Symbol:
Tgm2
Name:
transglutaminase 2
RGD ID:
621081
Description:
Enables several functions, including GTP binding activity; identical protein binding activity; and phospholipase binding activity. Involved in several processes, including isopeptide cross-linking via N6-(L-isoglutamyl)-L-lysine; positive regulation of canonical NF-kappaB signal transduction; and positive regulation of smooth muscle cell proliferation. Acts upstream of or within phospholipase C-activating G protein-coupled receptor signaling pathway. Located in cytosol and nucleus. Orthologous to human TGM2 (transglutaminase 2); PARTICIPATES IN eicosanoid signaling pathway; Huntington's disease pathway; INTERACTS WITH (+)-schisandrin B; 17alpha-ethynylestradiol; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
glutamine gamma-glutamyltransferase 2; isopeptidase TGM2; protein-glutamine deamidase TGM2; protein-glutamine dopaminyltransferase TGM2; protein-glutamine gamma-glutamyltransferase 2; protein-glutamine histaminyltransferase TGM2; protein-glutamine noradrenalinyltransferase TGM2; protein-glutamine serotonyltransferase TGM2; TGase 2; TGase II; TgaseII; TGII; tissue transglutaminase; tissue-type transglutaminase; transglutaminase 2, C polypeptide; transglutaminase II; tTG; tTgase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TGM2 (transglutaminase 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Tgm2 (transglutaminase 2, C polypeptide) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Tgm2 (transglutaminase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TGM2 (transglutaminase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TGM2 (transglutaminase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tgm2 (transglutaminase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TGM2 (transglutaminase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TGM2 (transglutaminase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Tgm2 (transglutaminase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
TGM4 (transglutaminase 4) HGNC
Treefam
Homo sapiens (human):
CAMK4 (calcium/calmodulin dependent protein kinase IV) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
TGM2 (transglutaminase 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Tgm2 (transglutaminase 2, C polypeptide)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
tgm2a (transglutaminase 2, C polypeptide A)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
tgm2b (transglutaminase 2b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Tg
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Xenopus tropicalis (tropical clawed frog):
tgm2
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 167,192,612 - 167,221,845 (-) NCBI GRCr8 mRatBN7.2 3 146,772,684 - 146,801,924 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 146,772,687 - 146,801,981 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 150,598,013 - 150,627,250 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 159,097,613 - 159,126,553 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 156,839,077 - 156,868,039 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 154,597,165 - 154,627,257 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 154,597,168 - 154,627,257 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 160,977,905 - 161,007,261 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 148,832,866 - 148,862,385 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 148,738,777 - 148,768,294 (-) NCBI Celera 3 145,473,663 - 145,503,117 (-) NCBI Celera Cytogenetic Map 3 q42 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tgm2 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of TGM2 mRNA] CTD PMID:31150632 Tgm2 Rat (1->4)-beta-D-glucan multiple interactions ISO Tgm2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of TGM2 mRNA CTD PMID:36331819 Tgm2 Rat 1,1-dichloroethene increases expression ISO Tgm2 (Mus musculus) 6480464 vinylidene chloride results in increased expression of TGM2 mRNA CTD PMID:26682919 Tgm2 Rat 1,2-dimethylhydrazine increases expression ISO Tgm2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of TGM2 mRNA CTD PMID:22206623 Tgm2 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine multiple interactions ISO Tgm2 (Mus musculus) 6480464 TGM2 protein affects the reaction [1-Methyl-4-phenyl-1 more ... CTD PMID:30195017 Tgm2 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine increases activity ISO Tgm2 (Mus musculus) 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:30195017 Tgm2 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine increases expression ISO Tgm2 (Mus musculus) 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:30195017 Tgm2 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of TGM2 mRNA CTD PMID:15834898 and PMID:17557909 Tgm2 Rat 17alpha-ethynylestradiol affects expression ISO Tgm2 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of TGM2 mRNA CTD PMID:14976129 and PMID:17555576 Tgm2 Rat 17alpha-ethynylestradiol increases expression ISO Tgm2 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of TGM2 mRNA CTD PMID:17942748 Tgm2 Rat 17alpha-ethynylestradiol multiple interactions ISO Tgm2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of TGM2 mRNA CTD PMID:17942748 Tgm2 Rat 17beta-estradiol increases expression ISO TGM2 (Homo sapiens) 6480464 Estradiol results in increased expression of TGM2 mRNA CTD PMID:19619570 more ... Tgm2 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of TGM2 mRNA CTD PMID:32145629 Tgm2 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of TGM2 mRNA CTD PMID:26496021 Tgm2 Rat 17beta-estradiol increases expression ISO Tgm2 (Mus musculus) 6480464 Estradiol results in increased expression of TGM2 mRNA CTD PMID:19484750 and PMID:39298647 Tgm2 Rat 17beta-estradiol affects expression ISO TGM2 (Homo sapiens) 6480464 Estradiol affects the expression of TGM2 mRNA CTD PMID:14699072 Tgm2 Rat 17beta-estradiol multiple interactions ISO TGM2 (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of TGM2 mRNA more ... CTD PMID:14699072 more ... Tgm2 Rat 2,2',5,5'-tetrachlorobiphenyl decreases expression ISO TGM2 (Homo sapiens) 6480464 2 more ... CTD PMID:36804509 Tgm2 Rat 2,2',5,5'-tetrachlorobiphenyl increases expression ISO TGM2 (Homo sapiens) 6480464 2 more ... CTD PMID:36804509 Tgm2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO TGM2 (Homo sapiens) 6480464 7-ketocholesterol inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of TGM2 mRNA] more ... CTD PMID:10910994 more ... Tgm2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Tgm2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of TGM2 mRNA CTD PMID:27562557 Tgm2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Tgm2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of TGM2 mRNA CTD PMID:19770486 and PMID:21570461 Tgm2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of TGM2 mRNA CTD PMID:21215274 more ... Tgm2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Tgm2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of TGM2 mRNA CTD PMID:15652763 Tgm2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Tgm2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of TGM2 mRNA CTD PMID:17942748 Tgm2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO TGM2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of TGM2 mRNA CTD PMID:16480812 Tgm2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO TGM2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of TGM2 mRNA CTD PMID:19619570 Tgm2 Rat 2,4,6-trinitrobenzenesulfonic acid multiple interactions ISO Tgm2 (Mus musculus) 6480464 Curcumin inhibits the reaction [Trinitrobenzenesulfonic Acid results in increased expression of TGM2 mRNA] CTD PMID:18200517 Tgm2 Rat 2,4,6-trinitrobenzenesulfonic acid increases expression ISO Tgm2 (Mus musculus) 6480464 Trinitrobenzenesulfonic Acid results in increased expression of TGM2 mRNA CTD PMID:18200517 Tgm2 Rat 2-bromohexadecanoic acid multiple interactions ISO TGM2 (Homo sapiens) 6480464 2-bromopalmitate promotes the reaction [Tretinoin results in increased expression of TGM2 mRNA] CTD PMID:30076181 Tgm2 Rat 2-butoxyethanol increases expression ISO Tgm2 (Mus musculus) 6480464 n-butoxyethanol results in increased expression of TGM2 mRNA CTD PMID:19812364 Tgm2 Rat 2-palmitoylglycerol increases expression ISO TGM2 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of TGM2 mRNA CTD PMID:37199045 Tgm2 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Tgm2 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of TGM2 mRNA CTD PMID:28522335 Tgm2 Rat 4,4'-sulfonyldiphenol increases expression ISO Tgm2 (Mus musculus) 6480464 bisphenol S results in increased expression of TGM2 mRNA CTD PMID:30951980 and PMID:39298647 Tgm2 Rat 4,4'-sulfonyldiphenol increases expression ISO TGM2 (Homo sapiens) 6480464 bisphenol S results in increased expression of TGM2 protein CTD PMID:34186270 Tgm2 Rat 4-\{[(5,5,8,8-tetramethyl-5,6,7,8-tetrahydronaphthalen-2-yl)carbonyl]amino\}benzoic acid multiple interactions ISO TGM2 (Homo sapiens) 6480464 [Am 580 co-treated with CD 2425] results in increased activity of TGM2 protein CTD PMID:9516142 Tgm2 Rat 4-\{[(5,5,8,8-tetramethyl-5,6,7,8-tetrahydronaphthalen-2-yl)carbonyl]amino\}benzoic acid increases activity ISO TGM2 (Homo sapiens) 6480464 Am 580 results in increased activity of TGM2 protein CTD PMID:2884032 Tgm2 Rat 4-\{[(5,5,8,8-tetramethyl-5,6,7,8-tetrahydronaphthalen-2-yl)carbonyl]amino\}benzoic acid increases expression ISO TGM2 (Homo sapiens) 6480464 Am 580 results in increased expression of TGM2 mRNA CTD PMID:16982809 Tgm2 Rat 4-hexylbenzene-1,3-diol multiple interactions ISO TGM2 (Homo sapiens) 6480464 [Hexylresorcinol results in decreased activity of TGM2 protein] which results in increased susceptibility to Cisplatin and Hexylresorcinol results in decreased activity of and affects the localization of TGM2 protein CTD PMID:21424127 Tgm2 Rat 4-hydroxyphenyl retinamide increases expression ISO Tgm2 (Mus musculus) 6480464 Fenretinide results in increased expression of TGM2 mRNA CTD PMID:28973697 Tgm2 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of TGM2 mRNA CTD PMID:30047161 Tgm2 Rat 7-ketocholesterol multiple interactions ISO TGM2 (Homo sapiens) 6480464 7-ketocholesterol inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of TGM2 mRNA] CTD PMID:16480812 Tgm2 Rat 9-cis-retinoic acid increases expression ISO TGM2 (Homo sapiens) 6480464 Alitretinoin results in increased expression of TGM2 mRNA and Alitretinoin results in increased expression of TGM2 protein CTD PMID:15964820 more ... Tgm2 Rat 9-cis-retinoic acid increases activity ISO TGM2 (Homo sapiens) 6480464 Alitretinoin results in increased activity of TGM2 protein CTD PMID:9516142 Tgm2 Rat 9-cis-retinoic acid multiple interactions ISO TGM2 (Homo sapiens) 6480464 [Alitretinoin co-treated with Dimethyl Sulfoxide] promotes the reaction [H3-4 protein modified form binds to TGM2 gene] more ... CTD PMID:15964820 Tgm2 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of TGM2 mRNA CTD PMID:15749267 Tgm2 Rat aflatoxin B1 decreases expression ISO Tgm2 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of TGM2 mRNA CTD PMID:19770486 Tgm2 Rat aflatoxin B1 increases expression ISO TGM2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of TGM2 mRNA CTD PMID:27153756 Tgm2 Rat all-trans-4-oxoretinoic acid increases expression ISO TGM2 (Homo sapiens) 6480464 4-oxoretinoic acid results in increased expression of TGM2 mRNA CTD PMID:17034753 Tgm2 Rat all-trans-4-oxoretinol increases expression ISO TGM2 (Homo sapiens) 6480464 4-oxoretinol results in increased expression of TGM2 mRNA CTD PMID:17034753 Tgm2 Rat all-trans-retinoic acid multiple interactions ISO TGM2 (Homo sapiens) 6480464 2-bromopalmitate promotes the reaction [Tretinoin results in increased expression of TGM2 mRNA] more ... CTD PMID:10910994 more ... Tgm2 Rat all-trans-retinoic acid increases activity ISO TGM2 (Homo sapiens) 6480464 Tretinoin results in increased activity of TGM2 protein CTD PMID:2884032 and PMID:9516142 Tgm2 Rat all-trans-retinoic acid increases expression ISO TGM2 (Homo sapiens) 6480464 Tretinoin results in increased expression of TGM2 mRNA and Tretinoin results in increased expression of TGM2 protein CTD PMID:10910994 more ... Tgm2 Rat all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of TGM2 mRNA CTD PMID:20488242 Tgm2 Rat all-trans-retinoic acid increases expression ISO Tgm2 (Mus musculus) 6480464 Tretinoin results in increased expression of TGM2 mRNA CTD PMID:16505366 and PMID:16604517 Tgm2 Rat all-trans-retinol increases expression ISO TGM2 (Homo sapiens) 6480464 Vitamin A results in increased expression of TGM2 mRNA CTD PMID:17034753 Tgm2 Rat all-trans-retinol affects expression EXP 6480464 Vitamin A affects the expression of TGM2 mRNA CTD PMID:14529804 Tgm2 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of TGM2 mRNA CTD PMID:30047161 Tgm2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of TGM2 mRNA CTD PMID:16483693 Tgm2 Rat aristolochic acid A increases expression ISO TGM2 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of TGM2 mRNA CTD PMID:33212167 Tgm2 Rat aristolochic acid A decreases expression ISO TGM2 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of TGM2 protein CTD PMID:33212167 Tgm2 Rat arotinoid acid increases expression ISO TGM2 (Homo sapiens) 6480464 4-(2-(5 more ... CTD PMID:10910994 and PMID:16158052 Tgm2 Rat arotinoid acid multiple interactions ISO TGM2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin inhibits the reaction [4-(2-(5 more ... CTD PMID:10910994 Tgm2 Rat arsane multiple interactions ISO TGM2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TGM2 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of TGM2 mRNA CTD PMID:39836092 Tgm2 Rat arsenic atom multiple interactions ISO TGM2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TGM2 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of TGM2 mRNA CTD PMID:39836092 Tgm2 Rat arsenous acid multiple interactions ISO TGM2 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [Tretinoin results in increased expression of TGM2 protein] CTD PMID:11133770 and PMID:9450572 Tgm2 Rat astaxanthin multiple interactions ISO Tgm2 (Mus musculus) 6480464 astaxanthine inhibits the reaction [LEPR gene mutant form results in increased expression of TGM2 mRNA] CTD PMID:16964424 Tgm2 Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of TGM2 mRNA CTD PMID:36841081 Tgm2 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of TGM2 gene CTD PMID:35440735 Tgm2 Rat benzo[a]pyrene decreases expression ISO Tgm2 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of TGM2 mRNA CTD PMID:19770486 Tgm2 Rat benzo[a]pyrene decreases methylation ISO TGM2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of TGM2 5' UTR and Benzo(a)pyrene results in decreased methylation of TGM2 promoter CTD PMID:27901495 Tgm2 Rat benzo[a]pyrene increases expression ISO TGM2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of TGM2 mRNA CTD PMID:26238291 and PMID:32234424 Tgm2 Rat benzo[a]pyrene decreases expression ISO TGM2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of TGM2 mRNA CTD PMID:22178795 Tgm2 Rat benzo[a]pyrene increases expression ISO Tgm2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of TGM2 mRNA CTD PMID:22228805 Tgm2 Rat benzo[a]pyrene diol epoxide I increases expression ISO TGM2 (Homo sapiens) 6480464 7 more ... CTD PMID:26238291 Tgm2 Rat benzo[e]pyrene increases methylation ISO TGM2 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of TGM2 intron CTD PMID:30157460 Tgm2 Rat benzoates decreases expression ISO TGM2 (Homo sapiens) 6480464 Benzoates analog results in decreased expression of TGM2 mRNA CTD PMID:29472718 Tgm2 Rat beta-carotene increases expression ISO TGM2 (Homo sapiens) 6480464 beta Carotene results in increased expression of TGM2 mRNA CTD PMID:17034753 Tgm2 Rat beta-naphthoflavone decreases expression ISO TGM2 (Homo sapiens) 6480464 beta-Naphthoflavone results in decreased expression of TGM2 mRNA CTD PMID:32858204 Tgm2 Rat bexarotene increases expression ISO TGM2 (Homo sapiens) 6480464 bexarotene results in increased expression of TGM2 mRNA CTD PMID:17178900 Tgm2 Rat bexarotene multiple interactions ISO Tgm2 (Mus musculus) 6480464 diazepinylbenzoic acid inhibits the reaction [bexarotene results in increased expression of TGM2 mRNA] CTD PMID:25932594 Tgm2 Rat bexarotene increases expression ISO Tgm2 (Mus musculus) 6480464 bexarotene results in increased expression of TGM2 mRNA CTD PMID:21622945 and PMID:25932594 Tgm2 Rat bis(2-ethylhexyl) phthalate increases expression ISO TGM2 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of TGM2 mRNA CTD PMID:31163220 Tgm2 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Tgm2 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of TGM2 mRNA CTD PMID:39150890 Tgm2 Rat bis(2-ethylhexyl) phthalate decreases expression ISO TGM2 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of TGM2 protein CTD PMID:31163220 Tgm2 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of TGM2 mRNA CTD PMID:26496021 Tgm2 Rat bisphenol A decreases expression ISO TGM2 (Homo sapiens) 6480464 bisphenol A results in decreased expression of TGM2 mRNA CTD PMID:29275510 Tgm2 Rat bisphenol A increases expression ISO Tgm2 (Mus musculus) 6480464 bisphenol A results in increased expression of TGM2 mRNA CTD PMID:30951980 more ... Tgm2 Rat bisphenol A decreases methylation ISO Tgm2 (Mus musculus) 6480464 bisphenol A results in decreased methylation of TGM2 promoter CTD PMID:27312807 Tgm2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TGM2 mRNA and bisphenol A results in decreased expression of TGM2 protein CTD PMID:22649256 more ... Tgm2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TGM2 mRNA CTD PMID:25181051 and PMID:32145629 Tgm2 Rat bisphenol F increases expression ISO Tgm2 (Mus musculus) 6480464 bisphenol F results in increased expression of TGM2 mRNA CTD PMID:30951980 and PMID:38685157 Tgm2 Rat bisphenol F increases expression ISO TGM2 (Homo sapiens) 6480464 bisphenol F results in increased expression of TGM2 protein CTD PMID:34186270 Tgm2 Rat bucladesine multiple interactions ISO Tgm2 (Mus musculus) 6480464 [O more ... CTD PMID:32749514 Tgm2 Rat budesonide increases expression ISO Tgm2 (Mus musculus) 6480464 Budesonide results in increased expression of TGM2 protein CTD PMID:21885873 Tgm2 Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of TGM2 mRNA CTD PMID:24136188 Tgm2 Rat butan-1-ol multiple interactions ISO TGM2 (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of TGM2 mRNA CTD PMID:29432896 Tgm2 Rat Butylbenzyl phthalate multiple interactions ISO Tgm2 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of TGM2 mRNA CTD PMID:39150890 Tgm2 Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of TGM2 mRNA CTD PMID:19167457 Tgm2 Rat cadmium dichloride decreases expression ISO TGM2 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of TGM2 mRNA CTD PMID:26314618 Tgm2 Rat cadmium dichloride increases expression ISO TGM2 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of TGM2 mRNA CTD PMID:38568856 Tgm2 Rat calcitriol multiple interactions ISO TGM2 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of TGM2 mRNA CTD PMID:21592394 Tgm2 Rat calcitriol increases expression ISO TGM2 (Homo sapiens) 6480464 Calcitriol results in increased expression of TGM2 mRNA CTD PMID:21592394 and PMID:26485663 Tgm2 Rat carbon nanotube increases expression ISO Tgm2 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Tgm2 Rat carbonyl sulfide increases expression EXP 6480464 carbonyl sulfide results in increased expression of TGM2 mRNA CTD PMID:19395590 Tgm2 Rat CGP 52608 multiple interactions ISO TGM2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to TGM2 gene] CTD PMID:28238834 Tgm2 Rat chlorpyrifos increases activity EXP 6480464 Chlorpyrifos results in increased activity of TGM2 protein CTD PMID:20637855 Tgm2 Rat choline multiple interactions ISO Tgm2 (Mus musculus) 6480464 [Dietary Fats co-treated with Choline deficiency] results in increased expression of TGM2 mRNA and PANX1 gene mutant form inhibits the reaction [[Dietary Fats co-treated with Choline deficiency] results in increased expression of TGM2 mRNA] CTD PMID:29246445 Tgm2 Rat cisplatin multiple interactions ISO TGM2 (Homo sapiens) 6480464 [Hexylresorcinol results in decreased activity of TGM2 protein] which results in increased susceptibility to Cisplatin CTD PMID:21424127 Tgm2 Rat cobalt dichloride increases expression ISO TGM2 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of TGM2 mRNA CTD PMID:23052192 Tgm2 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of TGM2 mRNA CTD PMID:24386269 Tgm2 Rat cobalt dichloride decreases expression ISO TGM2 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of TGM2 mRNA CTD PMID:19320972 and PMID:19376846 Tgm2 Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of TGM2 mRNA CTD PMID:30556269 Tgm2 Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of TGM2 mRNA CTD PMID:30556269 Tgm2 Rat corticosterone increases expression EXP 6480464 Corticosterone results in increased expression of TGM2 mRNA CTD PMID:15755911 Tgm2 Rat crocidolite asbestos increases expression ISO TGM2 (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of TGM2 mRNA CTD PMID:25351596 Tgm2 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of TGM2 mRNA CTD PMID:26577399 Tgm2 Rat curcumin multiple interactions ISO Tgm2 (Mus musculus) 6480464 Curcumin inhibits the reaction [Trinitrobenzenesulfonic Acid results in increased expression of TGM2 mRNA] CTD PMID:18200517 Tgm2 Rat cyclosporin A decreases expression ISO Tgm2 (Mus musculus) 6480464 Cyclosporine results in decreased expression of TGM2 mRNA CTD PMID:19770486 Tgm2 Rat cyclosporin A increases expression ISO TGM2 (Homo sapiens) 6480464 Cyclosporine results in increased expression of TGM2 mRNA CTD PMID:25562108 Tgm2 Rat cyclosporin A decreases expression ISO TGM2 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of TGM2 mRNA CTD PMID:19159671 more ... Tgm2 Rat cystamine multiple interactions EXP 6480464 Cystamine inhibits the reaction [Carbon Tetrachloride results in increased expression of TGM2 mRNA] and Cystamine inhibits the reaction [Carbon Tetrachloride results in increased expression of TGM2 protein] CTD PMID:17708605 Tgm2 Rat daidzein increases expression ISO Tgm2 (Mus musculus) 6480464 daidzein results in increased expression of TGM2 mRNA and daidzein results in increased expression of TGM2 protein CTD PMID:24859791 Tgm2 Rat DDE increases expression ISO TGM2 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of TGM2 mRNA CTD PMID:38568856 Tgm2 Rat dexamethasone increases expression ISO Tgm2 (Mus musculus) 6480464 Dexamethasone results in increased expression of TGM2 mRNA CTD PMID:23946490 and PMID:29229235 Tgm2 Rat dexamethasone multiple interactions ISO Tgm2 (Mus musculus) 6480464 apicidin inhibits the reaction [Dexamethasone results in increased expression of TGM2 mRNA] more ... CTD PMID:23946490 Tgm2 Rat diarsenic trioxide multiple interactions ISO TGM2 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [Tretinoin results in increased expression of TGM2 protein] CTD PMID:11133770 and PMID:9450572 Tgm2 Rat diazinon affects expression EXP 6480464 Diazinon affects the expression of TGM2 mRNA CTD PMID:22546817 Tgm2 Rat diazinon increases methylation ISO TGM2 (Homo sapiens) 6480464 Diazinon results in increased methylation of TGM2 gene CTD PMID:22964155 Tgm2 Rat dibenz[a,h]anthracene decreases expression ISO TGM2 (Homo sapiens) 6480464 1 more ... CTD PMID:16269432 Tgm2 Rat dibutyl phthalate multiple interactions ISO Tgm2 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of TGM2 mRNA CTD PMID:39150890 Tgm2 Rat dieldrin affects expression EXP 6480464 Dieldrin affects the expression of TGM2 mRNA CTD PMID:22546817 Tgm2 Rat diethyl maleate increases expression EXP 6480464 diethyl maleate results in increased expression of TGM2 mRNA CTD PMID:21161181 Tgm2 Rat diethyl phthalate multiple interactions ISO Tgm2 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of TGM2 mRNA CTD PMID:39150890 Tgm2 Rat diisobutyl phthalate multiple interactions ISO Tgm2 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of TGM2 mRNA CTD PMID:39150890 Tgm2 Rat diisononyl phthalate multiple interactions ISO Tgm2 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of TGM2 mRNA CTD PMID:39150890 Tgm2 Rat dimethyl sulfoxide multiple interactions ISO TGM2 (Homo sapiens) 6480464 [Alitretinoin co-treated with Dimethyl Sulfoxide] promotes the reaction [H3-4 protein modified form binds to TGM2 gene] more ... CTD PMID:15964820 Tgm2 Rat dimethylarsinic acid decreases expression EXP 6480464 Cacodylic Acid results in decreased expression of TGM2 mRNA CTD PMID:37567419 Tgm2 Rat dioxygen multiple interactions ISO Tgm2 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of TGM2 mRNA CTD PMID:30529165 Tgm2 Rat dorsomorphin multiple interactions ISO TGM2 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TGM2 mRNA CTD PMID:27188386 Tgm2 Rat doxorubicin increases expression ISO TGM2 (Homo sapiens) 6480464 Doxorubicin results in increased expression of TGM2 mRNA CTD PMID:15870702 and PMID:29803840 Tgm2 Rat doxorubicin affects response to substance ISO TGM2 (Homo sapiens) 6480464 TGM2 protein affects the susceptibility to Doxorubicin CTD PMID:17073438 Tgm2 Rat endosulfan affects expression EXP 6480464 Endosulfan affects the expression of TGM2 mRNA CTD PMID:29391264 Tgm2 Rat entinostat increases expression ISO TGM2 (Homo sapiens) 6480464 entinostat results in increased expression of TGM2 mRNA CTD PMID:27188386 Tgm2 Rat enzacamene decreases expression ISO TGM2 (Homo sapiens) 6480464 enzacamene results in decreased expression of TGM2 mRNA CTD PMID:30597193 Tgm2 Rat enzacamene multiple interactions ISO TGM2 (Homo sapiens) 6480464 ADGRG1 mRNA inhibits the reaction [enzacamene results in decreased expression of TGM2 mRNA] CTD PMID:30597193 Tgm2 Rat ethanol multiple interactions ISO TGM2 (Homo sapiens) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Ethanol results in increased activity of TGM2 protein] more ... CTD PMID:18295389 and PMID:29432896 Tgm2 Rat ethanol multiple interactions ISO Tgm2 (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of TGM2 mRNA CTD PMID:30517762 Tgm2 Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of TGM2 mRNA CTD PMID:10801782 Tgm2 Rat ethanol increases activity EXP 6480464 Ethanol results in increased activity of TGM2 protein CTD PMID:10801782 Tgm2 Rat ethanol multiple interactions EXP 6480464 Ethanol inhibits the reaction [Phenylephrine results in decreased activity of TGM2 protein] and Putrescine inhibits the reaction [Ethanol results in increased activity of TGM2 protein] CTD PMID:10801782 Tgm2 Rat ethanol increases expression ISO Tgm2 (Mus musculus) 6480464 Ethanol results in increased expression of TGM2 mRNA CTD PMID:11696672 and PMID:30319688 Tgm2 Rat ethanol increases activity ISO Tgm2 (Mus musculus) 6480464 Ethanol results in increased activity of TGM2 protein CTD PMID:11696672 Tgm2 Rat ethanol increases expression ISO TGM2 (Homo sapiens) 6480464 Ethanol results in increased expression of TGM2 mRNA CTD PMID:18295389 Tgm2 Rat ethanol increases activity ISO TGM2 (Homo sapiens) 6480464 Ethanol results in increased activity of TGM2 protein CTD PMID:18295389 Tgm2 Rat ethylparaben increases expression ISO TGM2 (Homo sapiens) 6480464 ethyl-p-hydroxybenzoate results in increased expression of TGM2 mRNA CTD PMID:37690743 Tgm2 Rat ferric oxide increases expression ISO Tgm2 (Mus musculus) 6480464 ferric oxide analog results in increased expression of TGM2 mRNA CTD PMID:25086211 Tgm2 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of TGM2 mRNA CTD PMID:24136188 Tgm2 Rat flunisolide increases expression ISO Tgm2 (Mus musculus) 6480464 flunisolide results in increased expression of TGM2 protein CTD PMID:21885873 Tgm2 Rat flusilazole increases expression EXP 6480464 flusilazole results in increased expression of TGM2 mRNA CTD PMID:28263823 Tgm2 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of TGM2 mRNA CTD PMID:24136188 Tgm2 Rat formaldehyde decreases expression ISO TGM2 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of TGM2 mRNA CTD PMID:28937961 Tgm2 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of TGM2 mRNA CTD PMID:22061828 and PMID:33387578 Tgm2 Rat glycidyl methacrylate decreases expression ISO TGM2 (Homo sapiens) 6480464 glycidyl methacrylate results in decreased expression of TGM2 protein CTD PMID:36641056 Tgm2 Rat glyphosate increases expression ISO Tgm2 (Mus musculus) 6480464 Glyphosate results in increased expression of TGM2 protein CTD PMID:37208198 Tgm2 Rat graphite affects expression EXP 6480464 Graphite affects the expression of TGM2 mRNA CTD PMID:29933104 Tgm2 Rat griseofulvin affects expression ISO Tgm2 (Mus musculus) 6480464 Griseofulvin affects the expression of TGM2 mRNA CTD PMID:12735108 Tgm2 Rat GTP affects binding ISO TGM2 (Homo sapiens) 6480464 Guanosine Triphosphate binds to TGM2 protein CTD PMID:15556610 Tgm2 Rat hemin multiple interactions ISO TGM2 (Homo sapiens) 6480464 [Hemin co-treated with Tretinoin] affects the localization of TGM2 protein CTD PMID:15556610 Tgm2 Rat heptachlor decreases expression EXP 6480464 Heptachlor results in decreased expression of TGM2 mRNA CTD PMID:23153324 Tgm2 Rat hydrazine increases expression ISO Tgm2 (Mus musculus) 6480464 hydrazine results in increased expression of TGM2 mRNA CTD PMID:15282401 Tgm2 Rat isobutanol multiple interactions ISO TGM2 (Homo sapiens) 6480464 [[Gasoline co-treated with isobutyl alcohol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of TGM2 mRNA CTD PMID:29432896 Tgm2 Rat isoprenaline increases expression ISO Tgm2 (Mus musculus) 6480464 Isoproterenol results in increased expression of TGM2 mRNA CTD PMID:20003209 Tgm2 Rat isoxazoles decreases activity ISO TGM2 (Homo sapiens) 6480464 Isoxazoles analog results in decreased activity of TGM2 protein CTD PMID:15850984 Tgm2 Rat isoxazoles decreases activity ISO Tgm2 (Mus musculus) 6480464 Isoxazoles analog results in decreased activity of TGM2 protein CTD PMID:15850984 Tgm2 Rat ivermectin decreases expression ISO TGM2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of TGM2 protein CTD PMID:32959892 Tgm2 Rat lipopolysaccharide increases expression ISO Tgm2 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of TGM2 mRNA CTD PMID:27339419 Tgm2 Rat LY294002 multiple interactions ISO TGM2 (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [Ethanol results in increased activity of TGM2 protein] CTD PMID:18295389 Tgm2 Rat manganese atom multiple interactions ISO TGM2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TGM2 mRNA CTD PMID:39836092 Tgm2 Rat manganese(0) multiple interactions ISO TGM2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TGM2 mRNA CTD PMID:39836092 Tgm2 Rat manganese(II) chloride multiple interactions ISO TGM2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TGM2 mRNA CTD PMID:39836092 Tgm2 Rat methapyrilene increases methylation ISO TGM2 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of TGM2 intron CTD PMID:30157460 Tgm2 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of TGM2 mRNA CTD PMID:30047161 Tgm2 Rat methoxychlor increases methylation EXP 6480464 Methoxychlor results in increased methylation of TGM2 gene CTD PMID:23303685 Tgm2 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of TGM2 gene CTD PMID:35440735 Tgm2 Rat microcystin-LR increases expression ISO Tgm2 (Mus musculus) 6480464 cyanoginosin LR results in increased expression of TGM2 mRNA CTD PMID:17654400 Tgm2 Rat mitomycin C affects response to substance ISO TGM2 (Homo sapiens) 6480464 TGM2 protein affects the susceptibility to Mitomycin CTD PMID:16217747 Tgm2 Rat mometasone furoate increases expression ISO Tgm2 (Mus musculus) 6480464 Mometasone Furoate results in increased expression of TGM2 protein CTD PMID:21885873 Tgm2 Rat mono(2-ethylhexyl) phthalate increases expression ISO TGM2 (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of TGM2 mRNA CTD PMID:36695872 Tgm2 Rat monodansylcadaverine decreases activity ISO TGM2 (Homo sapiens) 6480464 monodansylcadaverine results in decreased activity of TGM2 protein CTD PMID:16382148 Tgm2 Rat Muraglitazar increases expression EXP 6480464 muraglitazar results in increased expression of TGM2 mRNA CTD PMID:21515302 Tgm2 Rat N-acetyl-L-cysteine multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Particulate Matter analog results in decreased activity of TGM2 protein] and Acetylcysteine inhibits the reaction [Vehicle Emissions analog results in decreased activity of TGM2 protein] CTD PMID:15541757 Tgm2 Rat N-methyl-4-phenylpyridinium increases expression ISO Tgm2 (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of TGM2 protein CTD PMID:30195017 Tgm2 Rat N-methyl-4-phenylpyridinium decreases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of TGM2 mRNA CTD PMID:28801915 Tgm2 Rat N-nitrosodiethylamine increases expression ISO TGM2 (Homo sapiens) 6480464 Diethylnitrosamine results in increased expression of TGM2 mRNA CTD PMID:21527772 Tgm2 Rat naphthalene decreases expression EXP 6480464 naphthalene analog results in decreased expression of TGM2 mRNA CTD PMID:24976557 Tgm2 Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of TGM2 mRNA CTD PMID:24136188 Tgm2 Rat nickel atom increases expression ISO TGM2 (Homo sapiens) 6480464 Nickel results in increased expression of TGM2 mRNA CTD PMID:24768652 and PMID:25583101 Tgm2 Rat nimesulide decreases expression EXP 6480464 nimesulide results in decreased expression of TGM2 mRNA CTD PMID:24136188 Tgm2 Rat paracetamol affects expression ISO Tgm2 (Mus musculus) 6480464 Acetaminophen affects the expression of TGM2 mRNA CTD PMID:17562736 Tgm2 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of TGM2 mRNA CTD PMID:33387578 Tgm2 Rat paracetamol increases expression ISO TGM2 (Homo sapiens) 6480464 Acetaminophen results in increased expression of TGM2 mRNA CTD PMID:25704631 and PMID:29067470 Tgm2 Rat paracetamol decreases expression ISO TGM2 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of TGM2 mRNA CTD PMID:21420995 Tgm2 Rat paraquat increases expression ISO Tgm2 (Mus musculus) 6480464 Paraquat results in increased expression of TGM2 mRNA CTD PMID:21463325 Tgm2 Rat PD 0325901 multiple interactions ISO TGM2 (Homo sapiens) 6480464 [(+)-JQ1 compound co-treated with mirdametinib] results in decreased expression of TGM2 mRNA CTD PMID:25119042 Tgm2 Rat PD 0325901 decreases expression ISO TGM2 (Homo sapiens) 6480464 mirdametinib results in decreased expression of TGM2 mRNA CTD PMID:25119042 Tgm2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Tgm2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of TGM2 mRNA CTD PMID:36331819 Tgm2 Rat phenobarbital multiple interactions ISO Tgm2 (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of TGM2 mRNA] CTD PMID:19482888 Tgm2 Rat phenobarbital increases expression ISO Tgm2 (Mus musculus) 6480464 Phenobarbital results in increased expression of TGM2 mRNA CTD PMID:19482888 Tgm2 Rat phenylephrine multiple interactions EXP 6480464 ADRA1B protein affects the reaction [Phenylephrine results in decreased activity of TGM2 protein] and Ethanol inhibits the reaction [Phenylephrine results in decreased activity of TGM2 protein] CTD PMID:10801782 Tgm2 Rat phenylephrine decreases activity EXP 6480464 Phenylephrine results in decreased activity of TGM2 protein CTD PMID:10801782 Tgm2 Rat phenylephrine increases expression EXP 6480464 Phenylephrine results in increased expression of TGM2 mRNA CTD PMID:18158353 Tgm2 Rat phorbol 13-acetate 12-myristate multiple interactions ISO Tgm2 (Mus musculus) 6480464 Phycocyanin inhibits the reaction [Tetradecanoylphorbol Acetate results in decreased expression of TGM2 mRNA] and Phycocyanin inhibits the reaction [Tetradecanoylphorbol Acetate results in decreased expression of TGM2 protein] CTD PMID:22986104 Tgm2 Rat phorbol 13-acetate 12-myristate decreases expression ISO Tgm2 (Mus musculus) 6480464 Tetradecanoylphorbol Acetate results in decreased expression of TGM2 mRNA and Tetradecanoylphorbol Acetate results in decreased expression of TGM2 protein CTD PMID:22986104 Tgm2 Rat pinocembrin multiple interactions ISO TGM2 (Homo sapiens) 6480464 pinocembrin inhibits the reaction [Ethanol results in increased activity of TGM2 protein] and pinocembrin inhibits the reaction [Ethanol results in increased expression of TGM2 mRNA] CTD PMID:18295389 Tgm2 Rat pirinixic acid increases expression ISO Tgm2 (Mus musculus) 6480464 pirinixic acid results in increased expression of TGM2 mRNA CTD PMID:18301758 more ... Tgm2 Rat piroxicam decreases expression ISO TGM2 (Homo sapiens) 6480464 Piroxicam results in decreased expression of TGM2 mRNA CTD PMID:21858171 Tgm2 Rat potassium chromate increases expression ISO TGM2 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of TGM2 mRNA CTD PMID:22714537 Tgm2 Rat pregnenolone 16alpha-carbonitrile increases expression ISO Tgm2 (Mus musculus) 6480464 Pregnenolone Carbonitrile results in increased expression of TGM2 mRNA CTD PMID:28903501 Tgm2 Rat progesterone multiple interactions ISO TGM2 (Homo sapiens) 6480464 [Progesterone co-treated with Estradiol] results in decreased expression of TGM2 mRNA CTD PMID:17404688 Tgm2 Rat progesterone increases expression EXP 6480464 Progesterone results in increased expression of TGM2 mRNA CTD PMID:20726854 Tgm2 Rat progesterone increases expression ISO TGM2 (Homo sapiens) 6480464 Progesterone results in increased expression of TGM2 mRNA CTD PMID:21540246 Tgm2 Rat propiconazole increases expression ISO Tgm2 (Mus musculus) 6480464 propiconazole results in increased expression of TGM2 mRNA CTD PMID:21278054 Tgm2 Rat putrescine multiple interactions EXP 6480464 Putrescine inhibits the reaction [Ethanol results in increased activity of TGM2 protein] CTD PMID:10801782 Tgm2 Rat quercetin multiple interactions EXP 6480464 Quercetin inhibits the reaction [[Warfarin co-treated with Vitamin K] results in increased expression of and results in increased activity of TGM2 protein] and Quercetin inhibits the reaction [Warfarin results in increased activity of TGM2 protein] CTD PMID:23117658 Tgm2 Rat quercetin multiple interactions ISO TGM2 (Homo sapiens) 6480464 Quercetin binds to and results in decreased activity of TGM2 protein CTD PMID:23117658 Tgm2 Rat quercetin affects response to substance ISO Tgm2 (Mus musculus) 6480464 [TGM2 protein affects the susceptibility to Warfarin] which affects the susceptibility to Quercetin CTD PMID:23117658 Tgm2 Rat quercitrin decreases expression ISO TGM2 (Homo sapiens) 6480464 quercitrin results in decreased expression of TGM2 mRNA CTD PMID:25193878 Tgm2 Rat raloxifene affects expression ISO TGM2 (Homo sapiens) 6480464 Raloxifene Hydrochloride affects the expression of TGM2 mRNA CTD PMID:14699072 Tgm2 Rat SB 431542 multiple interactions ISO TGM2 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TGM2 mRNA CTD PMID:27188386 Tgm2 Rat silicon dioxide increases expression ISO TGM2 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of TGM2 mRNA and Silicon Dioxide results in increased expression of TGM2 mRNA CTD PMID:25351596 and PMID:25895662 Tgm2 Rat silicon dioxide increases expression ISO Tgm2 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of TGM2 mRNA CTD PMID:23221170 Tgm2 Rat silver atom increases expression ISO TGM2 (Homo sapiens) 6480464 Silver results in increased expression of TGM2 mRNA CTD PMID:28959546 Tgm2 Rat silver(0) increases expression ISO TGM2 (Homo sapiens) 6480464 Silver results in increased expression of TGM2 mRNA CTD PMID:28959546 Tgm2 Rat sirolimus decreases expression ISO Tgm2 (Mus musculus) 6480464 Sirolimus results in decreased expression of TGM2 mRNA CTD PMID:11355896 Tgm2 Rat sodium arsenite multiple interactions ISO TGM2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TGM2 mRNA more ... CTD PMID:33939924 and PMID:39836092 Tgm2 Rat Soman increases expression EXP 6480464 Soman results in increased expression of TGM2 mRNA CTD PMID:19281266 Tgm2 Rat styrene affects expression ISO Tgm2 (Mus musculus) 6480464 Styrene affects the expression of TGM2 mRNA CTD PMID:36912746 Tgm2 Rat succimer multiple interactions ISO Tgm2 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of TGM2 mRNA and [Succimer co-treated with Magnetite Nanoparticles] results in decreased expression of TGM2 mRNA CTD PMID:21641980 and PMID:26378955 Tgm2 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of TGM2 mRNA CTD PMID:30047161 Tgm2 Rat sulindac multiple interactions ISO TGM2 (Homo sapiens) 6480464 Sulindac inhibits the reaction [CDKN1A protein results in increased expression of TGM2 mRNA] CTD PMID:15190207 Tgm2 Rat sunitinib decreases expression ISO TGM2 (Homo sapiens) 6480464 Sunitinib results in decreased expression of TGM2 mRNA CTD PMID:31533062 Tgm2 Rat T-2 toxin decreases expression ISO TGM2 (Homo sapiens) 6480464 T-2 Toxin results in decreased expression of TGM2 mRNA CTD PMID:34581912 Tgm2 Rat tamibarotene increases activity ISO TGM2 (Homo sapiens) 6480464 tamibarotene results in increased activity of TGM2 protein CTD PMID:2884032 Tgm2 Rat tamoxifen affects expression ISO TGM2 (Homo sapiens) 6480464 Tamoxifen affects the expression of TGM2 mRNA CTD PMID:14699072 Tgm2 Rat tamoxifen affects expression ISO Tgm2 (Mus musculus) 6480464 Tamoxifen affects the expression of TGM2 mRNA CTD PMID:17555576 Tgm2 Rat tauroursodeoxycholic acid decreases expression EXP 6480464 ursodoxicoltaurine results in decreased expression of TGM2 mRNA CTD PMID:15885361 Tgm2 Rat temozolomide decreases expression ISO TGM2 (Homo sapiens) 6480464 Temozolomide results in decreased expression of TGM2 mRNA CTD PMID:31758290 Tgm2 Rat tert-butyl hydroperoxide increases expression ISO TGM2 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of TGM2 mRNA CTD PMID:15336504 Tgm2 Rat Tesaglitazar increases expression EXP 6480464 tesaglitazar results in increased expression of TGM2 mRNA CTD PMID:21515302 Tgm2 Rat testosterone multiple interactions ISO TGM2 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of TGM2 mRNA CTD PMID:21592394 Tgm2 Rat testosterone multiple interactions ISO Tgm2 (Mus musculus) 6480464 1 more ... CTD PMID:33848595 Tgm2 Rat testosterone increases expression ISO Tgm2 (Mus musculus) 6480464 Testosterone deficiency results in increased expression of TGM2 mRNA CTD PMID:33848595 Tgm2 Rat testosterone increases expression ISO TGM2 (Homo sapiens) 6480464 Testosterone results in increased expression of TGM2 mRNA CTD PMID:21592394 Tgm2 Rat tetrachloromethane multiple interactions ISO Tgm2 (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of TGM2 mRNA and PPARD protein affects the reaction [Carbon Tetrachloride results in increased expression of TGM2 mRNA] CTD PMID:18038451 and PMID:30517762 Tgm2 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of TGM2 mRNA CTD PMID:31150632 Tgm2 Rat tetrachloromethane increases expression ISO Tgm2 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of TGM2 mRNA CTD PMID:27339419 and PMID:31919559 Tgm2 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of TGM2 mRNA and Carbon Tetrachloride results in increased expression of TGM2 protein CTD PMID:17708605 Tgm2 Rat tetrachloromethane multiple interactions EXP 6480464 Cystamine inhibits the reaction [Carbon Tetrachloride results in increased expression of TGM2 mRNA] more ... CTD PMID:17708605 and PMID:31150632 Tgm2 Rat thapsigargin multiple interactions ISO TGM2 (Homo sapiens) 6480464 Thapsigargin results in increased expression of and results in increased activity of TGM2 protein CTD PMID:16382148 Tgm2 Rat thiophenes multiple interactions ISO TGM2 (Homo sapiens) 6480464 Thiophenes analog promotes the reaction [Tretinoin results in increased expression of TGM2 mRNA] CTD PMID:16140955 Tgm2 Rat thiram decreases expression ISO TGM2 (Homo sapiens) 6480464 Thiram results in decreased expression of TGM2 mRNA CTD PMID:38568856 Tgm2 Rat titanium dioxide increases expression ISO Tgm2 (Mus musculus) 6480464 titanium dioxide results in increased expression of TGM2 mRNA CTD PMID:27760801 Tgm2 Rat titanium dioxide affects expression ISO Tgm2 (Mus musculus) 6480464 titanium dioxide affects the expression of TGM2 mRNA CTD PMID:17656681 Tgm2 Rat toluene increases expression EXP 6480464 Toluene results in increased expression of TGM2 mRNA CTD PMID:22967744 Tgm2 Rat topotecan affects response to substance ISO TGM2 (Homo sapiens) 6480464 TGM2 protein affects the susceptibility to Topotecan CTD PMID:16217747 Tgm2 Rat tributylstannane multiple interactions ISO Tgm2 (Mus musculus) 6480464 diazepinylbenzoic acid inhibits the reaction [tributyltin results in increased expression of TGM2 mRNA] CTD PMID:25932594 Tgm2 Rat tributylstannane increases expression ISO Tgm2 (Mus musculus) 6480464 tributyltin results in increased expression of TGM2 mRNA CTD PMID:21622945 and PMID:25932594 Tgm2 Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of TGM2 gene CTD PMID:27618143 Tgm2 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of TGM2 mRNA CTD PMID:33387578 Tgm2 Rat trichostatin A multiple interactions ISO Tgm2 (Mus musculus) 6480464 trichostatin A inhibits the reaction [Dexamethasone results in increased expression of TGM2 mRNA] CTD PMID:23946490 Tgm2 Rat trichostatin A increases expression ISO TGM2 (Homo sapiens) 6480464 trichostatin A results in increased expression of TGM2 mRNA CTD PMID:26705709 Tgm2 Rat triclosan decreases expression ISO TGM2 (Homo sapiens) 6480464 Triclosan results in decreased expression of TGM2 mRNA CTD PMID:30510588 Tgm2 Rat triptonide decreases expression ISO Tgm2 (Mus musculus) 6480464 triptonide results in decreased expression of TGM2 mRNA CTD PMID:33045310 Tgm2 Rat tris(2-butoxyethyl) phosphate affects expression ISO TGM2 (Homo sapiens) 6480464 tris(2-butoxyethyl) phosphate affects the expression of TGM2 mRNA CTD PMID:29024780 Tgm2 Rat troglitazone decreases expression EXP 6480464 troglitazone results in decreased expression of TGM2 mRNA CTD PMID:21515302 Tgm2 Rat trovafloxacin multiple interactions ISO Tgm2 (Mus musculus) 6480464 [trovafloxacin co-treated with lipopolysaccharide and E coli O55-B5] results in increased expression of TGM2 mRNA CTD PMID:18930950 Tgm2 Rat undecane increases expression EXP 6480464 undecane results in increased expression of TGM2 protein CTD PMID:17337753 Tgm2 Rat ursodeoxycholic acid decreases expression EXP 6480464 Ursodeoxycholic Acid results in decreased expression of TGM2 mRNA CTD PMID:15885361 Tgm2 Rat valproic acid multiple interactions ISO Tgm2 (Mus musculus) 6480464 Valproic Acid inhibits the reaction [Dexamethasone results in increased expression of TGM2 mRNA] CTD PMID:23946490 Tgm2 Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of TGM2 mRNA CTD PMID:29427782 Tgm2 Rat valproic acid multiple interactions ISO TGM2 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TGM2 mRNA CTD PMID:27188386 Tgm2 Rat valproic acid increases expression ISO TGM2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of TGM2 mRNA CTD PMID:23179753 more ... Tgm2 Rat valproic acid affects expression ISO TGM2 (Homo sapiens) 6480464 Valproic Acid affects the expression of TGM2 mRNA CTD PMID:25979313 Tgm2 Rat valproic acid decreases methylation ISO TGM2 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of TGM2 gene CTD PMID:29154799 Tgm2 Rat vancomycin decreases expression ISO Tgm2 (Mus musculus) 6480464 Vancomycin results in decreased expression of TGM2 mRNA CTD PMID:18930951 Tgm2 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of TGM2 mRNA CTD PMID:19015723 Tgm2 Rat vitamin D multiple interactions ISO TGM2 (Homo sapiens) 6480464 Vitamin D promotes the reaction [alitretinoin results in increased expression of TGM2 mRNA] CTD PMID:15964820 Tgm2 Rat vitamin K multiple interactions EXP 6480464 [Warfarin co-treated with Vitamin K] results in increased expression of and results in increased activity of TGM2 protein and Quercetin inhibits the reaction [[Warfarin co-treated with Vitamin K] results in increased expression of and results in increased activity of TGM2 protein] CTD PMID:23117658 Tgm2 Rat warfarin affects response to substance ISO Tgm2 (Mus musculus) 6480464 [TGM2 protein affects the susceptibility to Warfarin] which affects the susceptibility to Quercetin and TGM2 protein affects the susceptibility to Warfarin CTD PMID:23117658 Tgm2 Rat warfarin multiple interactions EXP 6480464 [Warfarin co-treated with Vitamin K] results in increased expression of and results in increased activity of TGM2 protein more ... CTD PMID:23117658 Tgm2 Rat warfarin increases response to substance ISO Tgm2 (Mus musculus) 6480464 TGM2 protein results in increased susceptibility to Warfarin CTD PMID:23117658 Tgm2 Rat XL147 multiple interactions ISO Tgm2 (Mus musculus) 6480464 XL147 inhibits the reaction [N-nitroso-tris-chloroethylurea results in increased expression of TGM2 mRNA] CTD PMID:29891994 Tgm2 Rat zinc atom decreases expression EXP 6480464 Zinc deficiency results in decreased expression of TGM2 mRNA CTD PMID:16140947 Tgm2 Rat zinc atom multiple interactions EXP 6480464 Zinc inhibits the reaction [Zinc deficiency results in decreased expression of TGM2 mRNA] CTD PMID:16140947 Tgm2 Rat zinc(0) decreases expression EXP 6480464 Zinc deficiency results in decreased expression of TGM2 mRNA CTD PMID:16140947 Tgm2 Rat zinc(0) multiple interactions EXP 6480464 Zinc inhibits the reaction [Zinc deficiency results in decreased expression of TGM2 mRNA] CTD PMID:16140947 Tgm2 Rat zoledronic acid increases expression ISO TGM2 (Homo sapiens) 6480464 zoledronic acid results in increased expression of TGM2 mRNA CTD PMID:24714768
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) 1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrobenzenesulfonic acid (ISO) 2-bromohexadecanoic acid (ISO) 2-butoxyethanol (ISO) 2-palmitoylglycerol (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3-chloropropane-1,2-diol (EXP) 4,4'-sulfonyldiphenol (ISO) 4-\{[(5,5,8,8-tetramethyl-5,6,7,8-tetrahydronaphthalen-2-yl)carbonyl]amino\}benzoic acid (ISO) 4-hexylbenzene-1,3-diol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) 7-ketocholesterol (ISO) 9-cis-retinoic acid (ISO) acrylamide (EXP) aflatoxin B1 (ISO) all-trans-4-oxoretinoic acid (ISO) all-trans-4-oxoretinol (ISO) all-trans-retinoic acid (EXP,ISO) all-trans-retinol (EXP,ISO) amitrole (EXP) ammonium chloride (EXP) aristolochic acid A (ISO) arotinoid acid (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) astaxanthin (ISO) atrazine (EXP) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[e]pyrene (ISO) benzoates (ISO) beta-carotene (ISO) beta-naphthoflavone (ISO) bexarotene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bucladesine (ISO) budesonide (ISO) buspirone (EXP) butan-1-ol (ISO) Butylbenzyl phthalate (ISO) C60 fullerene (EXP) cadmium dichloride (ISO) calcitriol (ISO) carbon nanotube (ISO) carbonyl sulfide (EXP) CGP 52608 (ISO) chlorpyrifos (EXP) choline (ISO) cisplatin (ISO) cobalt dichloride (EXP,ISO) copper atom (EXP) copper(0) (EXP) corticosterone (EXP) crocidolite asbestos (ISO) Cuprizon (EXP) curcumin (ISO) cyclosporin A (ISO) cystamine (EXP) daidzein (ISO) DDE (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) diazinon (EXP,ISO) dibenz[a,h]anthracene (ISO) dibutyl phthalate (ISO) dieldrin (EXP) diethyl maleate (EXP) diethyl phthalate (ISO) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) dimethyl sulfoxide (ISO) dimethylarsinic acid (EXP) dioxygen (ISO) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) entinostat (ISO) enzacamene (ISO) ethanol (EXP,ISO) ethylparaben (ISO) ferric oxide (ISO) finasteride (EXP) flunisolide (ISO) flusilazole (EXP) flutamide (EXP) formaldehyde (ISO) gentamycin (EXP) glycidyl methacrylate (ISO) glyphosate (ISO) graphite (EXP) griseofulvin (ISO) GTP (ISO) hemin (ISO) heptachlor (EXP) hydrazine (ISO) isobutanol (ISO) isoprenaline (ISO) isoxazoles (ISO) ivermectin (ISO) lipopolysaccharide (ISO) LY294002 (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methapyrilene (ISO) methimazole (EXP) methoxychlor (EXP) microcystin-LR (ISO) mitomycin C (ISO) mometasone furoate (ISO) mono(2-ethylhexyl) phthalate (ISO) monodansylcadaverine (ISO) Muraglitazar (EXP) N-acetyl-L-cysteine (EXP) N-methyl-4-phenylpyridinium (EXP,ISO) N-nitrosodiethylamine (ISO) naphthalene (EXP) nefazodone (EXP) nickel atom (ISO) nimesulide (EXP) paracetamol (EXP,ISO) paraquat (ISO) PD 0325901 (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) phenylephrine (EXP) phorbol 13-acetate 12-myristate (ISO) pinocembrin (ISO) pirinixic acid (ISO) piroxicam (ISO) potassium chromate (ISO) pregnenolone 16alpha-carbonitrile (ISO) progesterone (EXP,ISO) propiconazole (ISO) putrescine (EXP) quercetin (EXP,ISO) quercitrin (ISO) raloxifene (ISO) SB 431542 (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sirolimus (ISO) sodium arsenite (ISO) Soman (EXP) styrene (ISO) succimer (ISO) sulfadimethoxine (EXP) sulindac (ISO) sunitinib (ISO) T-2 toxin (ISO) tamibarotene (ISO) tamoxifen (ISO) tauroursodeoxycholic acid (EXP) temozolomide (ISO) tert-butyl hydroperoxide (ISO) Tesaglitazar (EXP) testosterone (ISO) tetrachloromethane (EXP,ISO) thapsigargin (ISO) thiophenes (ISO) thiram (ISO) titanium dioxide (ISO) toluene (EXP) topotecan (ISO) tributylstannane (ISO) trichloroethene (EXP) trichostatin A (ISO) triclosan (ISO) triptonide (ISO) tris(2-butoxyethyl) phosphate (ISO) troglitazone (EXP) trovafloxacin (ISO) undecane (EXP) ursodeoxycholic acid (EXP) valproic acid (EXP,ISO) vancomycin (ISO) vinclozolin (EXP) vitamin D (ISO) vitamin K (EXP) warfarin (EXP,ISO) XL147 (ISO) zinc atom (EXP) zinc(0) (EXP) zoledronic acid (ISO)
Biological Process
apoptotic cell clearance (ISO) blood vessel remodeling (IMP) bone development (ISS) branching involved in salivary gland morphogenesis (ISO) cellular response to cocaine (ISO) cellular response to dopamine (ISO,ISS) cellular response to serotonin (ISO,ISS) chromatin remodeling (IEA) dopamine secretion (ISO) G protein-coupled receptor signaling pathway (ISO) gene expression (ISO) isopeptide cross-linking via N6-(L-isoglutamyl)-L-lysine (IDA,ISO) negative regulation of endoplasmic reticulum calcium ion concentration (ISO) peptide cross-linking (ISO) phospholipase C-activating G protein-coupled receptor signaling pathway (IBA,IDA,ISO) positive regulation of apoptotic process (IBA,IMP,ISO,ISS) positive regulation of canonical NF-kappaB signal transduction (IMP) positive regulation of cell adhesion (ISO) positive regulation of GTPase activity (ISS) positive regulation of mitochondrial calcium ion concentration (ISO) positive regulation of neurogenesis (ISO) positive regulation of small GTPase mediated signal transduction (ISS) positive regulation of smooth muscle cell proliferation (IDA) positive regulation of sprouting angiogenesis (ISO) protein deamination (ISO,ISS) protein homooligomerization (ISO,ISS) proteolysis (IEA) regulation of apoptotic cell clearance (ISO,ISS) regulation of apoptotic process (ISO,ISS) salivary gland cavitation (ISO)
Molecular Function
acyltransferase activity (IEA) calcium ion binding (ISO,ISS) enzyme binding (IC) GTP binding (IDA,IEA,ISO) histone dopaminyltransferase activity (ISO,ISS) histone serotonyltransferase activity (ISO,ISS) hydrolase activity (IEA) identical protein binding (IPI) metal ion binding (IEA) nucleotide binding (IEA) peptidase activity (IEA) peptide histaminyltransferase activity (ISO,ISS) phospholipase binding (IPI) protein binding (ISO) protein domain specific binding (IPI) protein-glutamine gamma-glutamyltransferase activity (IBA,IEA,ISO) protein-glutamine glutaminase activity (IEA,ISO,ISS) transferase activity (IEA)
1.
Tissue transglutaminase catalyzes the formation of alpha-synuclein crosslinks in Parkinson's disease.
Andringa G, etal., FASEB J. 2004 May;18(7):932-4. Epub 2004 Mar 4.
2.
Small artery remodeling depends on tissue-type transglutaminase.
Bakker EN, etal., Circ Res. 2005 Jan 7;96(1):119-26. Epub 2004 Nov 18.
3.
Role of transglutaminase 2 in glucose tolerance: knockout mice studies and a putative mutation in a MODY patient.
Bernassola F, etal., FASEB J. 2002 Sep;16(11):1371-8.
4.
Intron-exon swapping of transglutaminase mRNA and neuronal Tau aggregation in Alzheimer's disease.
Citron BA, etal., J Biol Chem. 2001 Feb 2;276(5):3295-301. Epub 2000 Sep 29.
5.
Functional coupling of rat myometrial alpha 1-adrenergic receptors to Gh alpha/tissue transglutaminase 2 during pregnancy.
Dupuis M, etal., J Biol Chem. 2004 Apr 30;279(18):19257-63. Epub 2004 Feb 17.
6.
Immunohistochemical study of the apoptotic mechanisms in the intestinal mucosa during children's coeliac disease.
Ehrmann J Jr, etal., Virchows Arch. 2003 May;442(5):453-61. Epub 2003 Apr 16.
7.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
8.
Tissue transglutaminase and its substrates in bone.
Kaartinen MT, etal., J Bone Miner Res. 2002 Dec;17(12):2161-73.
9.
Modulation of intracellular Ca(2+) via alpha(1B)-adrenoreceptor signaling molecules, G alpha(h) (transglutaminase II) and phospholipase C-delta 1.
Kang SK, etal., Biochem Biophys Res Commun 2002 Apr 26;293(1):383-90.
10.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
11.
IFN-gamma induces transglutaminase 2 expression in rat small intestinal cells.
Kim SY, etal., J Interferon Cytokine Res 2002 Jun;22(6):677-82.
12.
Mitochondrial aconitase is a transglutaminase 2 substrate: transglutamination is a probable mechanism contributing to high-molecular-weight aggregates of aconitase and loss of aconitase activity in Huntington disease brain.
Kim SY, etal., Neurochem Res. 2005 Oct;30(10):1245-55.
13.
Transglutaminase 2 induces nuclear factor-kappaB activation via a novel pathway in BV-2 microglia.
Lee J, etal., J Biol Chem. 2004 Dec 17;279(51):53725-35. Epub 2004 Oct 7.
14.
Contribution of tissue transglutaminase to the severity of hepatic fibrosis resulting from Schistosoma japonicum infection through the regulation of IL-33/ST2 expression.
Li ZY, etal., Parasit Vectors. 2019 Jun 14;12(1):302. doi: 10.1186/s13071-019-3542-4.
15.
A novel follicle-stimulating hormone-induced G alpha h/phospholipase C-delta1 signaling pathway mediating rat sertoli cell Ca2+-influx.
Lin YF, etal., Mol Endocrinol. 2006 Oct;20(10):2514-27. Epub 2006 May 18.
16.
Increase in extracellular cross-linking by tissue transglutaminase and reduction in expression of MMP-9 contribute differentially to focal segmental glomerulosclerosis in rats.
Liu S, etal., Mol Cell Biochem. 2006 Mar;284(1-2):9-17. Epub 2006 Feb 14.
17.
Prognostic significance of tissue transglutaminase in drug resistant and metastatic breast cancer.
Mehta K, etal., Clin Cancer Res. 2004 Dec 1;10(23):8068-76.
18.
Abnormal accumulation of tTGase products in muscle and erythrocytes of chorea-acanthocytosis patients.
Melone MA, etal., J Neuropathol Exp Neurol. 2002 Oct;61(10):841-8.
19.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
20.
Phosphorylation of histones by tissue transglutaminase.
Mishra S, etal., J Biol Chem. 2006 Mar 3;281(9):5532-8. Epub 2006 Jan 4.
21.
Gh: a GTP-binding protein with transglutaminase activity and receptor signaling function.
Nakaoka H, etal., Science. 1994 Jun 10;264(5165):1593-6.
22.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
23.
Retinoic acid-induced tissue transglutaminase and apoptosis in vascular smooth muscle cells.
Ou H, etal., Circ Res 2000 Nov 10;87(10):881-7.
24.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
25.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
26.
GOA pipeline
RGD automated data pipeline
27.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
28.
Increases in renal epsilon-(gamma-glutamyl)-lysine crosslinks result from compartment-specific changes in tissue transglutaminase in early experimental diabetic nephropathy: pathologic implications.
Skill NJ, etal., Lab Invest. 2001 May;81(5):705-16.
29.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
30.
COX-2-dependent cardiac failure in Gh/tTG transgenic mice.
Zhang Z, etal., Circ Res 2003 May 30;92(10):1153-61. Epub 2003 Apr 17.
Tgm2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 167,192,612 - 167,221,845 (-) NCBI GRCr8 mRatBN7.2 3 146,772,684 - 146,801,924 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 146,772,687 - 146,801,981 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 150,598,013 - 150,627,250 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 159,097,613 - 159,126,553 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 156,839,077 - 156,868,039 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 154,597,165 - 154,627,257 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 154,597,168 - 154,627,257 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 160,977,905 - 161,007,261 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 148,832,866 - 148,862,385 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 148,738,777 - 148,768,294 (-) NCBI Celera 3 145,473,663 - 145,503,117 (-) NCBI Celera Cytogenetic Map 3 q42 NCBI
TGM2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 38,127,385 - 38,168,475 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 38,127,385 - 38,166,578 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 36,755,787 - 36,794,910 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 36,190,277 - 36,227,114 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 20 36,199,764 - 36,227,114 NCBI Celera 20 33,465,637 - 33,502,475 (-) NCBI Celera Cytogenetic Map 20 q11.23 NCBI HuRef 20 33,493,671 - 33,530,533 (-) NCBI HuRef CHM1_1 20 36,660,115 - 36,696,950 (-) NCBI CHM1_1 T2T-CHM13v2.0 20 39,852,468 - 39,893,578 (-) NCBI T2T-CHM13v2.0
Tgm2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 157,958,325 - 157,988,312 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 157,958,322 - 157,988,356 (-) Ensembl GRCm39 Ensembl GRCm38 2 158,116,405 - 158,146,392 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 158,116,402 - 158,146,436 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 157,942,141 - 157,972,128 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 157,807,846 - 157,837,833 (-) NCBI MGSCv36 mm8 Celera 2 164,061,515 - 164,091,498 (-) NCBI Celera Cytogenetic Map 2 H1 NCBI cM Map 2 78.72 NCBI
Tgm2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955445 18,544,183 - 18,576,570 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955445 18,544,192 - 18,576,576 (+) NCBI ChiLan1.0 ChiLan1.0
TGM2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 21 43,851,557 - 43,889,993 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 20 43,844,655 - 43,881,956 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 20 34,450,845 - 34,488,106 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 20 35,561,819 - 35,599,099 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 20 35,561,819 - 35,599,042 (-) Ensembl panpan1.1 panPan2
TGM2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 24 26,631,339 - 26,662,723 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 24 26,628,009 - 26,663,840 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 24 26,277,181 - 26,308,444 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 24 27,327,862 - 27,359,126 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 24 27,295,164 - 27,359,267 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 24 26,602,350 - 26,633,607 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 24 26,710,189 - 26,741,409 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 24 27,198,294 - 27,229,594 (-) NCBI UU_Cfam_GSD_1.0
Tgm2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 175,541,933 - 175,571,217 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936561 3,178,293 - 3,207,561 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936561 3,178,244 - 3,207,551 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TGM2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 17 41,186,770 - 41,221,637 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 17 41,186,765 - 41,221,686 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 17 46,592,093 - 46,629,982 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TGM2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 25,585,827 - 25,623,961 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 25,585,865 - 25,624,280 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666050 74,426,778 - 74,465,107 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tgm2
.
Predicted Target Of
Count of predictions: 594 Count of miRNA genes: 247 Interacting mature miRNAs: 311 Transcripts: ENSRNOT00000018328 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
12879876 Bw182 Body weight QTL 182 0.003 body mass (VT:0001259) body weight (CMO:0000012) 3 145925360 166177555 Rat 2301411 Bp320 Blood pressure QTL 320 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 145925360 166177555 Rat 2312673 Scl63 Serum cholesterol level QTL 63 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 98535255 168026850 Rat 1300113 Bp176 Blood pressure QTL 176 3.9 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 145956084 157309487 Rat 12879872 Cm97 Cardiac mass QTL 97 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 145925360 166177555 Rat 1598877 Bp285 Blood pressure QTL 285 1.5 0.03 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 120538241 165538241 Rat 1578653 Vnigr3 Vascular neointimal growth QTL 3 3.1 artery morphology trait (VT:0002191) artery neointimal hyperplastic lesion area (CMO:0001414) 3 130656562 169034231 Rat 12879873 Cm96 Cardiac mass QTL 96 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 3 145925360 166177555 Rat 2302373 Gluco39 Glucose level QTL 39 5.01 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 3 98535386 161695835 Rat 12879874 Cm98 Cardiac mass QTL 98 0.005 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 3 145925360 166177555 Rat 1298068 Bp167 Blood pressure QTL 167 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 141074471 169034231 Rat 12879875 Kidm64 Kidney mass QTL 64 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 145925360 166177555 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 2298477 Eau4 Experimental allergic uveoretinitis QTL 4 0.0011 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 3 137398739 169034231 Rat 8552791 Vie2 Viral induced encephalitis QTL 2 4.1 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 3 145956084 169034231 Rat 61335 Bp20 Blood pressure QTL 20 3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 141339236 155617360 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 2317883 Alcrsp26 Alcohol response QTL 26 1.8 0.63 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 3 145526770 169034231 Rat 1578754 Stresp16 Stress response QTL 16 4 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 3 112681431 157681431 Rat 1331726 Bp208 Blood pressure QTL 208 3.129 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 141339013 162184794 Rat 1598854 Memor10 Memory QTL 10 2 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 3 145956084 161299569 Rat 9589106 Insul23 Insulin level QTL 23 13.86 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 3 131635904 169034231 Rat 10755461 Coatc16 Coat color QTL 16 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 3 122438700 167438700 Rat 8662816 Vetf4 Vascular elastic tissue fragility QTL 4 4 renal artery integrity trait (VT:0010642) number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563) 3 59242096 157323038 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 2303620 Vencon4 Ventilatory control QTL 4 3.9 respiration trait (VT:0001943) tidal volume (CMO:0000222) 3 127162703 168026850 Rat 631841 Niddm39 Non-insulin dependent diabetes mellitus QTL 39 3.36 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 94856903 159898684 Rat 1576306 Schws3 Schwannoma susceptibility QTL 3 0.001 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 3 118839124 163839124 Rat 619618 Rf3 Renal disease susceptibility QTL 3 6.5 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate to body weight ratio (CMO:0001270) 3 107693393 152693393 Rat 1300159 Kidm4 Kidney mass QTL 4 3.83 kidney mass (VT:0002707) right kidney wet weight to body weight ratio (CMO:0001953) 3 121056165 157309487 Rat 5686842 Rf59 Renal function QTL 59 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 3 140069424 146976080 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 2312659 Slep7 Serum leptin concentration QTL 7 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 3 98535255 168026850 Rat 631673 Iddm13 Insulin dependent diabetes mellitus QTL 13 1.3 0.663 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 3 130193298 161695983 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 1578656 Vnigr2 Vascular neointimal growth QTL 2 4.2 artery morphology trait (VT:0002191) lesioned artery residual lumen area (CMO:0001417) 3 130656562 169034231 Rat 8552952 Pigfal13 Plasma insulin-like growth factor 1 level QTL 13 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 3 138799500 169034231 Rat 12879871 Am7 Aortic mass QTL 7 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 3 145925360 166177555 Rat 631541 Bp81 Blood pressure QTL 81 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 124122556 169034231 Rat 2293087 Iddm27 Insulin dependent diabetes mellitus QTL 27 2.68 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 97551417 147415807 Rat 2312670 Bw94 Body weight QTL 94 0.01 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 3 98535255 168026850 Rat
RH129789
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 146,772,702 - 146,772,886 (+) MAPPER mRatBN7.2 Rnor_6.0 3 154,597,184 - 154,597,367 NCBI Rnor6.0 Rnor_5.0 3 161,007,059 - 161,007,242 UniSTS Rnor5.0 RGSC_v3.4 3 148,832,885 - 148,833,068 UniSTS RGSC3.4 Celera 3 145,473,682 - 145,473,865 UniSTS RH 3.4 Map 3 1358.9 UniSTS Cytogenetic Map 3 q42 UniSTS
Tgm2
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 3 167,204,009 - 167,204,664 (+) Marker Load Pipeline mRatBN7.2 3 146,784,087 - 146,784,742 (+) MAPPER mRatBN7.2 Rnor_6.0 3 154,608,553 - 154,609,207 NCBI Rnor6.0 Rnor_5.0 3 160,995,219 - 160,995,873 UniSTS Rnor5.0 RGSC_v3.4 3 148,844,264 - 148,844,918 UniSTS RGSC3.4 Celera 3 145,485,061 - 145,485,715 UniSTS Cytogenetic Map 3 q42 UniSTS
RH128073
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 146,772,859 - 146,773,061 (+) MAPPER mRatBN7.2 Rnor_6.0 3 154,597,341 - 154,597,542 NCBI Rnor6.0 Rnor_5.0 3 161,006,884 - 161,007,085 UniSTS Rnor5.0 RGSC_v3.4 3 148,833,042 - 148,833,243 UniSTS RGSC3.4 Celera 3 145,473,839 - 145,474,040 UniSTS Cytogenetic Map 3 q42 UniSTS
UniSTS:466074
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 146,780,187 - 146,780,256 (+) MAPPER mRatBN7.2 Rnor_6.0 3 154,604,655 - 154,604,723 NCBI Rnor6.0 Rnor_5.0 3 160,999,702 - 160,999,771 NCBI Rnor5.0 RGSC_v3.4 3 148,840,366 - 148,840,434 UniSTS RGSC3.4 Celera 3 145,481,163 - 145,481,231 UniSTS Cytogenetic Map 3 q42 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000018328 ⟹ ENSRNOP00000018328
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 146,772,687 - 146,801,981 (-) Ensembl Rnor_6.0 Ensembl 3 154,597,168 - 154,627,257 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000095177 ⟹ ENSRNOP00000083472
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 146,772,687 - 146,799,157 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000097236 ⟹ ENSRNOP00000085355
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 146,772,687 - 146,799,027 (-) Ensembl
RefSeq Acc Id:
NM_019386 ⟹ NP_062259
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 167,192,612 - 167,221,845 (-) NCBI mRatBN7.2 3 146,772,684 - 146,801,924 (-) NCBI Rnor_6.0 3 154,597,165 - 154,627,257 (-) NCBI Rnor_5.0 3 160,977,905 - 161,007,261 (+) NCBI RGSC_v3.4 3 148,832,866 - 148,862,385 (-) RGD Celera 3 145,473,663 - 145,503,117 (-) RGD
Sequence:
TGGTGATCCGCGCCCGAGTGTCCCGCTGCGTCCGAGCTGTCGCCGCTAGCTTGGCCATGGCCGAGGAGCTGAACCTGGAGAGGTGCGATTTGGAGATACAGGCCAATGGCCGTGATCACCACACGGCC
hide sequence
RefSeq Acc Id:
XM_039105740 ⟹ XP_038961668
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 167,192,612 - 167,204,583 (-) NCBI mRatBN7.2 3 146,772,684 - 146,784,661 (-) NCBI
RefSeq Acc Id:
NP_062259 ⟸ NM_019386
- UniProtKB:
Q9WVJ6 (UniProtKB/Swiss-Prot), Q6P6R6 (UniProtKB/Swiss-Prot), A0A8I6GAT6 (UniProtKB/TrEMBL)
- Sequence:
MAEELNLERCDLEIQANGRDHHTADLCQEKLVLRRGQRFRLTLYFEGRGYEASVDRLTFGAVTGPDPSEEAGTKARFSLSDDVEEGSWSASVLDQQDNVLSLQLCTPANAPVGQYRLSLETSTGYQGS
hide sequence
Ensembl Acc Id:
ENSRNOP00000018328 ⟸ ENSRNOT00000018328
RefSeq Acc Id:
XP_038961668 ⟸ XM_039105740
- Peptide Label:
isoform X1
Ensembl Acc Id:
ENSRNOP00000083472 ⟸ ENSRNOT00000095177
Ensembl Acc Id:
ENSRNOP00000085355 ⟸ ENSRNOT00000097236
RGD ID: 13692618 Promoter ID: EPDNEW_R3142 Type: multiple initiation site Name: Tgm2_1 Description: transglutaminase 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 154,627,266 - 154,627,326 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2014-03-13
Tgm2
transglutaminase 2
Tgm2
transglutaminase 2, C polypeptide
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
Tgm2
transglutaminase 2, C polypeptide
tissue-type transglutaminase
Name updated
1299863 APPROVED
2002-08-07
Tgm2
tissue-type transglutaminase
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_expression
expressed only in adult aorta
634391
gene_process
mediates smooth muscle cell (SMC) apoptosis
634391
gene_regulation
expression in the IEC-6 small intestinal epithelial cell line is reduced 4.5-fold after 24 hours of treatment with TGF-beta, and increased 2-fold after 24 hours and 5-fold after 5 days of treatment with IFN-gamma
634392
