Symbol:
Prkab2
Name:
protein kinase AMP-activated non-catalytic subunit beta 2
RGD ID:
620905
Description:
Enables protein kinase binding activity. Predicted to be involved in cellular response to nutrient levels; positive regulation of cold-induced thermogenesis; and signal transduction. Located in apical plasma membrane and cytoplasm. Part of cAMP-dependent protein kinase complex and nucleotide-activated protein kinase complex. Orthologous to human PRKAB2 (protein kinase AMP-activated non-catalytic subunit beta 2); PARTICIPATES IN adenosine monophosphate-activated protein kinase (AMPK) signaling pathway; hypertrophic cardiomyopathy pathway; insulin signaling pathway; INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 6-propyl-2-thiouracil; alpha-Zearalanol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
5'-AMP-activated protein kinase subunit beta-2; AMP-activated protein kinase beta-2 regulatory subunit; AMPK beta-2 chain; AMPK subunit beta-2; MGC93432; protein kinase, AMP-activated, beta 2 non-catalytic subunit
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PRKAB2 (protein kinase AMP-activated non-catalytic subunit beta 2) HGNC
Ensembl, HomoloGene, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):
Prkab2 (protein kinase, AMP-activated, beta 2 non-catalytic subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Prkab2 (protein kinase AMP-activated non-catalytic subunit beta 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PRKAB2 (protein kinase AMP-activated non-catalytic subunit beta 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PRKAB2 (protein kinase AMP-activated non-catalytic subunit beta 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
LOC101973983 (5'-AMP-activated protein kinase subunit beta-2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PRKAB2 (protein kinase AMP-activated non-catalytic subunit beta 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PRKAB2 (protein kinase AMP-activated non-catalytic subunit beta 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Prkab2 (protein kinase AMP-activated non-catalytic subunit beta 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
SLC25A15 (solute carrier family 25 member 15) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
PRKAB2 (protein kinase AMP-activated non-catalytic subunit beta 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Prkab2 (protein kinase, AMP-activated, beta 2 non-catalytic subunit)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
GAL83
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
aakb-2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
alc
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
aakb-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
SIP2
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
prkab2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Is Marker For:
QTLs:
Bp365
Candidate Gene For:
Bp365
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 187,946,008 - 187,961,615 (+) NCBI GRCr8 mRatBN7.2 2 185,257,218 - 185,272,846 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 185,257,213 - 185,269,872 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 192,905,393 - 192,917,612 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 190,713,236 - 190,725,438 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 185,538,007 - 185,550,226 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 199,831,990 - 199,847,623 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 199,831,990 - 199,847,629 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 219,309,807 - 219,325,389 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 192,498,430 - 192,510,624 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 192,461,183 - 192,473,369 (+) NCBI Celera 2 177,749,772 - 177,761,966 (+) NCBI Celera Cytogenetic Map 2 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Prkab2 Rat 1,2-dichloroethane decreases expression ISO RGD:735944 6480464 ethylene dichloride results in decreased expression of PRKAB2 mRNA CTD PMID:28960355 Prkab2 Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:735944 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in increased expression of PRKAB2 mRNA] CTD PMID:22206623 Prkab2 Rat 1,2-dimethylhydrazine increases expression ISO RGD:735944 6480464 1,2-Dimethylhydrazine results in increased expression of PRKAB2 mRNA CTD PMID:22206623 Prkab2 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO RGD:735943 6480464 Dihydrotestosterone results in increased expression of PRKAB2 mRNA CTD PMID:29581250 Prkab2 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2,2',4,4'-tetrabromodiphenyl ether results in increased expression of PRKAB2 mRNA CTD PMID:27291303 Prkab2 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO RGD:735943 6480464 2,2',4,4'-tetrabromodiphenyl ether analog results in increased expression of PRKAB2 mRNA CTD PMID:19095052 Prkab2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:735944 6480464 Tetrachlorodibenzodioxin results in decreased expression of PRKAB2 mRNA CTD PMID:19770486 Prkab2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:735944 6480464 Tetrachlorodibenzodioxin affects the expression of PRKAB2 mRNA CTD PMID:21570461|PMID:24680724 Prkab2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:735943 6480464 Tetrachlorodibenzodioxin results in decreased expression of PRKAB2 mRNA CTD PMID:20106945|PMID:21632981 Prkab2 Rat 3,4-methylenedioxymethamphetamine increases expression ISO RGD:735944 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in increased expression of PRKAB2 mRNA CTD PMID:20188158 Prkab2 Rat 3-methylcholanthrene multiple interactions ISO RGD:735943 6480464 Methylcholanthrene promotes the reaction [AHR protein binds to PRKAB2 promoter] CTD PMID:20348232 Prkab2 Rat 4,4'-sulfonyldiphenol affects methylation ISO RGD:735944 6480464 bisphenol S affects the methylation of PRKAB2 gene CTD PMID:31683443 Prkab2 Rat 4-vinylcyclohexene dioxide affects expression ISO RGD:735944 6480464 4-vinyl-1-cyclohexene dioxide affects the expression of PRKAB2 mRNA CTD PMID:20829426 Prkab2 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of PRKAB2 mRNA CTD PMID:30047161 Prkab2 Rat actinomycin D multiple interactions ISO RGD:735943 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of PRKAB2 mRNA CTD PMID:38460933 Prkab2 Rat adefovir pivoxil decreases expression ISO RGD:735943 6480464 adefovir dipivoxil results in decreased expression of PRKAB2 mRNA CTD PMID:25596134 Prkab2 Rat aflatoxin B1 increases expression ISO RGD:735944 6480464 Aflatoxin B1 results in increased expression of PRKAB2 mRNA CTD PMID:19770486 Prkab2 Rat aflatoxin B1 decreases methylation ISO RGD:735943 6480464 Aflatoxin B1 results in decreased methylation of PRKAB2 gene CTD PMID:27153756 Prkab2 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of PRKAB2 mRNA CTD PMID:35163327 Prkab2 Rat alpha-Zearalanol decreases expression EXP 6480464 Zeranol results in decreased expression of PRKAB2 mRNA CTD PMID:35163327 Prkab2 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of PRKAB2 mRNA CTD PMID:30047161 Prkab2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PRKAB2 mRNA CTD PMID:16483693 Prkab2 Rat antirheumatic drug increases expression ISO RGD:735943 6480464 Antirheumatic Agents results in increased expression of PRKAB2 mRNA CTD PMID:24449571 Prkab2 Rat atrazine multiple interactions ISO RGD:735944 6480464 Lycopene inhibits the reaction [Atrazine results in decreased expression of PRKAB2 mRNA] CTD PMID:30360616 Prkab2 Rat atrazine decreases expression ISO RGD:735944 6480464 Atrazine results in decreased expression of PRKAB2 mRNA CTD PMID:30360616 Prkab2 Rat benzo[a]pyrene decreases expression ISO RGD:735944 6480464 Benzo(a)pyrene results in decreased expression of PRKAB2 mRNA CTD PMID:19770486 Prkab2 Rat benzo[a]pyrene decreases expression ISO RGD:735943 6480464 Benzo(a)pyrene results in decreased expression of PRKAB2 mRNA CTD PMID:32234424 Prkab2 Rat benzo[a]pyrene increases methylation ISO RGD:735943 6480464 Benzo(a)pyrene results in increased methylation of PRKAB2 promoter CTD PMID:27901495 Prkab2 Rat benzo[a]pyrene increases expression ISO RGD:735944 6480464 Benzo(a)pyrene results in increased expression of PRKAB2 mRNA CTD PMID:22228805 Prkab2 Rat benzo[a]pyrene diol epoxide I increases expression ISO RGD:735943 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in increased expression of PRKAB2 mRNA CTD PMID:26238291 Prkab2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PRKAB2 mRNA CTD PMID:25181051 Prkab2 Rat bisphenol A decreases expression ISO RGD:735944 6480464 bisphenol A results in decreased expression of PRKAB2 mRNA CTD PMID:32156529 Prkab2 Rat cadmium dichloride decreases expression ISO RGD:735943 6480464 Cadmium Chloride results in decreased expression of PRKAB2 mRNA CTD PMID:25596134|PMID:38568856 Prkab2 Rat caffeine decreases phosphorylation ISO RGD:735943 6480464 Caffeine results in decreased phosphorylation of PRKAB2 protein CTD PMID:35688186 Prkab2 Rat cantharidin decreases expression ISO RGD:735944 6480464 Cantharidin results in decreased expression of PRKAB2 mRNA CTD PMID:36907384 Prkab2 Rat carbamazepine affects expression ISO RGD:735943 6480464 Carbamazepine affects the expression of PRKAB2 mRNA CTD PMID:25979313 Prkab2 Rat carbon nanotube decreases expression ISO RGD:735944 6480464 Nanotubes, Carbon analog results in decreased expression of PRKAB2 mRNA CTD PMID:25554681 Prkab2 Rat chloroacetaldehyde decreases expression ISO RGD:735943 6480464 chloroacetaldehyde results in decreased expression of PRKAB2 mRNA CTD PMID:25596134 Prkab2 Rat chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of PRKAB2 mRNA CTD PMID:17452286 Prkab2 Rat choline multiple interactions ISO RGD:735944 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Prkab2 Rat cidofovir anhydrous decreases expression ISO RGD:735943 6480464 Cidofovir results in decreased expression of PRKAB2 mRNA CTD PMID:25596134 Prkab2 Rat cisplatin decreases expression ISO RGD:735943 6480464 Cisplatin results in decreased expression of PRKAB2 mRNA CTD PMID:25596134 Prkab2 Rat clodronic acid decreases expression ISO RGD:735943 6480464 Clodronic Acid results in decreased expression of PRKAB2 mRNA CTD PMID:25596134 Prkab2 Rat copper atom multiple interactions ISO RGD:735943 6480464 [NSC 689534 binds to Copper] which results in increased expression of PRKAB2 mRNA CTD PMID:20971185 Prkab2 Rat copper(0) multiple interactions ISO RGD:735943 6480464 [NSC 689534 binds to Copper] which results in increased expression of PRKAB2 mRNA CTD PMID:20971185 Prkab2 Rat coumarin affects phosphorylation ISO RGD:735943 6480464 coumarin affects the phosphorylation of PRKAB2 protein CTD PMID:35688186 Prkab2 Rat cyclosporin A decreases expression ISO RGD:735943 6480464 Cyclosporine results in decreased expression of PRKAB2 mRNA CTD PMID:25562108 Prkab2 Rat cyclosporin A increases expression ISO RGD:735943 6480464 Cyclosporine results in increased expression of PRKAB2 mRNA CTD PMID:25596134 Prkab2 Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of PRKAB2 mRNA CTD PMID:23640034 Prkab2 Rat diazinon increases expression EXP 6480464 Diazinon results in increased expression of PRKAB2 mRNA CTD PMID:17452286 Prkab2 Rat Dibutyl phosphate affects expression ISO RGD:735943 6480464 di-n-butylphosphoric acid affects the expression of PRKAB2 mRNA CTD PMID:37042841 Prkab2 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of PRKAB2 mRNA CTD PMID:21266533 Prkab2 Rat dibutyl phthalate increases expression ISO RGD:735944 6480464 Dibutyl Phthalate results in increased expression of PRKAB2 mRNA CTD PMID:17361019|PMID:21266533 Prkab2 Rat dioxygen decreases expression ISO RGD:735943 6480464 Oxygen deficiency results in decreased expression of PRKAB2 mRNA CTD PMID:25596134 Prkab2 Rat doxorubicin decreases expression ISO RGD:735944 6480464 Doxorubicin results in decreased expression of PRKAB2 mRNA CTD PMID:17888722 Prkab2 Rat ethanol affects splicing ISO RGD:735944 6480464 Ethanol affects the splicing of PRKAB2 mRNA CTD PMID:30319688 Prkab2 Rat ethyl methanesulfonate increases expression ISO RGD:735943 6480464 Ethyl Methanesulfonate results in increased expression of PRKAB2 mRNA CTD PMID:23649840 Prkab2 Rat fenofibrate increases expression ISO RGD:735944 6480464 Fenofibrate results in increased expression of PRKAB2 mRNA CTD PMID:21318169 Prkab2 Rat fenofibrate multiple interactions ISO RGD:735944 6480464 [PPARA protein affects the susceptibility to Fenofibrate] which affects the expression of PRKAB2 mRNA CTD PMID:21318169 Prkab2 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of PRKAB2 mRNA CTD PMID:24793618 Prkab2 Rat folic acid multiple interactions ISO RGD:735944 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992|PMID:22206623 Prkab2 Rat folic acid decreases expression ISO RGD:735943 6480464 Folic Acid results in decreased expression of PRKAB2 mRNA CTD PMID:21867686 Prkab2 Rat formaldehyde increases expression ISO RGD:735943 6480464 Formaldehyde results in increased expression of PRKAB2 mRNA CTD PMID:23649840 Prkab2 Rat FR900359 increases phosphorylation ISO RGD:735943 6480464 FR900359 results in increased phosphorylation of PRKAB2 protein CTD PMID:37730182 Prkab2 Rat graphite affects expression EXP 6480464 Graphite affects the expression of PRKAB2 mRNA CTD PMID:29933104 Prkab2 Rat hydrogen peroxide affects expression ISO RGD:735943 6480464 Hydrogen Peroxide affects the expression of PRKAB2 mRNA CTD PMID:20044591 Prkab2 Rat ibuprofen decreases expression ISO RGD:735943 6480464 Ibuprofen results in decreased expression of PRKAB2 mRNA CTD PMID:25596134 Prkab2 Rat ifosfamide affects expression ISO RGD:735943 6480464 Ifosfamide affects the expression of PRKAB2 mRNA CTD PMID:25596134 Prkab2 Rat L-methionine multiple interactions ISO RGD:735944 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Prkab2 Rat lead(0) affects expression ISO RGD:735943 6480464 Lead affects the expression of PRKAB2 mRNA CTD PMID:28903495 Prkab2 Rat leflunomide decreases expression ISO RGD:735943 6480464 leflunomide results in decreased expression of PRKAB2 mRNA CTD PMID:28988120 Prkab2 Rat lycopene multiple interactions ISO RGD:735944 6480464 Lycopene inhibits the reaction [Atrazine results in decreased expression of PRKAB2 mRNA] CTD PMID:30360616 Prkab2 Rat manganese(II) chloride increases expression EXP 6480464 manganese chloride results in increased expression of PRKAB2 mRNA CTD PMID:28801915 Prkab2 Rat menadione affects expression ISO RGD:735943 6480464 Vitamin K 3 affects the expression of PRKAB2 mRNA CTD PMID:20044591 Prkab2 Rat menadione decreases expression ISO RGD:735944 6480464 Vitamin K 3 results in decreased expression of PRKAB2 mRNA CTD PMID:25270620 Prkab2 Rat metformin increases expression EXP 6480464 Metformin results in increased expression of PRKAB2 mRNA CTD PMID:25596134 Prkab2 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of PRKAB2 mRNA CTD PMID:30047161 Prkab2 Rat methotrexate increases expression ISO RGD:735943 6480464 Methotrexate results in increased expression of PRKAB2 mRNA CTD PMID:24449571 Prkab2 Rat methyl methanesulfonate increases expression ISO RGD:735943 6480464 Methyl Methanesulfonate results in increased expression of PRKAB2 mRNA CTD PMID:23649840 Prkab2 Rat methylmercury chloride increases expression ISO RGD:735943 6480464 methylmercuric chloride results in increased expression of PRKAB2 mRNA CTD PMID:28001369 Prkab2 Rat mono(2-ethylhexyl) phthalate increases expression ISO RGD:735944 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of PRKAB2 mRNA CTD PMID:32522588 Prkab2 Rat N-methyl-4-phenylpyridinium increases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in increased expression of PRKAB2 mRNA CTD PMID:28801915 Prkab2 Rat nickel atom decreases expression ISO RGD:735943 6480464 Nickel results in decreased expression of PRKAB2 mRNA CTD PMID:25583101 Prkab2 Rat nickel sulfate decreases expression ISO RGD:735943 6480464 nickel sulfate results in decreased expression of PRKAB2 mRNA CTD PMID:22714537 Prkab2 Rat nitrates multiple interactions ISO RGD:735944 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of PRKAB2 more ... CTD PMID:35964746 Prkab2 Rat Nutlin-3 multiple interactions ISO RGD:735943 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of PRKAB2 mRNA CTD PMID:38460933 Prkab2 Rat okadaic acid decreases expression ISO RGD:735943 6480464 Okadaic Acid results in decreased expression of PRKAB2 mRNA CTD PMID:38832940 Prkab2 Rat ozone multiple interactions ISO RGD:735944 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of PRKAB2 more ... CTD PMID:34911549 Prkab2 Rat paracetamol decreases expression ISO RGD:735943 6480464 Acetaminophen results in decreased expression of PRKAB2 mRNA CTD PMID:21420995 Prkab2 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of PRKAB2 mRNA CTD PMID:33387578 Prkab2 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of PRKAB2 mRNA CTD PMID:35163327 Prkab2 Rat phenethyl isothiocyanate increases expression ISO RGD:735943 6480464 phenethyl isothiocyanate results in increased expression of PRKAB2 mRNA CTD PMID:26678675 Prkab2 Rat quercetin decreases expression ISO RGD:735943 6480464 Quercetin results in decreased expression of PRKAB2 mRNA CTD PMID:21632981 Prkab2 Rat sodium arsenite decreases expression ISO RGD:735943 6480464 sodium arsenite results in decreased expression of PRKAB2 mRNA CTD PMID:28595984|PMID:29301061|PMID:34032870 Prkab2 Rat sodium arsenite increases expression ISO RGD:735943 6480464 sodium arsenite results in increased expression of PRKAB2 mRNA CTD PMID:38568856 Prkab2 Rat sunitinib increases expression ISO RGD:735943 6480464 Sunitinib results in increased expression of PRKAB2 mRNA CTD PMID:31533062 Prkab2 Rat testosterone enanthate affects expression ISO RGD:735943 6480464 testosterone enanthate affects the expression of PRKAB2 mRNA CTD PMID:17440010 Prkab2 Rat tetrachloromethane affects expression ISO RGD:735944 6480464 Carbon Tetrachloride affects the expression of PRKAB2 mRNA CTD PMID:17484886 Prkab2 Rat tetrachloromethane increases expression ISO RGD:735944 6480464 Carbon Tetrachloride results in increased expression of PRKAB2 mRNA CTD PMID:31919559 Prkab2 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of PRKAB2 mRNA CTD PMID:31150632 Prkab2 Rat tetracycline increases expression ISO RGD:735944 6480464 Tetracycline results in increased expression of PRKAB2 mRNA CTD PMID:16917069 Prkab2 Rat thimerosal decreases expression ISO RGD:735943 6480464 Thimerosal results in decreased expression of PRKAB2 mRNA CTD PMID:27188386 Prkab2 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PRKAB2 mRNA CTD PMID:23411599 Prkab2 Rat thiram increases expression ISO RGD:735943 6480464 Thiram results in increased expression of PRKAB2 mRNA CTD PMID:38568856 Prkab2 Rat titanium dioxide decreases methylation ISO RGD:735944 6480464 titanium dioxide results in decreased methylation of PRKAB2 gene CTD PMID:35295148 Prkab2 Rat titanium dioxide increases methylation ISO RGD:735944 6480464 titanium dioxide results in increased methylation of PRKAB2 promoter CTD PMID:35295148 Prkab2 Rat triphenyl phosphate affects expression ISO RGD:735943 6480464 triphenyl phosphate affects the expression of PRKAB2 mRNA CTD PMID:37042841 Prkab2 Rat Triptolide increases expression EXP 6480464 triptolide results in increased expression of PRKAB2 mRNA CTD PMID:23639586 Prkab2 Rat valproic acid decreases expression ISO RGD:735943 6480464 Valproic Acid results in decreased expression of PRKAB2 mRNA CTD PMID:23179753 Prkab2 Rat valproic acid affects expression ISO RGD:735943 6480464 Valproic Acid affects the expression of PRKAB2 mRNA CTD PMID:25979313 Prkab2 Rat zinc atom decreases expression ISO RGD:735943 6480464 Zinc deficiency results in decreased expression of PRKAB2 mRNA CTD PMID:22171008 Prkab2 Rat zinc(0) decreases expression ISO RGD:735943 6480464 Zinc deficiency results in decreased expression of PRKAB2 mRNA CTD PMID:22171008 Prkab2 Rat zoledronic acid decreases expression ISO RGD:735943 6480464 zoledronic acid results in decreased expression of PRKAB2 mRNA CTD PMID:25596134
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Prkab2 Rat AMP-activated protein kinase activity contributes_to ISS UniProtKB:O43741 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Prkab2 Rat AMP-activated protein kinase activity contributes_to ISO RGD:735943 1624291 PMID:21399626 RGD PMID:21399626 Prkab2 Rat enzyme binding IPI RGD:2758|RGD:2755 10401936 RGD Prkab2 Rat protein binding enables ISO RGD:735943 1624291 UniProtKB:A0A1U9X8X8|UniProtKB:A6NEM1|UniProtKB:A8MQ03|UniProtKB:G5E9A7|UniProtKB:O00231|UniProtKB:O00472|UniProtKB:O14627|UniProtKB:O15499|UniProtKB:O43186|UniProtKB:O43597|UniProtKB:O43609|UniProtKB:O60333-2|UniProtKB:O60729|UniProtKB:O75558|UniProtKB:O75928|UniProtKB:O95865|UniProtKB:P01185|UniProtKB:P04792|UniProtKB:P06396|UniProtKB:P0CG21|UniProtKB:P11217|UniProtKB:P14920|UniProtKB:P15976|UniProtKB:P15976-2|UniProtKB:P18545|UniProtKB:P19237|UniProtKB:P21333-2|UniProtKB:P22607|UniProtKB:P26371|UniProtKB:P27918|UniProtKB:P28799|UniProtKB:P31153|UniProtKB:P42575|UniProtKB:P50222|UniProtKB:P54619|UniProtKB:P54646|UniProtKB:P60370|UniProtKB:P60409|UniProtKB:P60410|UniProtKB:P60411|UniProtKB:P60412|UniProtKB:P61289|UniProtKB:P61758|UniProtKB:Q01974|UniProtKB:Q03989|UniProtKB:Q04864-2|UniProtKB:Q07627|UniProtKB:Q08117-2|UniProtKB:Q08379|UniProtKB:Q12824-2|UniProtKB:Q12933|UniProtKB:Q13131|UniProtKB:Q13360-2|UniProtKB:Q13422|UniProtKB:Q13956|UniProtKB:Q14140|UniProtKB:Q14142|UniProtKB:Q14957|UniProtKB:Q15323|UniProtKB:Q15742|UniProtKB:Q3KP22-3|UniProtKB:Q3SXR2|UniProtKB:Q53FD0-2|UniProtKB:Q53HV7-2|UniProtKB:Q5BKX5-3|UniProtKB:Q5JQS6|UniProtKB:Q5JUW0-3|UniProtKB:Q5RL73|UniProtKB:Q5T124|UniProtKB:Q5T3J3|UniProtKB:Q5VVH5|UniProtKB:Q5VWN6-2|UniProtKB:Q5W5X9-3|UniProtKB:Q6A162|UniProtKB:Q6PF18|UniProtKB:Q6PI77|UniProtKB:Q6S9Z5|UniProtKB:Q6UY14-3|UniProtKB:Q6ZR37|UniProtKB:Q70EL1-9|UniProtKB:Q7L4P6|UniProtKB:Q7L591-3|UniProtKB:Q7L5D6|UniProtKB:Q7Z699|UniProtKB:Q7Z783|UniProtKB:Q7Z7F0-4|UniProtKB:Q8IUG1|UniProtKB:Q8IWZ5|UniProtKB:Q8IYA8|UniProtKB:Q8N4C7|UniProtKB:Q8N6F8|UniProtKB:Q8N9N5|UniProtKB:Q8N9N5-2|UniProtKB:Q8NFV4-4|UniProtKB:Q8TAI7|UniProtKB:Q8TC17|UniProtKB:Q8TDS5|UniProtKB:Q8TF47|UniProtKB:Q8TF50|UniProtKB:Q8WXI9|UniProtKB:Q93062-3|UniProtKB:Q969E8|UniProtKB:Q96BA8|UniProtKB:Q96D03|UniProtKB:Q96E35|UniProtKB:Q96I34|UniProtKB:Q96KQ4|UniProtKB:Q96PF1|UniProtKB:Q96PU8|UniProtKB:Q96QF0-7|UniProtKB:Q96RU7|UniProtKB:Q99081-3|UniProtKB:Q99471|UniProtKB:Q99750|UniProtKB:Q9BQ66|UniProtKB:Q9BRK4|UniProtKB:Q9BRX9|UniProtKB:Q9BUN5-3|UniProtKB:Q9BYP8|UniProtKB:Q9BYQ0|UniProtKB:Q9BYQ2|UniProtKB:Q9BYQ3|UniProtKB:Q9BYQ4|UniProtKB:Q9BYR2|UniProtKB:Q9BYR5|UniProtKB:Q9BYR6|UniProtKB:Q9BYR9|UniProtKB:Q9BYV2|UniProtKB:Q9GZV8|UniProtKB:Q9H079|UniProtKB:Q9H2G9|UniProtKB:Q9H5F2|UniProtKB:Q9H7T9|UniProtKB:Q9H8Y8|UniProtKB:Q9NQ30|UniProtKB:Q9NQB0-10|UniProtKB:Q9NWW7|UniProtKB:Q9NYG5-2|UniProtKB:Q9NZH6|UniProtKB:Q9P0T4|UniProtKB:Q9UBR4-2|UniProtKB:Q9UFD9|UniProtKB:Q9UGI9|UniProtKB:Q9UIH9|UniProtKB:Q9UK41-2|UniProtKB:Q9UKT9|UniProtKB:Q9UL36|UniProtKB:Q9UMX0|UniProtKB:Q9UNE2|UniProtKB:Q9UPQ4-2|UniProtKB:Q9UPU9-3|UniProtKB:Q9Y242|UniProtKB:Q9Y250|UniProtKB:Q9Y3C5|UniProtKB:Q9Y5V3|UniProtKB:Q9Y649 PMID:16306228, PMID:20562859, PMID:21516116, PMID:21988832, PMID:22363791, PMID:23455922, PMID:24722188, PMID:25416956, PMID:25852190, PMID:27107012, PMID:28514442, PMID:29892012, PMID:31515488, more ... RGD PMID:16306228|PMID:20562859|PMID:21516116|PMID:21988832|PMID:22363791|PMID:23455922|PMID:24722188|PMID:25416956|PMID:25852190|PMID:27107012|PMID:28514442|PMID:29892012|PMID:31515488|PMID:32296183|PMID:32707033|PMID:32814053|PMID:33961781|PMID:35271311 Prkab2 Rat protein kinase binding IPI RGD:3387 1600447 RGD Prkab2 Rat protein kinase binding enables IBA PANTHER:PTN000038857|RGD:620905|RGD:71057 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Prkab2 Rat protein kinase binding IPI RGD:620893 1600447 RGD
Imported Annotations - KEGG (archival)
1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-methylcholanthrene (ISO) 4,4'-sulfonyldiphenol (ISO) 4-vinylcyclohexene dioxide (ISO) 6-propyl-2-thiouracil (EXP) actinomycin D (ISO) adefovir pivoxil (ISO) aflatoxin B1 (ISO) alpha-Zearalanol (EXP) amitrole (EXP) ammonium chloride (EXP) antirheumatic drug (ISO) atrazine (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (EXP,ISO) cadmium dichloride (ISO) caffeine (ISO) cantharidin (ISO) carbamazepine (ISO) carbon nanotube (ISO) chloroacetaldehyde (ISO) chlorpyrifos (EXP) choline (ISO) cidofovir anhydrous (ISO) cisplatin (ISO) clodronic acid (ISO) copper atom (ISO) copper(0) (ISO) coumarin (ISO) cyclosporin A (ISO) decabromodiphenyl ether (EXP) diazinon (EXP) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dioxygen (ISO) doxorubicin (ISO) ethanol (ISO) ethyl methanesulfonate (ISO) fenofibrate (ISO) flutamide (EXP) folic acid (ISO) formaldehyde (ISO) FR900359 (ISO) graphite (EXP) hydrogen peroxide (ISO) ibuprofen (ISO) ifosfamide (ISO) L-methionine (ISO) lead(0) (ISO) leflunomide (ISO) lycopene (ISO) manganese(II) chloride (EXP) menadione (ISO) metformin (EXP) methimazole (EXP) methotrexate (ISO) methyl methanesulfonate (ISO) methylmercury chloride (ISO) mono(2-ethylhexyl) phthalate (ISO) N-methyl-4-phenylpyridinium (EXP) nickel atom (ISO) nickel sulfate (ISO) nitrates (ISO) Nutlin-3 (ISO) okadaic acid (ISO) ozone (ISO) paracetamol (EXP,ISO) perfluorooctanoic acid (EXP) phenethyl isothiocyanate (ISO) quercetin (ISO) sodium arsenite (ISO) sunitinib (ISO) testosterone enanthate (ISO) tetrachloromethane (EXP,ISO) tetracycline (ISO) thimerosal (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) triphenyl phosphate (ISO) Triptolide (EXP) valproic acid (ISO) zinc atom (ISO) zinc(0) (ISO) zoledronic acid (ISO)
1.
Control of glycogen synthase through ADIPOR1-AMPK pathway in renal distal tubules of normal and diabetic rats.
Cammisotto PG, etal., Am J Physiol Renal Physiol. 2008 Apr;294(4):F881-9. doi: 10.1152/ajprenal.00373.2007. Epub 2008 Feb 6.
2.
Expression of the AMP-activated protein kinase beta1 and beta2 subunits in skeletal muscle.
Chen Z, etal., FEBS Lett 1999 Oct 29;460(2):343-8.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
The AMP-activated protein kinase pathway--new players upstream and downstream.
Hardie DG J Cell Sci. 2004 Nov 1;117(Pt 23):5479-87.
6.
Management of cellular energy by the AMP-activated protein kinase system.
Hardie DG, etal., FEBS Lett. 2003 Jul 3;546(1):113-20.
7.
AMP-activated protein kinase beta subunit tethers alpha and gamma subunits via its C-terminal sequence (186-270).
Iseli TJ, etal., J Biol Chem. 2005 Apr 8;280(14):13395-400. Epub 2005 Jan 28.
8.
Glutathione S-transferases interact with AMP-activated protein kinase: evidence for S-glutathionylation and activation in vitro.
Klaus A, etal., PLoS One. 2013 May 31;8(5):e62497. doi: 10.1371/journal.pone.0062497. Print 2013.
9.
Activation of AMPK alpha- and gamma-isoform complexes in the intact ischemic rat heart.
Li J, etal., Am J Physiol Heart Circ Physiol. 2006 Oct;291(4):H1927-34. Epub 2006 Apr 28.
10.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
11.
Lack of Adipocyte AMPK Exacerbates Insulin Resistance and Hepatic Steatosis through Brown and Beige Adipose Tissue Function.
Mottillo EP, etal., Cell Metab. 2016 Jul 12;24(1):118-29. doi: 10.1016/j.cmet.2016.06.006.
12.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
13.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
14.
GOA pipeline
RGD automated data pipeline
15.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
16.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
17.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Prkab2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 187,946,008 - 187,961,615 (+) NCBI GRCr8 mRatBN7.2 2 185,257,218 - 185,272,846 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 185,257,213 - 185,269,872 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 192,905,393 - 192,917,612 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 190,713,236 - 190,725,438 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 185,538,007 - 185,550,226 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 199,831,990 - 199,847,623 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 199,831,990 - 199,847,629 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 219,309,807 - 219,325,389 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 192,498,430 - 192,510,624 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 192,461,183 - 192,473,369 (+) NCBI Celera 2 177,749,772 - 177,761,966 (+) NCBI Celera Cytogenetic Map 2 q34 NCBI
PRKAB2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 147,155,106 - 147,172,470 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 147,155,106 - 147,172,550 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 146,626,685 - 146,644,049 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 145,093,309 - 145,110,753 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 143,851,502 - 143,868,945 NCBI Celera 1 122,340,718 - 122,358,162 (+) NCBI Celera Cytogenetic Map 1 q21.1 NCBI HuRef 1 120,039,190 - 120,056,673 (-) NCBI HuRef CHM1_1 1 148,523,232 - 148,540,715 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 147,635,939 - 147,653,299 (+) NCBI T2T-CHM13v2.0
Prkab2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 97,565,527 - 97,581,128 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 97,565,509 - 97,581,128 (+) Ensembl GRCm39 Ensembl GRCm38 3 97,658,211 - 97,673,812 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 97,658,193 - 97,673,812 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 97,462,135 - 97,477,006 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 97,743,617 - 97,758,488 (+) NCBI MGSCv36 mm8 Celera 3 99,057,874 - 99,072,745 (+) NCBI Celera Cytogenetic Map 3 F2.2 NCBI cM Map 3 42.25 NCBI
Prkab2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955568 1,252,736 - 1,279,761 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955568 1,253,331 - 1,279,761 (+) NCBI ChiLan1.0 ChiLan1.0
PRKAB2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 102,556,601 - 102,574,428 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 102,144,935 - 102,162,775 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 122,577,308 - 122,595,083 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 112,934,877 - 112,952,364 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 112,934,877 - 112,952,364 (+) Ensembl panpan1.1 panPan2
PRKAB2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 17 57,614,499 - 57,630,041 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 17 57,616,451 - 57,630,041 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 17 57,138,994 - 57,154,977 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 17 58,608,987 - 58,624,968 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 17 58,547,205 - 58,625,036 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 17 57,507,665 - 57,523,856 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 17 57,555,486 - 57,571,458 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 17 58,281,440 - 58,297,432 (-) NCBI UU_Cfam_GSD_1.0
LOC101973983
PRKAB2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 100,378,071 - 100,394,338 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 100,378,047 - 100,394,346 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 110,207,633 - 110,223,926 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PRKAB2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Vero_WHO_p1.0 NW_023666038 15,067,417 - 15,083,027 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Prkab2
.
Predicted Target Of
Count of predictions: 137 Count of miRNA genes: 89 Interacting mature miRNAs: 106 Transcripts: ENSRNOT00000063783 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578648 Bss11 Bone structure and strength QTL 11 4.7 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 2 114837527 211674221 Rat 1358356 Srcrt1 Stress Responsive Cort QTL1 3.66 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 2 161699179 222436696 Rat 1331734 Bp204 Blood pressure QTL 204 3.61192 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168358098 223265385 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 1298076 Bp166 Blood pressure QTL 166 0.0009 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 136445150 202447032 Rat 152025245 Scl81 Serum cholesterol level QTL 81 3.49 blood cholesterol amount (VT:0000180) 2 122609194 206936711 Rat 70162 Bp63 Blood pressure QTL 63 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 1554319 Bmd2 Bone mineral density QTL 2 13.4 0.0001 lumbar vertebra area (VT:0010570) lumbar vertebra cross-sectional area (CMO:0001689) 2 114837675 212549332 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 10043136 Iddm54 Insulin dependent diabetes mellitus QTL 54 3.4 0.0001 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 2 143657411 190602963 Rat 1302793 Bw16 Body weight QTL 16 5 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 2 157142209 202446871 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 61469 Bp16 Blood pressure QTL 16 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 70175 BpQTLCluster3 Blood pressure QTL cluster 3 4.128 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 2 135552573 202446871 Rat 1358900 Bw48 Body weight QTL 48 4.88 body mass (VT:0001259) body weight (CMO:0000012) 2 157142078 211086598 Rat 4889834 Pur24 Proteinuria QTL 24 5.8 0.014 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 2 184114274 202447032 Rat 1359030 Bp277 Blood pressure QTL 277 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 114837527 185876470 Rat 1331760 Bp206 Blood pressure QTL 206 3.62454 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 56043031 202447032 Rat 1581502 Esta3 Estrogen-induced thymic atrophy QTL 3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 2 136916935 189599348 Rat 9589044 Scfw1 Subcutaneous fat weight QTL 1 5.8 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 2 182171407 227171407 Rat 8694435 Bw166 Body weight QTL 166 14.08 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 2 182171407 227171407 Rat 1359032 Hrtrt18 Heart rate QTL 18 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 2 157142078 192625452 Rat 2301966 Bp322 Blood pressure QTL 322 3.58 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150540301 202447032 Rat 1298080 Bp163 Blood pressure QTL 163 0.02 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118275 202447032 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 8694194 Abfw1 Abdominal fat weight QTL 1 11.7 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 2 182171407 227171407 Rat 1359022 Ppulsi1 Prepulse inhibition QTL 1 3.63 prepulse inhibition trait (VT:0003088) acoustic startle response measurement (CMO:0001519) 2 136916935 213594495 Rat 1641891 Alcrsp17 Alcohol response QTL 17 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 249053267 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 61374 Edpm2 Estrogen-dependent pituitary mass QTL 2 4.42 0.86 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 76539322 202447032 Rat 2300189 Bmd48 Bone mineral density QTL 48 5.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 2 179335906 224335906 Rat 8662843 Vetf9 Vascular elastic tissue fragility QTL 9 2.05 thoracic aorta molecular composition trait (VT:0010568) aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003) 2 157142078 226277316 Rat 631501 Bp101 Blood pressure QTL 101 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150341684 202446871 Rat 2307174 Activ3 Activity QTL 3 4.83 0.000058 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 2 168594495 213594495 Rat 1331794 Bp202 Blood pressure QTL 202 3.66819 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 141194931 223265385 Rat 71113 Cari2 Carrageenan-induced inflammation QTL 2 2.7 0.009 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 2 141596551 202447032 Rat 1331805 Cm29 Cardiac mass QTL 29 3.50746 heart mass (VT:0007028) heart wet weight (CMO:0000069) 2 141194931 223265385 Rat 634308 Sach6 Saccharin preference QTL 6 4.9 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 2 112456140 212696837 Rat 1598805 Memor8 Memory QTL 8 3 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 2 150341585 189039377 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 724568 Uae13 Urinary albumin excretion QTL 13 4.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 2 143157029 210020885 Rat 7488929 Bp366 Blood pressure QTL 366 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 184974550 193094998 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300165 Rf9 Renal function QTL 9 3.28 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 2 133914684 202447032 Rat 738013 Alc15 Alcohol consumption QTL 15 4.1 0.00022 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 2 184165752 229165752 Rat 61401 Niddm2 Non-insulin dependent diabetes mellitus QTL 2 4.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 144599348 189599348 Rat 631507 Bp105 Blood pressure QTL 105 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 112456140 212696837 Rat 1641925 Alcrsp2 Alcohol response QTL 2 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 221167075 Rat 1354609 Niddm62 Non-insulin dependent diabetes mellitus QTL 62 4.72 0.000006 insulin secretion trait (VT:0003564) plasma insulin level (CMO:0000342) 2 150540301 202447032 Rat 1598833 Bp295 Blood pressure QTL 295 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 147798556 192798556 Rat 61417 Cia10 Collagen induced arthritis QTL 10 3.4 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 2 179946951 224946951 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 631266 Bp132 Blood pressure QTL 132 0.0005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 46123260 202447032 Rat 8694383 Bw158 Body weight QTL 158 7.69 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 2 182171407 227171407 Rat 7488927 Bp365 Blood pressure QTL 365 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 162765032 207765032 Rat 1598838 Bp290 Blood pressure QTL 290 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 166539266 211539266 Rat 7488925 Bp364 Blood pressure QTL 364 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 160564068 205564068 Rat 2306901 Bp337 Blood pressure QTL 337 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 164073756 227146641 Rat 1354605 Rf48 Renal function QTL 48 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 2 74786664 206665859 Rat 2293084 Iddm26 Insulin dependent diabetes mellitus QTL 26 2.9 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 174930955 213594495 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000063783 ⟹ ENSRNOP00000062137
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 185,257,213 - 185,269,872 (+) Ensembl Rnor_6.0 Ensembl 2 199,831,990 - 199,844,649 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000086588 ⟹ ENSRNOP00000069519
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 2 199,832,023 - 199,847,629 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000099010 ⟹ ENSRNOP00000086904
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 185,257,632 - 185,269,817 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000102819 ⟹ ENSRNOP00000090150
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 185,257,354 - 185,264,831 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000108265 ⟹ ENSRNOP00000078691
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 185,257,287 - 185,269,817 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000113165 ⟹ ENSRNOP00000093894
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 185,257,213 - 185,264,329 (+) Ensembl
RefSeq Acc Id:
NM_022627 ⟹ NP_072149
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 187,946,401 - 187,958,595 (+) NCBI mRatBN7.2 2 185,257,632 - 185,269,826 (+) NCBI Rnor_6.0 2 199,832,409 - 199,844,603 (+) NCBI Rnor_5.0 2 219,309,807 - 219,325,389 (+) NCBI RGSC_v3.4 2 192,498,430 - 192,510,624 (+) RGD Celera 2 177,749,772 - 177,761,966 (+) RGD
Sequence:
TGCAGCCATGGGAAACACCACCAGTGAGCGGGTGTCCGGGGAGCGCCACGGTGCCAAGGCTGCTCGAGCTGAGGGTGGCGGCCATGGCCCCGGCAAGGAGCACAAGATCATGGTGGGAAGCACCGACG
hide sequence
RefSeq Acc Id:
XM_006233011 ⟹ XP_006233073
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 187,946,009 - 187,961,615 (+) NCBI mRatBN7.2 2 185,257,235 - 185,272,846 (+) NCBI Rnor_6.0 2 199,831,990 - 199,847,623 (+) NCBI Rnor_5.0 2 219,309,807 - 219,325,389 (+) NCBI
Sequence:
GGCCTTGTGGGCGGGGCCAGAGGCAGAGGCGGTACCGCGTCGCCGGCCTTGTAGCCATTTTAGGAGGAAACCCGGTTCGCTGGCTTGGGGCGCGGCTTCAATTTCAATAACTTTATTGGTCTCCTTGT
hide sequence
RefSeq Acc Id:
XM_006233012 ⟹ XP_006233074
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 187,946,151 - 187,961,615 (+) NCBI mRatBN7.2 2 185,257,382 - 185,272,846 (+) NCBI Rnor_6.0 2 199,832,180 - 199,847,623 (+) NCBI Rnor_5.0 2 219,309,807 - 219,325,389 (+) NCBI
Sequence:
GCGTGGGGGTGTGCGGGACCCGGGCTGTGGGGCAGCGAGGGCTCCTGGAGCCGGTTCTCCGAGCTTAGGCGTCCGTGAAGCGGGTTGCCCCGGACTCGAGCTGCAGCCATGGGAAACACCACCAGTGA
hide sequence
RefSeq Acc Id:
XM_039103078 ⟹ XP_038959006
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 187,946,424 - 187,961,615 (+) NCBI mRatBN7.2 2 185,257,654 - 185,272,846 (+) NCBI
RefSeq Acc Id:
XM_039103079 ⟹ XP_038959007
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 187,946,008 - 187,961,615 (+) NCBI mRatBN7.2 2 185,257,235 - 185,272,846 (+) NCBI
RefSeq Acc Id:
XM_039103080 ⟹ XP_038959008
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 187,946,157 - 187,961,615 (+) NCBI mRatBN7.2 2 185,257,388 - 185,272,846 (+) NCBI
RefSeq Acc Id:
XR_005500366
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 187,946,008 - 187,957,642 (+) NCBI mRatBN7.2 2 185,257,218 - 185,272,846 (+) NCBI
RefSeq Acc Id:
NP_072149 ⟸ NM_022627
- UniProtKB:
Q9QZH4 (UniProtKB/Swiss-Prot)
- Sequence:
MGNTTSERVSGERHGAKAARAEGGGHGPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVPWQQDLDDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFV
hide sequence
RefSeq Acc Id:
XP_006233073 ⟸ XM_006233011
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2JVK3 (UniProtKB/TrEMBL), A6K3B7 (UniProtKB/TrEMBL)
- Sequence:
MGNTTSERVSGERHGAKAARAEGGGHGPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVPWQQD
hide sequence
RefSeq Acc Id:
XP_006233074 ⟸ XM_006233012
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2JVK3 (UniProtKB/TrEMBL), A6K3B7 (UniProtKB/TrEMBL)
- Sequence:
MGNTTSERVSGERHGAKAARAEGGGHGPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVPWQQDLDDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFV
hide sequence
Ensembl Acc Id:
ENSRNOP00000062137 ⟸ ENSRNOT00000063783
Ensembl Acc Id:
ENSRNOP00000069519 ⟸ ENSRNOT00000086588
RefSeq Acc Id:
XP_038959007 ⟸ XM_039103079
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I5ZLG3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038959008 ⟸ XM_039103080
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I5ZLG3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038959006 ⟸ XM_039103078
- Peptide Label:
isoform X2
Ensembl Acc Id:
ENSRNOP00000086904 ⟸ ENSRNOT00000099010
Ensembl Acc Id:
ENSRNOP00000078691 ⟸ ENSRNOT00000108265
Ensembl Acc Id:
ENSRNOP00000090150 ⟸ ENSRNOT00000102819
Ensembl Acc Id:
ENSRNOP00000093894 ⟸ ENSRNOT00000113165
RGD ID: 13691597 Promoter ID: EPDNEW_R2122 Type: single initiation site Name: Prkab2_1 Description: protein kinase AMP-activated non-catalytic subunit beta 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R2123 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 199,832,116 - 199,832,176 EPDNEW
RGD ID: 13691598 Promoter ID: EPDNEW_R2123 Type: multiple initiation site Name: Prkab2_2 Description: protein kinase AMP-activated non-catalytic subunit beta 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R2122 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 199,832,401 - 199,832,461 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-03
Prkab2
protein kinase AMP-activated non-catalytic subunit beta 2
Prkab2
protein kinase, AMP-activated, beta 2 non-catalytic subunit
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Prkab2
protein kinase, AMP-activated, beta 2 non-catalytic subunit
AMP-activated protein kinase beta-2 regulatory subunit
Name updated
1299863 APPROVED
2002-08-07
Prkab2
AMP-activated protein kinase beta-2 regulatory subunit
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_expression
expressed in skeletal muscle
631899
gene_product
member of the AMP-activated protein kinase (AMPK) isoenzyme family
gene_regulation
Ser-182 is only partially phosphorylated in skeletal muscle
