

Soman (EXP)

succimer (ISO)

tamoxifen (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trans-pinosylvin (ISO)

trichostatin A (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

heterochromatin formation (IBA)

kinetochore assembly (IBA)

mitotic metaphase chromosome alignment (IBA)

nucleosome assembly (ISO)

positive regulation of cell growth (ISO)

response to hormone (IEP)

Cellular Component

chromosome (IEA)

chromosome, telomeric region (ISO)

kinetochore (IBA)

nucleoplasm (ISO)

nucleosome (IBA,IEA,ISO)

nucleus (IBA,IEA,ISO)

protein-containing complex (ISO)

Molecular Function

DNA binding (IEA)

nucleosomal DNA binding (IBA,ISO)

protein binding (ISO)

protein heterodimerization activity (IEA)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (ISO)

RNA polymerase II core promoter sequence-specific DNA binding (ISO)

structural constituent of chromatin (IBA,IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

histone modification pathway (ISO)

systemic lupus erythematosus pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	H1(0) and H3.3B mRNA levels in developing rat brain.	Castiglia D, etal., Neurochem Res 1994 Dec;19(12):1531-7.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Every amino acid matters: essential contributions of histone variants to mammalian development and disease.	Maze I, etal., Nat Rev Genet. 2014 Apr;15(4):259-71. doi: 10.1038/nrg3673. Epub 2014 Mar 11.
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
6.	GOA pipeline	RGD automated data pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Comprehensive gene review and curation	RGD comprehensive gene curation
9.	Posttranscriptional regulation of H1 zero and H3.3B histone genes in differentiating rat cortical neurons.	Scaturro M, etal., Neurochem Res. 1995 Aug;20(8):969-76.
10.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:7534202	PMID:9582357	PMID:12560483	PMID:14718166	PMID:15273246	PMID:15489334	PMID:15607978	PMID:15746254	PMID:19135898	PMID:19633671	PMID:20094059	PMID:20110566
PMID:20458337	PMID:20513656	PMID:21274551	PMID:21630459	PMID:21636898	PMID:22371606	PMID:22705305	PMID:22871113	PMID:23570311	PMID:23903189	PMID:24747049	PMID:25615412
PMID:25675407	PMID:26159997	PMID:26388943	PMID:35352799

Genomics

Comparative Map Data

H3f3b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	101,755,404 - 101,764,616 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	101,755,404 - 101,757,636 (-)	Ensembl				GRCr8
mRatBN7.2	10	101,256,484 - 101,258,716 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	92,533,298 - 92,544,908 (-)	Ensembl				mRatBN7.2
mRatBN7.2 Ensembl	10	101,256,480 - 101,258,709 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	106,317,943 - 106,320,175 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	105,781,026 - 105,783,258 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	101,177,427 - 101,179,659 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	104,573,666 - 104,575,890 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	104,573,664 - 104,575,890 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	103,709,482 - 103,711,706 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	106,130,320 - 106,132,544 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	99,830,619 - 99,832,836 (-)	NCBI		Celera
RGSC_v3.1	10	106,144,823 - 106,147,045 (-)	NCBI
Cytogenetic Map	10	q32.1	NCBI

H3-3B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	75,776,434 - 75,779,779 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	75,776,434 - 75,785,893 (-)	Ensembl			hg38	GRCh38
GRCh37	17	73,772,515 - 73,775,860 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	71,284,110 - 71,287,455 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	17	71,284,111 - 71,287,455	NCBI
Celera	17	70,362,565 - 70,365,910 (-)	NCBI		Celera
Cytogenetic Map	17	q25.1	NCBI
HuRef	17	69,198,034 - 69,201,379 (-)	NCBI		HuRef
CHM1_1	17	73,837,589 - 73,840,931 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	76,669,660 - 76,678,707 (-)	NCBI		T2T-CHM13v2.0

H3f3b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	115,912,787 - 115,921,313 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	115,912,738 - 115,918,788 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm39 Ensembl	11	115,909,962 - 115,921,332 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	11	116,021,961 - 116,026,039 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	116,021,912 - 116,027,962 (-)	Ensembl			mm10	GRCm38
MGSCv37	11	115,883,275 - 115,885,818 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	11	115,837,018 - 115,840,587 (-)	NCBI		MGSCv36	mm8
Celera	11	127,784,227 - 127,786,770 (-)	NCBI		Celera
Cytogenetic Map	11	E2	NCBI
cM Map	11	80.91	NCBI

H3f3b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955506	6,474,727 - 6,482,244 (+)	Ensembl
ChiLan1.0	NW_004955506	6,475,336 - 6,478,781 (+)	NCBI	ChiLan1.0	ChiLan1.0

LOC100988671
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	91,821,558 - 91,824,038 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	96,646,832 - 96,648,754 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	69,728,165 - 69,730,519 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	75,277,614 - 75,281,106 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	75,277,614 - 75,281,106 (-)	Ensembl			panPan2	panpan1.1

LOC101963257
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	5,450,377 - 5,452,805 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936594	958,049 - 961,708 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936594	959,493 - 961,703 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

H3-3B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	5,632,365 - 5,634,726 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	12	5,632,326 - 5,634,977 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	5,578,702 - 5,581,109 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

H3-3B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	45,903,252 - 45,905,605 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	45,902,980 - 45,904,929 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666077	16,660,280 - 16,662,641 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

LOC101698172
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624801	5,668,661 - 5,672,164 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

LOC116909029
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	9	68,035,873 - 68,038,132 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in H3f3b
52 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	219
Count of miRNA genes:	123
Interacting mature miRNAs:	165
Transcripts:	ENSRNOT00000050223
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354641	Bvd2	Brain ventricular dilatation QTL 2	6.36	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	10	93723381	107556066	Rat
8657410	Bp374	Blood pressure QTL 374			heart left ventricle size trait (VT:0002753)	heart left ventricle end-diastolic diameter (CMO:0000982)	10	67476608	107713808	Rat
61449	Ciaa2	CIA Autoantibody QTL 2	7.1		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	10	63719161	107713808	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42546145	107713808	Rat
1549831	Bss6	Bone structure and strength QTL 6	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	10	58073360	103073360	Rat
12903252	Cm113	Cardiac mass QTL 113		0.047	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	66817119	107713808	Rat
2298548	Neuinf7	Neuroinflammation QTL 7	3.4		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	10	64939013	107713808	Rat
1302404	Cia27	Collagen induced arthritis QTL 27	2.6	0.0045	joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	10	76951790	107713808	Rat
1300107	Rf18	Renal function QTL 18	3.41		urine output (VT:0003620)	timed urine volume (CMO:0000260)	10	79272424	102982300	Rat
70168	Eae12	Experimental allergic encephalomyelitis QTL 12		0.0009	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	73599825	107713808	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	54296227	107713808	Rat
12903269	Am15	Aortic mass QTL 15		0.042	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	66817119	107713808	Rat
12903266	Cm114	Cardiac mass QTL 114		0.02	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	10	66817119	107713808	Rat
1578672	Bmd16	Bone mineral density QTL 16	6.2		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	97202388	107556066	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62556066	107556066	Rat
70193	Mcs7	Mammary carcinoma susceptibility QTL 7	2.38		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72724423	107713808	Rat
12880372	Am12	Aortic mass QTL 12		0.003	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	66817119	107713808	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62556066	107556066	Rat
61363	Oia3	Oil induced arthritis QTL 3		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	87807758	107713808	Rat
12880375	Kidm66	Kidney mass QTL 66		0.009	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	66817119	107713808	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14991535	107556066	Rat
12880370	Cm105	Cardiac mass QTL 105		0.008	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	10	66817119	107713808	Rat
12880371	Cm106	Cardiac mass QTL 106		0.007	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	66817119	107713808	Rat
1300137	Bp186	Blood pressure QTL 186	3.57		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	10	91127270	107556066	Rat
11565453	Kidm58	Kidney mass QTL 58		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	66817119	107713808	Rat
1578663	Bss18	Bone structure and strength QTL 18	3.6		femur width (VT:1000666)	femoral neck width (CMO:0001695)	10	97202388	107556066	Rat
7387312	Bw125	Body weight QTL 125	3	0.0047	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight (CMO:0000356)	10	65390777	107713808	Rat
6893357	Bw102	Body weight QTL 102	0.5	0.36	body mass (VT:0001259)	body weight (CMO:0000012)	10	81012077	101828297	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	52269185	107713808	Rat
61396	Bp9	Blood pressure QTL 9	4.8	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68920187	107713808	Rat
1358915	Stresp7	Stress response QTL 7	3.52		blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	65307813	107713808	Rat
634320	Niddm49	Non-insulin dependent diabetes mellitus QTL 49	4.41		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	10	89039175	107713808	Rat
70363	Bp71	Blood pressure QTL 71		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	61843496	106843496	Rat
6893366	Bw106	Body weight QTL 106	0.3	0.47	body mass (VT:0001259)	body weight (CMO:0000012)	10	70698731	107713808	Rat
1576313	Pia25	Pristane induced arthritis QTL 25			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	96620293	107713808	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
1576307	Cia28	Collagen induced arthritis QTL 28			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	96620293	107713808	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40535708	107713808	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14991535	107713808	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
1581559	Eae18	Experimental allergic encephalomyelitis QTL 18		0.00002	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	10	66108888	107555881	Rat
1600367	Mcs15	Mammary carcinoma susceptibility QTL 15	4.5		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72724423	107713808	Rat
631537	Oia4	Oil induced arthritis QTL 4			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	76128947	107713808	Rat
634354	Rends3	Renal damage susceptibility QTL 3		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	10	61997479	106997479	Rat
61436	Cia5	Collagen induced arthritis QTL 5	4.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	91727883	107713808	Rat
2301405	Cm69	Cardiac mass QTL 69		0.031	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	10	66817119	107713808	Rat

Markers in Region

RH141812

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	10	101,756,827 - 101,757,134 (+)	Marker Load Pipeline
mRatBN7.2	6	11,421,483 - 11,421,686 (-)	MAPPER	mRatBN7.2
mRatBN7.2	6	11,421,355 - 11,421,686 (-)	MAPPER	mRatBN7.2
Rnor_6.0	6	6,470,748 - 6,470,950	NCBI	Rnor6.0
Rnor_6.0	6	6,470,748 - 6,471,111	NCBI	Rnor6.0
Rnor_5.0	6	6,427,708 - 6,428,071	UniSTS	Rnor5.0
Rnor_5.0	6	6,427,708 - 6,427,910	UniSTS	Rnor5.0
RGSC_v3.4	6	6,606,574 - 6,606,776	UniSTS	RGSC3.4
RGSC_v3.4	10	105,493,315 - 105,493,517	UniSTS	RGSC3.4
Celera	6	11,125,752 - 11,125,954	UniSTS
Cytogenetic Map	10	q32.3	UniSTS

UniSTS:224180

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	101,256,889 - 101,257,047 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	104,574,068 - 104,574,225	NCBI	Rnor6.0
Rnor_5.0	10	103,711,147 - 103,711,304	UniSTS	Rnor5.0
RGSC_v3.4	10	106,130,722 - 106,130,879	UniSTS	RGSC3.4
Celera	10	99,831,021 - 99,831,178	UniSTS
Cytogenetic Map	10	q32.3	UniSTS

RH47096

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	11,421,732 - 11,421,843 (-)	MAPPER	mRatBN7.2
mRatBN7.2	10	101,257,662 - 101,257,861 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	6,470,591 - 6,470,701	NCBI	Rnor6.0
Rnor_6.0	10	104,574,841 - 104,575,039	NCBI	Rnor6.0
Rnor_5.0	10	103,710,333 - 103,710,531	UniSTS	Rnor5.0
Rnor_5.0	6	6,427,551 - 6,427,661	UniSTS	Rnor5.0
Celera	10	99,831,794 - 99,831,992	UniSTS
Celera	6	11,126,001 - 11,126,111	UniSTS
Cytogenetic Map	10	q32.3	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
13	22	104	216	114	120	82	105	82	457	241	11	199	106	114	38	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053985	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268315	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268316	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC130970	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC063159	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC078759	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215473	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225133	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225528	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226787	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227040	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227260	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227664	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227957	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228569	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232451	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232671	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232852	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234172	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234408	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ235236	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X73683	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000004329 ⟹ ENSRNOP00000004329

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	95,065,085 - 95,076,695 (-)	Ensembl
mRatBN7.2 Ensembl	13	92,533,298 - 92,544,908 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000050223 ⟹ ENSRNOP00000040434

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	101,755,404 - 101,757,636 (-)	Ensembl
mRatBN7.2 Ensembl	10	101,256,480 - 101,258,709 (-)	Ensembl
Rnor_6.0 Ensembl	10	104,573,664 - 104,575,890 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000104118 ⟹ ENSRNOP00000094970

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	92,540,615 - 92,544,908 (-)	Ensembl

RefSeq Acc Id:

NM_053985 ⟹ NP_446437

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	101,755,404 - 101,757,636 (-)	NCBI
mRatBN7.2	10	101,256,484 - 101,258,716 (-)	NCBI
Rnor_6.0	10	104,573,666 - 104,575,890 (-)	NCBI
Rnor_5.0	10	103,709,482 - 103,711,706 (+)	NCBI
RGSC_v3.4	10	106,130,320 - 106,132,544 (-)	RGD
Celera	10	99,830,619 - 99,832,836 (-)	RGD

Sequence:

show sequence

GGGGCGCAGAGCGGTTTGGTCGTTCGTTGGAGGAGCTTCGTCTTGTTCTGCTCTGCGATTGCGG
CGCTTGTTCGAGCGCTTACAGCGGCGCGTCGGTCCCAGCAAGGGCCTCAGACTTCAGCTTTGGG
TGAGAGAAGATGGCCCGAACCAAGCAGACCGCTAGGAAGTCCACCGGAGGGAAAGCCCCCCGCA
AACAGCTGGCCACCAAGGCGGCCCGGAAAAGCGCGCCCTCTACTGGCGGGGTGAAGAAACCTCA
TCGCTACAGGCCCGGGACCGTGGCTCTAAGAGAGATCCGTCGTTACCAGAAATCGACTGAGCTG
CTCATCCGGAAGCTACCCTTCCAGAGGTTGGTGAGGGAGATCGCCCAGGATTTCAAAACCGACT
TGAGGTTTCAAAGTGCAGCCATCGGTGCCCTTCAGGAGGCTAGCGAGGCATACCTGGTGGGGTT
GTTTGAAGATACCAATCTGTGTGCCATCCACGCCAAGAGAGTCACCATCATGCCCAAAGACATC
CAGTTGGCTCGCCGGATACGGGGGGAGAGAGCTTAAGTTGAAGCGATTTTTATGGCATTTTGTA
GTAAATTCTGTAAAATACTTTGGTTTAATTTGTGACTTTTTTTGTAAGAAATTGTTTATAATAT
GTTGCATTTGTACTTAAGTCATTCCATCTTTCACTCAGGATGAATGGAAAGAGTGACTGTTCAC
AGACCTCAGTGATGTGAGCACTGTGGCTCAGGAGTGACAAGTTGCTAATATGCAGAAGGGATGG
GTGATACTTCTTGCTTCTCATGATGCATGTTTCTGTATGTTAATGACTTGTTGGGTAGCTATTA
AGGTACTAGAATTGATAAATGTGTACAGGGTCCTTTTGCAATAAAACTGGTTATGACTTGATCC
AAGTGTTTAACCATACATCACTGTGATAGAATGTGGGCTTTTTCAAAGGTTGAAGATACAAGTT
TTAGCCACAGTGTAACAGTTTCCTTTAAAAAAAAAAAGTAAACCTGGCAGCTATAGAATACACT
ATGTGCATTTATAATAGCTATTTTATATATTGTAGTGTTCAACATTTTTAAATTAAATGTTTTA
CATTCACAAGTGGTGGGGAGTCTTGTCATTAAGGTGTGTGTAATTTAGTCCAGTTGGTATTTCT
GACTAGACTGCATTTGTTTTTAACAAAGTAGAAGAATGCTATGCGTATTAAACCTTGCATAAGT
CCTCATTCTACCACATGTTCACTAACCCCTGACCCTCTGGCTGGTAACACAAAACACTAACGGG
GATTTTCTTTAAGGGCTCTAGAGTAAAACAACAAGCTATTCACACCAGCATCATCTGTTCCTAA
TCTAGTTAGTGAGCTTTTCATTGTGTTTGGTCTTACGCCTAGACTGAGTTTGGTTTTGTTTTTA
ATCTTTAAGGGGGAAAACTGTACAAGGTTTGCTTTTCCTTGTGGAGTTTATAAACATGGGGGTA
AGAGTACAGCTTGAGCTTATTGGACTCTGCCAATGAAGATGGGTTAGGTTACACCTGGTTACTA
TCCTGGCAAAAAAATCCCTTTTATAGAGATGGCCTTCAAGTGGTTTTTAAAAGTATCCTATTGA
AGTTTTTAGGTCAATTATGTATGTTGACTAAATTTACAAATAAACTTGTTTATCCAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063268315 ⟹ XP_063124385

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	101,755,404 - 101,764,613 (-)	NCBI

RefSeq Acc Id:

XM_063268316 ⟹ XP_063124386

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	101,755,404 - 101,764,616 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_446437	(Get FASTA)	NCBI Sequence Viewer
	XP_063124385	(Get FASTA)	NCBI Sequence Viewer
	XP_063124386	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH63159	(Get FASTA)	NCBI Sequence Viewer
	AAH78759	(Get FASTA)	NCBI Sequence Viewer
	CAA52035	(Get FASTA)	NCBI Sequence Viewer
	EDM06637	(Get FASTA)	NCBI Sequence Viewer
	EDM06638	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000004329.4
	ENSRNOP00000040434
	ENSRNOP00000040434.3
GenBank Protein	P84245	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_446437 ⟸ NM_053985
- UniProtKB:	Q5RJM5 (UniProtKB/Swiss-Prot), P84245 (UniProtKB/Swiss-Prot), B0BMY8 (UniProtKB/TrEMBL), A6HKT3 (UniProtKB/TrEMBL), A6JGH8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIR KLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLA RRIRGERA hide sequence

Ensembl Acc Id:

ENSRNOP00000040434 ⟸ ENSRNOT00000050223

RefSeq Acc Id:	XP_063124386 ⟸ XM_063268316
- Peptide Label:	isoform X1
- UniProtKB:	Q5RJM5 (UniProtKB/Swiss-Prot), P84245 (UniProtKB/Swiss-Prot), A6HKT3 (UniProtKB/TrEMBL), A6JGH8 (UniProtKB/TrEMBL), B0BMY8 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063124385 ⟸ XM_063268315
- Peptide Label:	isoform X1
- UniProtKB:	Q5RJM5 (UniProtKB/Swiss-Prot), P84245 (UniProtKB/Swiss-Prot), A6HKT3 (UniProtKB/TrEMBL), A6JGH8 (UniProtKB/TrEMBL), B0BMY8 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000094970 ⟸ ENSRNOT00000104118

Ensembl Acc Id:

ENSRNOP00000004329 ⟸ ENSRNOT00000004329

Protein Domains

Histone H2A/H2B/H3

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P84245-F1-model_v2	AlphaFold	P84245	1-136	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697901

Promoter ID:

EPDNEW_R8426

Type:

single initiation site

Name:

H3f3b_1

Description:

H3 histone family member 3B

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	104,575,887 - 104,575,947	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621095	AgrOrtholog
BioCyc Gene	G2FUF-22637	BioCyc
Ensembl Genes	ENSRNOG00000003220	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00000006532	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000004329.8	UniProtKB/Swiss-Prot
	ENSRNOT00000050223	ENTREZGENE
	ENSRNOT00000050223.4	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.20.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:6921452	IMAGE-MGC_LOAD
	IMAGE:7112262	IMAGE-MGC_LOAD
	IMAGE:7307209	IMAGE-MGC_LOAD
	IMAGE:7320825	IMAGE-MGC_LOAD
	IMAGE:7386252	IMAGE-MGC_LOAD
	IMAGE:9024967	IMAGE-MGC_LOAD
InterPro	Histone-fold	UniProtKB/Swiss-Prot
	Histone_H2A/H2B/H3	UniProtKB/Swiss-Prot
	Histone_H3/CENP-A	UniProtKB/Swiss-Prot
KEGG Report	rno:117056	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105789	IMAGE-MGC_LOAD
	MGC:105794	IMAGE-MGC_LOAD
	MGC:187497	IMAGE-MGC_LOAD
	MGC:188786	IMAGE-MGC_LOAD
	MGC:72729	IMAGE-MGC_LOAD
	MGC:93264	IMAGE-MGC_LOAD
NCBI Gene	117056	ENTREZGENE
PANTHER	PTHR11426	UniProtKB/Swiss-Prot
Pfam	Histone	UniProtKB/Swiss-Prot
PharmGKB	H3F3B	RGD
PhenoGen	H3f3b	PhenoGen
PRINTS	HISTONEH3	UniProtKB/Swiss-Prot
PROSITE	HISTONE_H3_1	UniProtKB/Swiss-Prot
	HISTONE_H3_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000003220	RatGTEx
	ENSRNOG00000006532	RatGTEx
SMART	SM00428	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF47113	UniProtKB/Swiss-Prot
UniProt	A6HKT2_RAT	UniProtKB/TrEMBL
	A6HKT3	ENTREZGENE, UniProtKB/TrEMBL
	A6JGH8	ENTREZGENE, UniProtKB/TrEMBL
	B0BMY8	ENTREZGENE
	H33_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q5RJM5	ENTREZGENE
UniProt Secondary	P06351	UniProtKB/Swiss-Prot
	P33155	UniProtKB/Swiss-Prot
	Q5RJM5	UniProtKB/Swiss-Prot
	Q9V3W4	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2020-10-27	H3f3b	H3.3 histone B	H3f3b	H3 histone family member 3B	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-08-18	H3f3b	H3 histone family member 3B	H3f3b	H3 histone, family 3B	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-11-17	H3f3b	H3 histone, family 3B			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	H3f3b	H3 histone, family 3B			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	mRNAs decreases from the embryonal day 18 (E18) to the postnatal day 10 (P10)	632914

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)