Advanced Search (OLGA)

Gene: Dhh (desert hedgehog signaling molecule) Rattus norvegicus

Analyze

Symbol:

Dhh

Name:

desert hedgehog signaling molecule

RGD ID:

620711

Description:

Predicted to enable calcium ion binding activity; patched binding activity; and zinc ion binding activity. Involved in several processes, including response to estradiol; response to estrogen; and spermatid development. Predicted to be located in plasma membrane. Predicted to be active in extracellular space. Human ortholog(s) of this gene implicated in 46,XY complete gonadal dysgenesis; 46,XY gonadal dysgenesis with minifascicular neuropathy; and 46,XY sex reversal 7. Orthologous to human DHH (desert hedgehog signaling molecule); PARTICIPATES IN altered Hedgehog signaling pathway; Hedgehog signaling pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,3-bis(4-hydroxyphenyl)propionitrile.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

desert hedgehog; desert hedgehog homolog (Drosophila); desert hedgehog protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DHH (desert hedgehog signaling molecule)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, Panther
Mus musculus (house mouse):	Dhh (desert hedgehog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DHH (desert hedgehog signaling molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DHH (desert hedgehog signaling molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Dhh (desert hedgehog signaling molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DHH (desert hedgehog signaling molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DHH (desert hedgehog signaling molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Dhh (desert hedgehog signaling molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Dhh (desert hedgehog signaling molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	DHH (desert hedgehog signaling molecule)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Dhh (desert hedgehog)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	dhh (desert hedgehog signaling molecule)	Alliance	DIOPT (OrthoFinder\|PhylomeDB)
Drosophila melanogaster (fruit fly):	hh	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	hh	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	grd-2	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|SonicParanoid)
Caenorhabditis elegans (roundworm):	grd-1	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|SonicParanoid)
Caenorhabditis elegans (roundworm):	grd-11	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|SonicParanoid)
Caenorhabditis elegans (roundworm):	wrt-6	Alliance	DIOPT (Ensembl Compara\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	wrt-4	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector)
Xenopus tropicalis (tropical clawed frog):	dhh	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	wrt-7	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PhylomeDB)
Caenorhabditis elegans (roundworm):	hog-1	Alliance	DIOPT (OrthoFinder\|OrthoInspector\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	131,929,857 - 131,935,352 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	131,929,857 - 131,935,352 (-)	Ensembl				GRCr8
mRatBN7.2	7	130,050,910 - 130,056,406 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	130,050,910 - 130,056,406 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	131,856,301 - 131,861,803 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	134,081,862 - 134,087,365 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	133,994,372 - 133,999,875 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	140,575,288 - 140,580,783 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	140,575,288 - 140,580,783 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	X	115,082,778 - 115,088,273 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	137,666,984 - 137,672,479 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	126,535,827 - 126,541,767 (-)	NCBI		Celera
RGSC_v3.1	7	137,745,431 - 137,748,567 (-)	NCBI
Cytogenetic Map	7	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

46,XY complete gonadal dysgenesis (ISO,ISS)

46,XY gonadal dysgenesis with minifascicular neuropathy (ISO)

46,XY sex reversal 7 (ISO)

disorder of sexual development (ISO)

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17alpha-ethynylestradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3-bis(4-hydroxyphenyl)propionitrile (EXP)

3,3',4,4',5-pentachlorobiphenyl (EXP)

4,4'-sulfonyldiphenol (EXP,ISO)

6-propyl-2-thiouracil (EXP)

aldehydo-D-glucose (ISO)

all-trans-retinol (EXP)

alpha-Zearalanol (EXP)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

bisphenol AF (EXP)

bisphenol F (EXP)

carbon nanotube (ISO)

chlorpyrifos (ISO)

clofibrate (ISO)

cocaine (EXP)

copper atom (EXP)

copper(0) (EXP)

cypermethrin (EXP)

D-glucose (ISO)

Di-n-hexyl phthalate (EXP)

diazinon (ISO)

dibenz[a,h]anthracene (ISO)

dibutyl phthalate (ISO)

dioxygen (ISO)

fenvalerate (EXP)

fulvestrant (EXP)

genistein (ISO)

glucose (ISO)

indole-3-methanol (EXP)

N-acetyl-L-cysteine (EXP)

N-nitrosodiethylamine (EXP)

paracetamol (ISO)

paraquat (EXP)

perfluorododecanoic acid (EXP)

perfluorooctanoic acid (EXP)

perfluoroundecanoic acid (EXP)

sodium arsenite (ISO)

titanium dioxide (ISO)

triphenylstannane (EXP)

triptonide (ISO)

valproic acid (EXP)

vinclozolin (EXP)

ziram (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell fate specification (IBA)

cell-cell signaling (IEA)

developmental process involved in reproduction (IEA)

intein-mediated protein splicing (IEA)

Leydig cell differentiation (ISO)

male sex determination (ISO)

multicellular organism development (IEP)

myelination (IEP,NAS)

osteoblast differentiation (ISO)

positive regulation of smoothened signaling pathway (IEA,ISO)

protein autoprocessing (IEA)

proteolysis (IEA)

regulation of gene expression (IBA)

regulation of steroid biosynthetic process (ISO)

response to estradiol (IEP)

response to estrogen (IEP)

smoothened signaling pathway (IBA,ISO,TAS)

spermatid development (IEP,ISO)

system development (IEA)

Cellular Component

endoplasmic reticulum (IEA)

endoplasmic reticulum membrane (IEA)

extracellular region (IEA)

extracellular space (IBA)

Golgi apparatus (IEA)

Golgi membrane (IEA)

plasma membrane (IEA,ISO)

Molecular Function

calcium ion binding (IBA,IEA,ISO)

hydrolase activity (IEA)

metal ion binding (IEA)

patched binding (IBA,IEA,ISO)

peptidase activity (IEA)

protein binding (ISO)

transferase activity (IEA)

zinc ion binding (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

altered Hedgehog signaling pathway (IMP)

Hedgehog signaling pathway (IEA,IMP,ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal adult Leydig cell differentiation (IMP)

abnormal fetal Leydig cell differentiation (IMP)

decreased circulating testosterone level (IMP)

male pseudohermaphroditism (IMP)

References

References - curated

#	Reference Title	Reference Citation
1.	Interactions between Hedgehog proteins and their binding partners come into view.	Beachy PA, etal., Genes Dev. 2010 Sep 15;24(18):2001-12.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	The expression of Hedgehog genes (Ihh, Dhh) and Hedgehog target genes (Ptc1, Gli1, Coup-TfII) is affected by estrogenic stimuli in the uterus of immature female rats.	Katayama S, etal., Toxicol Appl Pharmacol. 2006 Dec 15;217(3):375-83. Epub 2006 Oct 6.
4.	A missense mutation of the Dhh gene is associated with male pseudohermaphroditic rats showing impaired Leydig cell development.	Kawai Y, etal., Reproduction. 2011 Feb;141(2):217-25. doi: 10.1530/REP-10-0006. Epub 2010 Nov 9.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Frequent deregulations in the hedgehog signaling network and cross-talks with the epidermal growth factor receptor pathway involved in cancer progression and targeted therapies.	Mimeault M and Batra SK, Pharmacol Rev. 2010 Sep;62(3):497-524.
7.	Hedgehog signalling promotes germ cell survival in the rat testis.	Mäkelä JA, etal., Reproduction. 2011 Nov;142(5):711-21. doi: 10.1530/REP-11-0110. Epub 2011 Sep 5.
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
10.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
11.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
12.	GOA pipeline	RGD automated data pipeline
13.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
15.	Comprehensive gene review and curation	RGD comprehensive gene curation
16.	SCIP/Oct-6, Krox-20, and desert hedgehog mRNA expression during CNS remyelination by transplanted olfactory ensheathing cells.	Smith PM, etal., Glia 2001 Dec;36(3):342-53.
17.	Hedgehog signaling regulation of insulin production by pancreatic beta-cells.	Thomas MK, etal., Diabetes 2000 Dec;49(12):2039-47.
18.	A novel mutation of desert hedgehog in a patient with 46,XY partial gonadal dysgenesis accompanied by minifascicular neuropathy.	Umehara F, etal., Am J Hum Genet. 2000 Nov;67(5):1302-5. Epub 2000 Oct 2.

Additional References at PubMed

PMID:1302240	PMID:9811851	PMID:12050120	PMID:15645142	PMID:17495005	PMID:18612197	PMID:18772241	PMID:19561611	PMID:25639508	PMID:30266964	PMID:31949236

Genomics

Comparative Map Data

Dhh
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	131,929,857 - 131,935,352 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	131,929,857 - 131,935,352 (-)	Ensembl				GRCr8
mRatBN7.2	7	130,050,910 - 130,056,406 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	130,050,910 - 130,056,406 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	131,856,301 - 131,861,803 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	134,081,862 - 134,087,365 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	133,994,372 - 133,999,875 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	140,575,288 - 140,580,783 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	140,575,288 - 140,580,783 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	X	115,082,778 - 115,088,273 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	137,666,984 - 137,672,479 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	126,535,827 - 126,541,767 (-)	NCBI		Celera
RGSC_v3.1	7	137,745,431 - 137,748,567 (-)	NCBI
Cytogenetic Map	7	q36	NCBI

DHH
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	49,086,656 - 49,094,801 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	49,086,656 - 49,094,801 (-)	Ensembl			hg38	GRCh38
GRCh37	12	49,480,439 - 49,488,584 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	47,769,471 - 47,774,869 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	12	47,769,474 - 47,774,869	NCBI
Celera	12	48,277,990 - 48,283,388 (-)	NCBI		Celera
Cytogenetic Map	12	q13.12	NCBI
HuRef	12	46,514,270 - 46,519,672 (-)	NCBI		HuRef
CHM1_1	12	49,448,515 - 49,453,913 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	49,048,829 - 49,056,982 (-)	NCBI		T2T-CHM13v2.0

Dhh
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	98,779,496 - 98,796,443 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	98,789,033 - 98,796,421 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	15	98,881,615 - 98,898,562 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	98,891,152 - 98,898,540 (-)	Ensembl			mm10	GRCm38
MGSCv37	15	98,723,458 - 98,728,971 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	15	98,721,065 - 98,726,574 (-)	NCBI		MGSCv36	mm8
Celera	15	101,042,606 - 101,048,119 (-)	NCBI		Celera
Cytogenetic Map	15	F1	NCBI
cM Map	15	55.05	NCBI

DHH
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	45,090,380 - 45,103,870 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	45,087,141 - 45,100,567 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	39,656,046 - 39,661,439 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	40,535,740 - 40,541,123 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	40,535,740 - 40,541,123 (+)	Ensembl			panPan2	panpan1.1

DHH
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	27	5,490,122 - 5,497,144 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	27	5,490,441 - 5,494,636 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	27	40,762,495 - 40,767,370 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	27	5,541,256 - 5,548,205 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	27	5,541,556 - 5,545,696 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	27	5,505,500 - 5,512,442 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	27	5,495,207 - 5,502,154 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	27	41,155,104 - 41,159,982 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Dhh
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	66,274,789 - 66,283,532 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936512	6,885,607 - 6,889,992 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936512	6,885,607 - 6,889,955 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DHH
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	15,114,527 - 15,119,577 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	5	15,114,524 - 15,119,610 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	15,473,443 - 15,478,529 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DHH
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	45,330,593 - 45,336,958 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666037	200,804,838 - 200,811,230 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Dhh
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624816	3,095,849 - 3,104,228 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624816	3,096,137 - 3,100,882 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Dhh
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	271,719,745 - 271,724,190 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Dhh
20 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	264
Count of miRNA genes:	181
Interacting mature miRNAs:	217
Transcripts:	ENSRNOT00000020563
Prediction methods:	Miranda, Pita, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631529	Tls2	T-lymphoma susceptibility QTL 2	0	0.001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	7	82111382	132099989	Rat
1354582	Stl11	Serum triglyceride level QTL 11	3.42		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	121393075	137014596	Rat
731176	Glom5	Glomerulus QTL 5	2.5	0.0035	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	7	98549867	137014596	Rat
1300112	Bp183	Blood pressure QTL 183	3.51		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	119280025	135560836	Rat
1331731	Bp216	Blood pressure QTL 216	2.851		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	104186212	135371468	Rat
1331748	Bp215	Blood pressure QTL 215	4.043		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	110725024	135371468	Rat
61428	Scl3	Serum cholesterol level QTL 3	3.2		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	7	100548246	137014596	Rat
61397	Bw17	Body weight QTL 17	6.3		body mass (VT:0001259)	body weight (CMO:0000012)	7	95485047	137014596	Rat
1331746	Kidm9	Kidney mass QTL 9	3.934		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	7	82111245	134948181	Rat
1358914	Bp266	Blood pressure QTL 266			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	115313999	136544683	Rat
2299163	Iddm34	Insulin dependent diabetes mellitus QTL 34	2.71		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	7	116269196	132020414	Rat
1549899	Stresp8	Stress response QTL 8	4.37	0.0008	stress-related behavior trait (VT:0010451)	defensive burying duration (CMO:0001961)	7	92362341	137014596	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	71827901	136544683	Rat

Markers in Region

Dhh

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	7	131,930,884 - 131,931,000 (+)	Marker Load Pipeline
mRatBN7.2	7	130,051,936 - 130,052,053 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	140,576,315 - 140,576,431	NCBI	Rnor6.0
Rnor_5.0	X	115,083,805 - 115,083,921	UniSTS	Rnor5.0
RGSC_v3.4	7	137,668,011 - 137,668,127	UniSTS	RGSC3.4
Celera	7	126,537,300 - 126,537,416	UniSTS
Cytogenetic Map	7	q36	UniSTS

AW529714

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	130,050,963 - 130,051,116 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	140,575,342 - 140,575,494	NCBI	Rnor6.0
Rnor_5.0	X	115,082,832 - 115,082,984	UniSTS	Rnor5.0
RGSC_v3.4	7	137,667,038 - 137,667,190	UniSTS	RGSC3.4
Celera	7	126,535,881 - 126,536,033	UniSTS
RH 3.4 Map	7	1076.9	UniSTS
Cytogenetic Map	7	q36	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
15	12	67	152	90	89	58	78	58	6	338	178	11	131	79	92	31	13	13

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053367	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC114446	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF148226	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474035	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000087327 ⟹ ENSRNOP00000074600

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	131,929,857 - 131,935,352 (-)	Ensembl
mRatBN7.2 Ensembl	7	130,050,910 - 130,056,406 (-)	Ensembl
Rnor_6.0 Ensembl	7	140,575,288 - 140,580,783 (-)	Ensembl

RefSeq Acc Id:

NM_053367 ⟹ NP_445819

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	131,929,857 - 131,935,352 (-)	NCBI
mRatBN7.2	7	130,050,910 - 130,056,406 (-)	NCBI
Rnor_6.0	7	140,575,288 - 140,580,783 (-)	NCBI
Rnor_5.0	X	115,082,778 - 115,088,273 (-)	NCBI
RGSC_v3.4	7	137,666,984 - 137,672,479 (-)	RGD
Celera	7	126,535,827 - 126,541,767 (-)	RGD

Sequence:

show sequence

AAGGCGGAGTCAGGGCGTTTCTGGGAGCACCGGAGCTGGGCAGCAGAAACCGCCTGGGCTGGCA
CTCACCCTCGACCCACCTGCCCTGTAATGGTAGTCTATCAGTAGTAGGTTCCAGGTTCCCCAGG
GCATGTAGGCAGAGTTAGCGGCTGCCAAGTGGTCAGAGCCACAGCGCTCCAGGTACTCTGGGAC
TTTCTCTATCTGCAGTGCTCTCTAGCTCCTGCGGAGATGCCAAACTGACAGGAGAGCCAGTAAG
GACAAGAACGCTCCCTTTCGACCCAAGTCCACTGCACCCATGGCTCTGCCAGCCAGTCTGTTGC
CCCTGTGCTGCTTGGCACTCCTGGCACTATCTGTCCAGAGCTGCGGGCCAGGCCGAGGACCGGT
TGGCCGGCGGCGTTACGTGCGCAAGCAACTTGTGCCTCTGCTCTACAAGCAGTTTGTGCCTAGT
ATGCCCGAGCGGACCCTTGGCGCGAGTGGGCCAGCGGAGGGGAGGGTAACAAGGGGGTCGGAGC
GCTTCCGGGACCTCGTCCCCAACTACAACCCCGACATAATCTTCAAGGATGAGGAGAACAGCGG
CGCTGACCGCCTGATGACAGAGCGTTGCAAAGAGCGGGTGAATGCTCTAGCCATCGCGGTGATG
AACATGTGGCCCGGAGTACGCCTACGCGTGACTGAAGGTTGGGACGAGGATGGCCACCACGCAC
AGGACTCACTGCACTACGAAGGCCGTGCCCTGGACATCACCACGTCTGACCGTGACCGTAATAA
GTATGGTTTGTTGGCGCGCCTAGCAGTGGAAGCCGGATTCGACTGGGTCTACTACGAGTCCCGC
AACCACATCCACGTGTCGGTCAAAGCTGATAACTCATTGGCGGTCCGAGCCGGAGGCTGCTTTC
CGGGAAATGCCACGGTGCGCTTGCGGAGCGGCGAACGGAAGGGGCTGAGGGAACTCCATCGTGG
TGACTGGGTACTGGCCGCTGATGCAGCGGGCCGAGTGGTACCCACGCCGGTGCTGCTCTTCCTG
GACCGGGACCTGCAGCGCCGCGCCTCGTTCGTGGCTGTGGAGACCGAGCGGCCACCGCGCAAAC
TGTTGCTCACACCCTGGCATCTGGTGTTCGCCGCTCGGGGGCCAGCGCCTGCTCCAGGTGACTT
TGCACCGGTGTTCGCGCGCCGCTTACGCGCTGGGGACTCGGTACTGGCTCCCGGCGGGGACGCG
CTCCGGCCTGCGCGCGTAGCCCGCGTGGCGCGCGAGGAAGCCGTGGGCGTGTTCGCACCGCTCA
CGGCTCACGGGACGCTGCTGGTCAACGACGTCCTCGCCTCCTGCTACGCGGTTCTAGAGAGTCA
CCAGTGGGCCCACCGCGCCTTTGCTCCTTTGCGTTTGCTGCACGCGCTCGGGGCGCTGCTCCCC
GGGGGTGCAGTCCAGCCGACTGGCATGCATTGGTACTCGCGCCTCCTTTACCGCTTGGCGGAGG
AGTTAATGGGTTGAGCTTCCAAGGACAGAGGTCCACCAGGCTTTGCAAGAAACCGAAGGCCCCG
AGACCTGCTAGCTGAGATCTGAAGATGTGGGCAGCAGGTGGGAGAGAGGGCGGCGGGAAAGAGA
GAGAAAAAAAGGTGGGCTGTGGTTTAGGCAATCTGAGAGGAGTGGTACCTGGTCCTTGATAACT
GGGTTTTGCTGGTAGGCACTCTTTTTTTTTTTTTTTTTTTTTTTTTTTGGAGCTGGGGACCGAA
CCCAGGGCCTTGCGCTTCCTAGGCAAGCGCTCTACCACTGAGCTAAATCCCAACCCCTGGTAGG
CACTCTTTAAGGAGGACTTTTTTGCGGTTTCCCCAGTCGCACGGATAATTTTATTTCCTATTTA
TAATTTGTAATATGATGATGCGCTTGCTCAGCCCACCAAGGTGAGGACCTGGAGTGTGGCTTTA
ACACTGTCTGACCCAGCCAGTCAGCCTGACAGCTCACACTTTCACTTTCTCCTCCTCAGGTGGG
TTAATAAAGGGAAGGCTTATTGGAAAACACCTTCACTTGGGTGATTCACCTCCAAAGAGGAGGA
GAACTAGGACTAATCGAGTCCACACCTTGCTTCCAGCTCGCCCTTCTTCCTCAGCAGGATCTTC
CAAACCCTCTTGCTGAAAAGGGTGCCCCAATCTGTCAGGAATGGACCAGAAATATCCTGTCCTT
TTTAAGGTACTGGTTCCACTACTAGCCGGGACCAGAACTTTGCTTATGAGGATGTGTACCAACT
TTGAGTGGGGTGGGACTTACCAAGGGAGCACGAAGATTGATGCTCGACCCATTTGGAGTTTTCT
ATTGTTAGCTATTGTGACCTAACCCTGTAGACTGGATCAGCCCAGCAGTCATCCTGCCTGCTGA
AGTGGTCTGATTTTTATCCTGGGATTTTGTTAGGCCAACTGATGAACCATGGGTGTTCCTTACA
GTTCACCACACATTCGTGGCCAAAATAAAGATCCTAGAGTGAGCAGG

hide sequence

Protein Sequences


Protein RefSeqs	NP_445819	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAD31927	(Get FASTA)	NCBI Sequence Viewer
	EDL87018	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000074600
	ENSRNOP00000074600.1

RefSeq Acc Id:	NP_445819 ⟸ NM_053367
- Peptide Label:	precursor
- UniProtKB:	G3V7Y0 (UniProtKB/TrEMBL), A6KCC4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MALPASLLPLCCLALLALSVQSCGPGRGPVGRRRYVRKQLVPLLYKQFVPSMPERTLGASGPAE GRVTRGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEG WDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHIHVSVKADNSL AVRAGGCFPGNATVRLRSGERKGLRELHRGDWVLAADAAGRVVPTPVLLFLDRDLQRRASFVAV ETERPPRKLLLTPWHLVFAARGPAPAPGDFAPVFARRLRAGDSVLAPGGDALRPARVARVAREE AVGVFAPLTAHGTLLVNDVLASCYAVLESHQWAHRAFAPLRLLHALGALLPGGAVQPTGMHWYS RLLYRLAEELMG hide sequence

Ensembl Acc Id:

ENSRNOP00000074600 ⟸ ENSRNOT00000087327

Protein Domains

Hedgehog N-terminal signalling Hint

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-G3V7Y0-F1-model_v2	AlphaFold	G3V7Y0	1-396	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620711	AgrOrtholog
BioCyc Gene	G2FUF-32106	BioCyc
Ensembl Genes	ENSRNOG00000053675	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000087327	ENTREZGENE
	ENSRNOT00000087327.3	UniProtKB/TrEMBL
Gene3D-CATH	3.30.1380.10	UniProtKB/TrEMBL
	Hedgehog/Intein (Hint) domain	UniProtKB/TrEMBL
InterPro	Hedgehog/DD-peptidase	UniProtKB/TrEMBL
	Hedgehog_Signaling	UniProtKB/TrEMBL
	Hedgehog_signaling_dom	UniProtKB/TrEMBL
	Hint_dom	UniProtKB/TrEMBL
	Hint_dom_C	UniProtKB/TrEMBL
	Hint_dom_N	UniProtKB/TrEMBL
	Hint_dom_sf	UniProtKB/TrEMBL
	Intein_splice_site	UniProtKB/TrEMBL
	Peptidase_C46	UniProtKB/TrEMBL
KEGG Report	rno:84380	UniProtKB/TrEMBL
NCBI Gene	84380	ENTREZGENE
PANTHER	DESERT HEDGEHOG PROTEIN	UniProtKB/TrEMBL
	HEDGEHOG	UniProtKB/TrEMBL
Pfam	HH_signal	UniProtKB/TrEMBL
	Hint	UniProtKB/TrEMBL
PhenoGen	Dhh	PhenoGen
PIRSF	Peptidase_C46	UniProtKB/TrEMBL
PRINTS	SONICHHOG	UniProtKB/TrEMBL
PROSITE	INTEIN_N_TER	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000053675	RatGTEx
SMART	HintC	UniProtKB/TrEMBL
	HintN	UniProtKB/TrEMBL
Superfamily-SCOP	Hedgehog_sig_N	UniProtKB/TrEMBL
	SSF51294	UniProtKB/TrEMBL
UniProt	A6KCC4	ENTREZGENE, UniProtKB/TrEMBL
	G3V7Y0	ENTREZGENE, UniProtKB/TrEMBL
	Q9WUP6_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-12-04	Dhh	desert hedgehog signaling molecule	Dhh	desert hedgehog	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-08-02	Dhh	desert hedgehog	Dhh	desert hedgehog homolog (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-26	Dhh	desert hedgehog homolog (Drosophila)	Dhh	desert hedgehog	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-22	Dhh	desert hedgehog	Dhh	desert hedgehog homolog (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Dhh	desert hedgehog homolog (Drosophila)		desert hedgehog protein	Name updated	1299863	APPROVED
2002-08-07	Dhh	desert hedgehog protein			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in pancreas and the clonal gamma-cell line INS-1	634737

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Mammalian Phenotype