Symbol:
Tec
Name:
tec protein tyrosine kinase
RGD ID:
620973
Description:
Predicted to enable non-membrane spanning protein tyrosine kinase activity. Involved in tissue regeneration. Predicted to be located in cell-cell junction and cytoskeleton. Predicted to be active in plasma membrane. Orthologous to human TEC (tec protein tyrosine kinase); PARTICIPATES IN erythropoietin signaling pathway; T cell receptor signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; acetamide.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
cytoplasmic tyrosine kinase; cytoplasmic tyrosine kinase, Dscr28C related; cytoplasmic tyrosine kinase, Dscr28C related (Drosophila); tyrosine-protein kinase Tec
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 35,706,557 - 35,815,563 (+) NCBI GRCr8 mRatBN7.2 14 35,352,551 - 35,461,585 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 35,352,829 - 35,461,557 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 35,717,326 - 35,825,852 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 37,022,092 - 37,130,596 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 35,510,436 - 35,618,954 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 37,918,884 - 38,027,953 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 37,918,652 - 38,027,925 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 37,729,168 - 37,838,252 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 37,756,486 - 37,865,180 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 37,838,323 - 37,868,527 (+) NCBI Celera 14 34,607,791 - 34,715,833 (+) NCBI Celera Cytogenetic Map 14 p11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tec Rat (-)-epigallocatechin 3-gallate multiple interactions ISO TEC (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of TEC mRNA CTD PMID:22079256 Tec Rat (1->4)-beta-D-glucan multiple interactions ISO Tec (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of TEC mRNA CTD PMID:36331819 Tec Rat 1,2-dimethylhydrazine increases expression ISO Tec (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of TEC mRNA CTD PMID:22206623 Tec Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Tec (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of TEC mRNA CTD PMID:19933214 Tec Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of TEC mRNA CTD PMID:33387578 Tec Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Tec (Mus musculus) 6480464 [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in increased expression of TEC mRNA CTD PMID:25975270 Tec Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Tec (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of TEC mRNA CTD PMID:21570461 Tec Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of TEC mRNA CTD PMID:21215274 and PMID:32109520 Tec Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of TEC mRNA CTD PMID:22298810 and PMID:34747641 Tec Rat 2-hydroxypropanoic acid decreases expression ISO TEC (Homo sapiens) 6480464 Lactic Acid results in decreased expression of TEC mRNA CTD PMID:30851411 Tec Rat 4,4'-diaminodiphenylmethane decreases expression ISO Tec (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of TEC mRNA CTD PMID:18648102 Tec Rat 4,4'-sulfonyldiphenol increases expression ISO Tec (Mus musculus) 6480464 bisphenol S results in increased expression of TEC mRNA CTD PMID:30951980 Tec Rat 4,4'-sulfonyldiphenol decreases methylation ISO Tec (Mus musculus) 6480464 bisphenol S results in decreased methylation of TEC promoter CTD PMID:33297965 Tec Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of TEC mRNA CTD PMID:24780913 Tec Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of TEC mRNA CTD PMID:31881176 Tec Rat acrylamide increases expression ISO Tec (Mus musculus) 6480464 Acrylamide results in increased expression of TEC mRNA CTD PMID:30807115 Tec Rat aflatoxin B1 increases methylation ISO TEC (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of TEC gene CTD PMID:27153756 Tec Rat aflatoxin B1 decreases methylation ISO TEC (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of TEC intron CTD PMID:30157460 Tec Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of TEC mRNA CTD PMID:16483693 Tec Rat benzo[a]pyrene multiple interactions ISO Tec (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of TEC mRNA CTD PMID:27858113 Tec Rat benzo[a]pyrene decreases methylation ISO Tec (Mus musculus) 6480464 Benzo(a)pyrene results in decreased methylation of TEC 5' UTR more ... CTD PMID:27901495 Tec Rat benzo[a]pyrene affects methylation ISO TEC (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of TEC 5' UTR CTD PMID:27901495 Tec Rat benzo[b]fluoranthene multiple interactions ISO Tec (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of TEC mRNA CTD PMID:27858113 Tec Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TEC mRNA CTD PMID:25181051 Tec Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TEC mRNA CTD PMID:34947998 Tec Rat bisphenol A increases expression ISO Tec (Mus musculus) 6480464 bisphenol A results in increased expression of TEC mRNA CTD PMID:30951980 and PMID:34585602 Tec Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of TEC gene CTD PMID:28505145 Tec Rat bisphenol F increases expression ISO Tec (Mus musculus) 6480464 bisphenol F results in increased expression of TEC mRNA CTD PMID:30951980 Tec Rat buta-1,3-diene decreases expression ISO Tec (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of TEC mRNA CTD PMID:29038090 Tec Rat CGP 52608 multiple interactions ISO TEC (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to TEC gene] CTD PMID:28238834 Tec Rat chromium(6+) affects expression ISO Tec (Mus musculus) 6480464 chromium hexavalent ion affects the expression of TEC mRNA CTD PMID:28472532 Tec Rat chrysene multiple interactions ISO Tec (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of TEC mRNA CTD PMID:27858113 Tec Rat Dibutyl phosphate affects expression ISO TEC (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of TEC mRNA CTD PMID:37042841 Tec Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of TEC mRNA CTD PMID:21266533 Tec Rat dibutyl phthalate increases expression ISO Tec (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of TEC mRNA CTD PMID:17361019 Tec Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of TEC mRNA CTD PMID:29391264 Tec Rat fulvestrant increases methylation ISO TEC (Homo sapiens) 6480464 Fulvestrant results in increased methylation of TEC gene CTD PMID:31601247 Tec Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of TEC mRNA CTD PMID:33387578 Tec Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of TEC mRNA CTD PMID:24136188 Tec Rat Honokiol multiple interactions ISO TEC (Homo sapiens) 6480464 honokiol inhibits the reaction [N-Formylmethionine Leucyl-Phenylalanine affects the localization of TEC protein] CTD PMID:25980585 Tec Rat hydralazine multiple interactions ISO TEC (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of TEC mRNA CTD PMID:17183730 Tec Rat lead diacetate decreases expression EXP 6480464 lead acetate results in decreased expression of TEC mRNA CTD PMID:22641619 Tec Rat lidocaine increases expression EXP 6480464 Lidocaine results in increased expression of TEC mRNA CTD PMID:35283115 Tec Rat methotrexate affects expression ISO Tec (Mus musculus) 6480464 Methotrexate affects the expression of TEC mRNA CTD PMID:18502557 Tec Rat methoxyacetic acid affects expression EXP 6480464 methoxyacetic acid affects the expression of TEC mRNA CTD PMID:20864626 Tec Rat N(4)-hydroxycytidine decreases expression ISO Tec (Mus musculus) 6480464 N(4)-hydroxycytidine results in decreased expression of TEC mRNA CTD PMID:37748715 Tec Rat N-formyl-L-methionyl-L-leucyl-L-phenylalanine affects localization ISO TEC (Homo sapiens) 6480464 N-Formylmethionine Leucyl-Phenylalanine affects the localization of TEC protein CTD PMID:25980585 Tec Rat N-formyl-L-methionyl-L-leucyl-L-phenylalanine multiple interactions ISO TEC (Homo sapiens) 6480464 AG 1879 inhibits the reaction [N-Formylmethionine Leucyl-Phenylalanine affects the localization of TEC protein] and honokiol inhibits the reaction [N-Formylmethionine Leucyl-Phenylalanine affects the localization of TEC protein] CTD PMID:25980585 Tec Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in increased expression of TEC mRNA CTD PMID:20360939 Tec Rat nickel sulfate decreases expression ISO Tec (Mus musculus) 6480464 nickel sulfate results in decreased expression of TEC mRNA CTD PMID:16100012 Tec Rat nitrates multiple interactions ISO Tec (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of TEC mRNA CTD PMID:35964746 Tec Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of TEC mRNA CTD PMID:33484710 Tec Rat ozone multiple interactions ISO Tec (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of TEC mRNA CTD PMID:34911549 Tec Rat paracetamol affects expression ISO Tec (Mus musculus) 6480464 Acetaminophen affects the expression of TEC mRNA CTD PMID:17562736 Tec Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of TEC mRNA CTD PMID:33387578 Tec Rat paracetamol increases expression ISO TEC (Homo sapiens) 6480464 Acetaminophen results in increased expression of TEC mRNA CTD PMID:29067470 Tec Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Tec (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of TEC mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of TEC mRNA CTD PMID:36331819 Tec Rat phenethyl caffeate multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in increased expression of TEC mRNA CTD PMID:20360939 Tec Rat pirinixic acid increases expression ISO Tec (Mus musculus) 6480464 pirinixic acid results in increased expression of TEC mRNA CTD PMID:18301758 Tec Rat potassium chromate multiple interactions ISO TEC (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of TEC mRNA CTD PMID:22079256 Tec Rat potassium chromate decreases expression ISO TEC (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of TEC mRNA CTD PMID:22079256 Tec Rat pregnenolone 16alpha-carbonitrile decreases expression ISO Tec (Mus musculus) 6480464 Pregnenolone Carbonitrile results in decreased expression of TEC mRNA CTD PMID:28903501 Tec Rat rac-lactic acid decreases expression ISO TEC (Homo sapiens) 6480464 Lactic Acid results in decreased expression of TEC mRNA CTD PMID:30851411 Tec Rat sunitinib decreases expression ISO TEC (Homo sapiens) 6480464 Sunitinib results in decreased expression of TEC mRNA CTD PMID:31533062 Tec Rat testosterone increases expression ISO Tec (Mus musculus) 6480464 Testosterone deficiency results in increased expression of TEC mRNA CTD PMID:33848595 Tec Rat tetraphene multiple interactions ISO Tec (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of TEC mRNA CTD PMID:27858113 Tec Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of TEC mRNA CTD PMID:33387578 Tec Rat triphenyl phosphate affects expression ISO TEC (Homo sapiens) 6480464 triphenyl phosphate affects the expression of TEC mRNA CTD PMID:37042841 Tec Rat triptonide increases expression ISO Tec (Mus musculus) 6480464 triptonide results in increased expression of TEC mRNA CTD PMID:33045310 Tec Rat valproic acid multiple interactions ISO TEC (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of TEC mRNA CTD PMID:17183730 Tec Rat valproic acid increases expression ISO Tec (Mus musculus) 6480464 Valproic Acid results in increased expression of TEC mRNA CTD PMID:21427059 Tec Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of TEC mRNA CTD PMID:23555832
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-hydroxypropanoic acid (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrylamide (ISO) aflatoxin B1 (ISO) ammonium chloride (EXP) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) buta-1,3-diene (ISO) CGP 52608 (ISO) chromium(6+) (ISO) chrysene (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) endosulfan (EXP) fulvestrant (ISO) gentamycin (EXP) glafenine (EXP) Honokiol (ISO) hydralazine (ISO) lead diacetate (EXP) lidocaine (EXP) methotrexate (ISO) methoxyacetic acid (EXP) N(4)-hydroxycytidine (ISO) N-formyl-L-methionyl-L-leucyl-L-phenylalanine (ISO) N-nitrosodiethylamine (EXP) nickel sulfate (ISO) nitrates (ISO) nitrofen (EXP) ozone (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) phenethyl caffeate (EXP) pirinixic acid (ISO) potassium chromate (ISO) pregnenolone 16alpha-carbonitrile (ISO) rac-lactic acid (ISO) sunitinib (ISO) testosterone (ISO) tetraphene (ISO) trichloroethene (EXP) triphenyl phosphate (ISO) triptonide (ISO) valproic acid (ISO) vinclozolin (EXP)
Tec Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 35,706,557 - 35,815,563 (+) NCBI GRCr8 mRatBN7.2 14 35,352,551 - 35,461,585 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 35,352,829 - 35,461,557 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 35,717,326 - 35,825,852 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 37,022,092 - 37,130,596 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 35,510,436 - 35,618,954 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 37,918,884 - 38,027,953 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 37,918,652 - 38,027,925 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 37,729,168 - 37,838,252 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 37,756,486 - 37,865,180 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 37,838,323 - 37,868,527 (+) NCBI Celera 14 34,607,791 - 34,715,833 (+) NCBI Celera Cytogenetic Map 14 p11 NCBI
TEC Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 48,135,783 - 48,269,838 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 48,135,783 - 48,269,838 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 48,137,800 - 48,271,855 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 47,832,557 - 47,966,571 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 47,978,728 - 48,112,742 NCBI Celera 4 48,586,515 - 48,720,532 (-) NCBI Celera Cytogenetic Map 4 p12-p11 NCBI HuRef 4 47,457,565 - 47,591,606 (-) NCBI HuRef CHM1_1 4 48,136,907 - 48,270,950 (-) NCBI CHM1_1 T2T-CHM13v2.0 4 48,102,615 - 48,236,780 (-) NCBI T2T-CHM13v2.0
Tec Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 72,913,061 - 73,025,997 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 72,913,059 - 73,025,826 (-) Ensembl GRCm39 Ensembl GRCm38 5 72,755,718 - 72,868,654 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 72,755,716 - 72,868,483 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 73,146,962 - 73,259,687 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 73,034,873 - 73,147,618 (-) NCBI MGSCv36 mm8 Celera 5 70,005,814 - 70,119,901 (-) NCBI Celera Cytogenetic Map 5 C3.2 NCBI cM Map 5 38.44 NCBI
Tec Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955443 340,940 - 476,702 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955443 339,678 - 474,029 (+) NCBI ChiLan1.0 ChiLan1.0
TEC Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 79,597,405 - 79,732,679 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 79,858,809 - 79,999,701 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 73,885,588 - 74,018,061 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 84,618,088 - 84,750,319 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 84,618,088 - 84,750,319 (+) Ensembl panpan1.1 panPan2
TEC Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 13 43,978,964 - 44,111,256 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 13 43,978,573 - 44,062,795 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 13 43,931,930 - 44,063,497 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 13 44,579,240 - 44,711,903 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 13 44,578,650 - 44,711,864 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 13 44,256,721 - 44,388,235 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 13 43,788,809 - 43,921,144 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 13 44,671,707 - 44,803,644 (-) NCBI UU_Cfam_GSD_1.0
Tec Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405285 31,945,875 - 32,049,975 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936482 14,248,233 - 14,341,402 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936482 14,248,277 - 14,341,329 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TEC Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 38,051,059 - 38,181,874 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 38,051,053 - 38,182,259 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 40,100,495 - 40,275,177 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TEC Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 27 1,982,549 - 2,118,533 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 27 2,024,719 - 2,117,763 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666047 47,991,627 - 48,131,736 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tec
.
Predicted Target Of
Count of predictions: 76 Count of miRNA genes: 56 Interacting mature miRNAs: 74 Transcripts: ENSRNOT00000003125 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1581500 Renag1 Renal agenesis QTL 1 kidney development trait (VT:0000527) percentage of study population developing unilateral renal agenesis during a period of time (CMO:0000940) 14 8170668 68298175 Rat 731183 Pia20 Pristane induced arthritis QTL 20 3.55 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 14 9088978 39057237 Rat 10755459 Coatc15 Coat color QTL 15 0.01681 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 14 19836944 64836944 Rat 1300154 Bp189 Blood pressure QTL 189 3.04 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 14 30883777 68757901 Rat 70187 Pancm5 Pancreatic morphology QTL 5 16.7 pancreas mass (VT:0010144) pancreas weight to body weight ratio (CMO:0000630) 14 30320092 80829842 Rat 2324617 Coatc2 Coat color QTL 2 0.001 coat/hair pigmentation trait (VT:0010463) pigmented coat/hair area to total coat/hair area ratio (CMO:0001810) 14 30767025 39153750 Rat 1358296 Ael3 Aortic elastin QTL 3 3.7 0.00051 aorta elastin amount (VT:0003905) aortic elastin 14 8267090 53267090 Rat 71117 Niddm17 Non-insulin dependent diabetes mellitus QTL 17 2.35 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 14 17593761 42336881 Rat 61420 Pia6 Pristane induced arthritis QTL 6 4.9 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 14 18631345 42337007 Rat 7387267 Uae42 Urinary albumin excretion QTL 42 0.61 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 14 22167967 67167967 Rat 631839 Niddm37 Non-insulin dependent diabetes mellitus QTL 37 3.37 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 11030622 95876975 Rat 2313397 Coatc1 Coat color QTL1 coat/hair pigmentation trait (VT:0010463) coat/hair color measurement (CMO:0001808) 14 18541332 63541332 Rat 631262 Tcas4 Tongue tumor susceptibility QTL 4 7.29 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 14 17622561 42337007 Rat 634352 Apr6 Acute phase response QTL 6 3.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 14 1 41131407 Rat 2302045 Pia39 Pristane induced arthritis QTL 39 4.9 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G2a level (CMO:0002116) 14 8267090 53267090 Rat
D14Got44
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 35,442,032 - 35,442,185 (+) MAPPER mRatBN7.2 Rnor_6.0 14 38,008,403 - 38,008,555 NCBI Rnor6.0 Rnor_5.0 14 37,818,685 - 37,818,837 UniSTS Rnor5.0 RGSC_v3.4 14 37,845,655 - 37,845,808 RGD RGSC3.4 RGSC_v3.4 14 37,845,656 - 37,845,808 UniSTS RGSC3.4 RGSC_v3.1 14 37,848,980 - 37,849,133 RGD Celera 14 34,696,308 - 34,696,463 UniSTS Cytogenetic Map 14 p11 UniSTS
RH144023
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 35,409,966 - 35,410,230 (+) MAPPER mRatBN7.2 Rnor_6.0 14 37,976,338 - 37,976,601 NCBI Rnor6.0 Rnor_5.0 14 37,786,425 - 37,786,688 UniSTS Rnor5.0 RGSC_v3.4 14 37,813,591 - 37,813,854 UniSTS RGSC3.4 Celera 14 34,664,807 - 34,665,070 UniSTS Cytogenetic Map 14 p11 UniSTS
RH141346
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 35,461,158 - 35,461,338 (+) MAPPER mRatBN7.2 Rnor_6.0 14 38,027,527 - 38,027,706 NCBI Rnor6.0 Rnor_5.0 14 37,837,826 - 37,838,005 UniSTS Rnor5.0 RGSC_v3.4 14 37,864,780 - 37,864,959 UniSTS RGSC3.4 Celera 14 34,715,433 - 34,715,612 UniSTS Cytogenetic Map 14 p11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000003125 ⟹ ENSRNOP00000003125
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 35,352,863 - 35,461,557 (+) Ensembl Rnor_6.0 Ensembl 14 37,919,233 - 38,027,925 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000088441 ⟹ ENSRNOP00000075313
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 35,352,829 - 35,461,557 (+) Ensembl Rnor_6.0 Ensembl 14 37,918,652 - 38,027,920 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000097152 ⟹ ENSRNOP00000084561
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 35,352,863 - 35,461,557 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000105424 ⟹ ENSRNOP00000082206
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 35,352,863 - 35,461,557 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000109580 ⟹ ENSRNOP00000085542
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 35,352,863 - 35,461,406 (+) Ensembl
RefSeq Acc Id:
NM_053432 ⟹ NP_445884
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 35,706,870 - 35,815,563 (+) NCBI mRatBN7.2 14 35,352,863 - 35,461,559 (+) NCBI Rnor_6.0 14 37,919,233 - 38,027,927 (+) NCBI Rnor_5.0 14 37,729,168 - 37,838,252 (+) NCBI RGSC_v3.4 14 37,756,486 - 37,865,180 (+) RGD Celera 14 34,607,791 - 34,715,833 (+) RGD
Sequence:
CCGCAGTTTGGCCCGCGCTGTCTCCTGTCCTGTGTCAGCACGCGCTCGGTCAAGGTGTCACATGACACTGAGGATGTCTGAAGAATGAAGTGATGGAACTTTGAAGACCGAGTCAACGGGCAGAAGGG
hide sequence
RefSeq Acc Id:
XM_039092512 ⟹ XP_038948440
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 35,706,853 - 35,815,563 (+) NCBI mRatBN7.2 14 35,352,860 - 35,461,585 (+) NCBI
RefSeq Acc Id:
XM_039092513 ⟹ XP_038948441
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 35,706,864 - 35,813,903 (+) NCBI mRatBN7.2 14 35,352,854 - 35,459,903 (+) NCBI
RefSeq Acc Id:
XM_039092514 ⟹ XP_038948442
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 35,750,483 - 35,815,563 (+) NCBI mRatBN7.2 14 35,396,506 - 35,461,585 (+) NCBI
RefSeq Acc Id:
XM_063273683 ⟹ XP_063129753
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 35,706,862 - 35,815,563 (+) NCBI
RefSeq Acc Id:
XM_063273684 ⟹ XP_063129754
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 35,729,780 - 35,815,563 (+) NCBI
RefSeq Acc Id:
XM_063273685 ⟹ XP_063129755
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 35,706,557 - 35,815,563 (+) NCBI
RefSeq Acc Id:
XM_063273686 ⟹ XP_063129756
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 35,750,483 - 35,815,563 (+) NCBI
RefSeq Acc Id:
NP_445884 ⟸ NM_053432
- UniProtKB:
B2RYC7 (UniProtKB/TrEMBL), A0A8I5ZXG2 (UniProtKB/TrEMBL)
- Sequence:
MNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSVLTYYEGRAEKKYRKGFIDISKIKCVEIVKNDDGIIPCQNKFPFQVVHDANTLYIFAPSPQSRDRWVKKLKEEIKNNNNIMIKYHPKFWADG
hide sequence
Ensembl Acc Id:
ENSRNOP00000003125 ⟸ ENSRNOT00000003125
Ensembl Acc Id:
ENSRNOP00000075313 ⟸ ENSRNOT00000088441
RefSeq Acc Id:
XP_038948441 ⟸ XM_039092513
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_038948440 ⟸ XM_039092512
- Peptide Label:
isoform X2
- UniProtKB:
B2RYC7 (UniProtKB/TrEMBL), A0A8I5ZXG2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038948442 ⟸ XM_039092514
- Peptide Label:
isoform X5
- UniProtKB:
Q9EQ78 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000084561 ⟸ ENSRNOT00000097152
Ensembl Acc Id:
ENSRNOP00000082206 ⟸ ENSRNOT00000105424
Ensembl Acc Id:
ENSRNOP00000085542 ⟸ ENSRNOT00000109580
RefSeq Acc Id:
XP_063129755 ⟸ XM_063273685
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6A3K6 (UniProtKB/TrEMBL), A0A8I5ZXG2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063129753 ⟸ XM_063273683
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6A3K6 (UniProtKB/TrEMBL), A0A8I5ZXG2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063129754 ⟸ XM_063273684
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6A3K6 (UniProtKB/TrEMBL), A0A8I5ZXG2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063129756 ⟸ XM_063273686
- Peptide Label:
isoform X3
- UniProtKB:
Q9EQ78 (UniProtKB/TrEMBL)
RGD ID: 13699300 Promoter ID: EPDNEW_R9821 Type: multiple initiation site Name: Tec_2 Description: tec protein tyrosine kinase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R9822 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 14 37,918,621 - 37,918,681 EPDNEW
RGD ID: 13699297 Promoter ID: EPDNEW_R9822 Type: multiple initiation site Name: Tec_1 Description: tec protein tyrosine kinase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R9821 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 14 37,919,237 - 37,919,297 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-10-23
Tec
tec protein tyrosine kinase
Tec
cytoplasmic tyrosine kinase, Dscr28C related (Drosophila)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-22
Tec
cytoplasmic tyrosine kinase, Dscr28C related (Drosophila)
Tec
tec protein tyrosine kinase
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-08-07
Tec
tec protein tyrosine kinase
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_expression
expressed exclusively in liver
631955
gene_regulation
induced in regeneration liver; induced by EGF
631955
