Advanced Search (OLGA)

Gene: Agps (alkylglycerone phosphate synthase) Rattus norvegicus

Analyze

Symbol:

Agps

Name:

alkylglycerone phosphate synthase

RGD ID:

620364

Description:

Enables alkylglycerone-phosphate synthase activity. Predicted to be involved in ether lipid biosynthetic process. Located in peroxisome. Human ortholog(s) of this gene implicated in rhizomelic chondrodysplasia punctata and rhizomelic chondrodysplasia punctata type 3. Orthologous to human AGPS (alkylglycerone phosphate synthase); PARTICIPATES IN plasmalogen biosynthetic pathway; plasmalogen metabolic pathway; ether lipid metabolic pathway; INTERACTS WITH (+)-schisandrin B; 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Adap-s; Adps; Ads; alkyl-DHAP synthase; alkyl-dihydroxyacetonephosphate synthase; alkyl-dihydroxyacetonephosphate synthase precursor; alkyldihydroxyacetone phosphate synthase; alkyldihydroxyacetonephosphate synthase, peroxisomal; alkylglycerone phosphate synthase-like; alkylglycerone-phosphate synthase; LOC100360503

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	AGPS (alkylglycerone phosphate synthase)	RGD	RGD
Mus musculus (house mouse):	Agps (alkylglycerone phosphate synthase)	RGD	RGD
Chinchilla lanigera (long-tailed chinchilla):	Agps (alkylglycerone phosphate synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	AGPS (alkylglycerone phosphate synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	AGPS (alkylglycerone phosphate synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Agps (alkylglycerone phosphate synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	AGPS (alkylglycerone phosphate synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	AGPS (alkylglycerone phosphate synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Agps (alkylglycerone phosphate synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Agps (alkylglycerone phosphate synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	AGPS (alkylglycerone phosphate synthase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Agps (alkylglycerone phosphate synthase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	agps (alkylglycerone phosphate synthase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	ADPS	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ads-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	agps	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	agps	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	81,154,599 - 81,253,099 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	81,154,604 - 81,258,277 (+)	Ensembl				GRCr8
mRatBN7.2	3	60,747,323 - 60,845,831 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	60,747,323 - 60,845,830 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	64,120,994 - 64,219,055 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	72,704,658 - 72,802,714 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	70,471,616 - 70,569,962 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	62,648,352 - 62,749,250 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	62,648,447 - 62,749,153 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	69,193,349 - 69,296,169 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	3	60,248,210 - 60,345,456 (+)	NCBI		Celera
RGSC_v3.1	3	58,425,040 - 58,444,100 (+)	NCBI
Cytogenetic Map	3	q23	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Desbuquois dysplasia (ISO)

Experimental Liver Neoplasms (IDA)

Experimental Sarcoma (IDA)

genetic disease (ISO)

rhizomelic chondrodysplasia punctata (ISO)

rhizomelic chondrodysplasia punctata type 3 (ISO,ISS)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(-)-epigallocatechin 3-gallate (ISO)

1,1-dichloroethene (ISO)

17alpha-ethynylestradiol (EXP)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2-methylcholine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amphetamine (EXP)

arsenous acid (ISO)

atrazine (ISO)

benzatropine (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

Butylbenzyl phthalate (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

carnosic acid (ISO)

CGP 52608 (ISO)

chlordecone (ISO)

chlorpyrifos (ISO)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

Cuprizon (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

dicrotophos (ISO)

diquat (ISO)

ethyl methanesulfonate (ISO)

fipronil (EXP)

flavonoids (EXP)

formaldehyde (ISO)

FR900359 (ISO)

furan (EXP)

haloperidol (ISO)

indometacin (EXP,ISO)

ivermectin (ISO)

ketoconazole (ISO)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

nickel atom (ISO)

paracetamol (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

resveratrol (ISO)

Salinomycin (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

tamibarotene (ISO)

temozolomide (ISO)

tetrachloromethane (EXP)

thioacetamide (EXP)

titanium dioxide (ISO)

trimellitic anhydride (ISO)

triphenyl phosphate (ISO)

Triptolide (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

ether lipid biosynthetic process (IEA,ISS)

lipid biosynthetic process (IBA,IEA,ISO)

lipid metabolic process (IEA)

Cellular Component

peroxisomal membrane (IEA)

peroxisome (IBA,IDA,IEA,ISO,TAS)

Molecular Function

alkylglycerone-phosphate synthase activity (IBA,IDA,IEA,ISO)

catalytic activity (IEA)

FAD binding (IEA,ISS)

flavin adenine dinucleotide binding (IEA)

protein binding (ISO)

transferase activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

ether lipid metabolic pathway (IEA)

plasmalogen biosynthetic pathway (ISO)

plasmalogen metabolic pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Alkyl-dihydroxyacetonephosphate synthase. Fate in peroxisome biogenesis disorders and identification of the point mutation underlying a single enzyme deficiency.	de Vet EC, etal., J Biol Chem 1998 Apr 24;273(17):10296-301.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Kinetic studies of alkyl-dihydroxyacetone-phosphate (alkyl-glycerone-phosphate) synthase in peroxisomes of rat liver.	Gunawan J, etal., Biol Chem Hoppe Seyler 1990 Apr;371(4):339-44.
5.	Proteomic analysis of rat liver peroxisome: presence of peroxisome-specific isozyme of Lon protease.	Kikuchi M, etal., J Biol Chem. 2004 Jan 2;279(1):421-8. Epub 2003 Oct 15.
6.	Activities of enzymes involved in the metabolism of ether-linked lipids in normal and neoplastic tissues of rat.	Lee TC, etal., Biochim Biophys Acta. 1980 Aug 11;619(2):420-3.
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
9.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
10.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
11.	GOA pipeline	RGD automated data pipeline
12.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
14.	PPAR gamma activators induce growth arrest and process extension in B12 oligodendrocyte-like cells and terminal differentiation of cultured oligodendrocytes.	Roth AD, etal., J Neurosci Res. 2003 May 15;72(4):425-35.
15.	Dihydroxyacetone phosphate acyltransferase and alkyldihydroxyacetone phosphate synthase activities in rat liver subcellular fractions and human skin fibroblasts.	Singh H, etal., Arch Biochem Biophys. 1989 Feb 1;268(2):676-86.
16.	Ether lipid synthesis: purification and identification of alkyl dihydroxyacetone phosphate synthase from guinea-pig liver.	Zomer AW, etal., Biochim Biophys Acta. 1993 Oct 13;1170(2):189-96. doi: 10.1016/0005-2760(93)90070-p.

Additional References at PubMed

PMID:8889548	PMID:10415121	PMID:11369596	PMID:18614015	PMID:19946888	PMID:20833797	PMID:21525035

Genomics

Comparative Map Data

Agps
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	81,154,599 - 81,253,099 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	81,154,604 - 81,258,277 (+)	Ensembl				GRCr8
mRatBN7.2	3	60,747,323 - 60,845,831 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	60,747,323 - 60,845,830 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	64,120,994 - 64,219,055 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	72,704,658 - 72,802,714 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	70,471,616 - 70,569,962 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	62,648,352 - 62,749,250 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	62,648,447 - 62,749,153 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	69,193,349 - 69,296,169 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	3	60,248,210 - 60,345,456 (+)	NCBI		Celera
RGSC_v3.1	3	58,425,040 - 58,444,100 (+)	NCBI
Cytogenetic Map	3	q23	NCBI

AGPS
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	177,392,773 - 177,543,834 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	177,392,576 - 177,567,024 (+)	Ensembl			hg38	GRCh38
GRCh37	2	178,257,501 - 178,408,562 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	177,965,731 - 178,112,411 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	2	178,083,009 - 178,228,512	NCBI
Celera	2	171,860,003 - 172,011,409 (+)	NCBI		Celera
Cytogenetic Map	2	q31.2	NCBI
HuRef	2	170,128,203 - 170,279,631 (+)	NCBI		HuRef
CHM1_1	2	178,262,812 - 178,413,489 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	177,875,047 - 178,026,109 (+)	NCBI		T2T-CHM13v2.0

Agps
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	75,662,477 - 75,761,694 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	75,662,521 - 75,761,694 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	2	75,832,177 - 75,931,350 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	75,832,177 - 75,931,350 (+)	Ensembl			mm10	GRCm38
MGSCv37	2	75,670,234 - 75,769,407 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	2	75,633,031 - 75,730,489 (+)	NCBI		MGSCv36	mm8
Celera	2	77,493,849 - 77,593,052 (+)	NCBI		Celera
Cytogenetic Map	2	C3	NCBI
cM Map	2	44.77	NCBI

Agps
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955403	19,257,501 - 19,381,901 (-)	Ensembl
ChiLan1.0	NW_004955403	19,253,784 - 19,381,883 (-)	NCBI	ChiLan1.0	ChiLan1.0

AGPS
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	80,058,687 - 80,208,144 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	80,073,679 - 80,223,118 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	64,671,136 - 64,823,956 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	182,375,149 - 182,526,192 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	182,375,149 - 182,520,557 (+)	Ensembl			panPan2	panpan1.1

AGPS
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	36	21,131,616 - 21,264,615 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	36	21,131,641 - 21,329,467 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	36	21,149,863 - 21,284,172 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	36	21,274,757 - 21,409,268 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	36	21,276,105 - 21,474,081 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	36	21,345,042 - 21,479,391 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	36	21,346,803 - 21,481,415 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	36	21,462,141 - 21,596,527 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Agps
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	138,188,897 - 138,319,862 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936509	6,742,673 - 6,868,401 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936509	6,742,800 - 6,872,045 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

AGPS
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	83,146,002 - 83,391,984 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	15	83,146,063 - 83,285,905 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	92,609,561 - 92,727,304 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

AGPS
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	62,943,914 - 63,101,644 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	10	62,946,695 - 63,096,044 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666040	136,479,515 - 136,640,249 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Agps
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624787	14,513,082 - 14,656,632 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624787	14,517,552 - 14,661,138 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Agps
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	5	53,179,426 - 53,279,181 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Agps
556 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	82
Count of miRNA genes:	71
Interacting mature miRNAs:	73
Transcripts:	ENSRNOT00000002111
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300178	Hrtrt4	Heart rate QTL 4	3.74		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	51490129	111359995	Rat
61377	Edpm3	Estrogen-dependent pituitary mass QTL 3	7.05	0.038	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	73592611	110333156	Rat
1358293	Bw38	Body weight QTL 38	6	0.0000031	body mass (VT:0001259)	body weight (CMO:0000012)	3	74364268	119364268	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	73592512	136118980	Rat
1331795	Rf30	Renal function QTL 30	3.708		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	3	59863663	87321459	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	73592512	136118980	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	51581665	184004958	Rat
1354589	Bw31	Body weight QTL 31	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	53651826	98651826	Rat
2303593	Gluco46	Glucose level QTL 46	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	48876619	93876619	Rat
1354590	Despr11	Despair related QTL 11		0.000031	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	3	48876619	93876619	Rat
2298542	Neuinf11	Neuroinflammation QTL 11	3.9		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	3	35403199	97383526	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	67641776	167835660	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	58601291	153936591	Rat
631832	Sach1	Saccharin preference QTL 1	2.7	0.02	consumption behavior trait (VT:0002069)	calculated saccharin drink intake volume (CMO:0001600)	3	47904172	92904172	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	49872657	138829559	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	73592512	136118980	Rat
1331777	Bw24	Body weight QTL 24	3.503		body mass (VT:0001259)	body weight (CMO:0000012)	3	59863663	87321459	Rat
631647	Bp122	Blood pressure QTL 122	6.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	51092561	96092561	Rat
1300169	Bp177	Blood pressure QTL 177	2.96		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	3	36425116	81425116	Rat
9590286	Uminl1	Urine mineral level QTL 1	3.5	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	3	48657744	93657744	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	70845569	136091483	Rat
4889966	Bss95	Bone structure and strength QTL 95	4.4		tibia area (VT:1000281)	tibia-fibula cross-sectional area (CMO:0001718)	3	37796919	82796919	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	79649560	177741895	Rat
2302276	Bw82	Body weight QTL 82	4.32		body mass (VT:0001259)	body weight (CMO:0000012)	3	59863663	83358329	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	67641995	130815812	Rat
738019	Anxrr10	Anxiety related response QTL 10	3.9		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	3	58925062	103925062	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	70311536	115311536	Rat
9590136	Scort3	Serum corticosterone level QTL 3	23.37	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	48657744	93657744	Rat
61419	Cia11	Collagen induced arthritis QTL 11	5.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	3	50766145	95766145	Rat
61356	Bp37	Blood pressure QTL 37	3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	3	51092561	96092561	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	36721849	110333156	Rat
1558650	Cm48	Cardiac mass QTL 48	4	0.0001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	3	50766145	95766145	Rat
8694196	Abfw2	Abdominal fat weight QTL 2	16.58	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	3	48657744	93657744	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	1	141509147	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	42158111	124558371	Rat
1582249	Bw77	Body weight QTL 77	3.2	0.0025	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	73592512	85062403	Rat
2325840	Bp345	Blood pressure QTL 345		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	38708931	83708931	Rat
8552950	Pigfal12	Plasma insulin-like growth factor 1 level QTL 12	7.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	48657744	93657744	Rat
631676	Cm8	Cardiac mass QTL 8	7.03	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	3	37363734	82363734	Rat
8694386	Bw159	Body weight QTL 159	4.52	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	3	48657744	93657744	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	42158111	124558371	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	5675975	141509147	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	67641995	130815812	Rat

Markers in Region

BF403642

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	60,746,079 - 60,746,284 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	62,647,109 - 62,647,313	NCBI	Rnor6.0
Rnor_5.0	3	69,192,106 - 69,192,310	UniSTS	Rnor5.0
RGSC_v3.4	3	58,527,331 - 58,527,535	UniSTS	RGSC3.4
Celera	3	60,246,966 - 60,247,170	UniSTS
Cytogenetic Map	3	q23	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	163	91	90	59	92	59	6	355	192	11	142	80	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053350	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF121052	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF280054	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ238006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BF524961	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BM389725	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000002111 ⟹ ENSRNOP00000002111

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	81,154,604 - 81,258,277 (+)	Ensembl
mRatBN7.2 Ensembl	3	60,747,323 - 60,845,830 (+)	Ensembl
Rnor_6.0 Ensembl	3	62,648,447 - 62,749,153 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000093964 ⟹ ENSRNOP00000095474

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	81,154,604 - 81,258,277 (+)	Ensembl
mRatBN7.2 Ensembl	3	60,763,713 - 60,845,830 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000096806 ⟹ ENSRNOP00000079560

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	81,154,604 - 81,258,277 (+)	Ensembl
mRatBN7.2 Ensembl	3	60,747,323 - 60,845,830 (+)	Ensembl

RefSeq Acc Id:

NM_053350 ⟹ NP_445802

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	81,154,599 - 81,253,099 (+)	NCBI
mRatBN7.2	3	60,747,323 - 60,845,831 (+)	NCBI
Rnor_6.0	3	62,648,352 - 62,749,250 (+)	NCBI
Rnor_5.0	3	69,193,349 - 69,296,169 (+)	NCBI
Celera	3	60,248,210 - 60,345,456 (+)	NCBI

Sequence:

show sequence

GGGATGCGCTGCAGCGAATGGTCGCGCGGGGCGCCGCTCTGAGTGACCTTTCACCCGCGCCCAG
CGGCCTCGGGCGGCAGCACAAGGCGGAAGCCATGGCGGAGGCGGCGGGAGAGGCGGGCGCGAGC
GAGCGGGACCCAGACGCGGTCCGCGCGCGTCGGCGGCTGCGGGTTCTGTCGGGCCATCTGCTGG
GCCGGCCCCAGGAGGCTCCGAGTACCAATGAGTGCAAAGCGCGGAGAGCCGCGTCGGCGGCCGG
GGCGTCGCCCGCTGCTTCTCCCGCCGCGCCGGAGTCGGGCACCATCCCCAAGAAGCGGCAAGAA
CTTATGAAATGGAATGGATGGGGCTATAATGATTCCAAGTTCTTACTGAATAAGAAGGGCCAGG
TTGAGCTGACTGGGAAAAGGTACCCTCTTAGTGGCTTGGCTTTACCAACTTTGAAAGACTGGAT
CCAAAACACCCTTGGAGTAAATCTGGAGCATAAAACTACCTCTAAACCATCCATAAATCCTAGT
GAAGCACCTCCTTCTATTGTGAATGAAGATTTCCTTCAGGAACTTAAAGAAGCTCATATTTCCT
ACTCACAAGACGCAGATGATCGTGTGTTTAGAGCTCACGGTCATTGTCTTCATGAGATATTTTT
GCTCAGAGAAGGGATGTTTGAGCGGATTCCTGATATAGTTGTATGGCCAACATGTCATGATGAT
GTAGTTAAGATTGTGAATCTAGCGTGCAAATATAACCTTTGTATCATACCAATTGGTGGGGGAA
CGAGTGTATCCTATGGCCTGATGTGCCCTGCAGATGAGACAAGAACAATAATTTCTTTGGATAC
TTCACAAATGAACCGGATTCTCTGGGTTGATGAGAACAATCTGACAGCTCACGTAGAGGCTGGG
ATAACAGGACAAGATTTGGAAAGACAGCTTAAAGAAAGTGGTTATTGTACAGGTCATGAACCGG
ACTCCCTAGAATTCAGCATCGTGGGAGGATGGATATCTACTCGAGCATCAGGCATGAAGAAGAA
TGTCTACGGCAATATTGAGGACCTGGTGGTTCACATGAAAATGGTAACACCTAGAGGTGTAATA
GAGAAAAGCTCCCAAGGCCCTCGGATGTCAACGGGGCCTGATATCCATCACTTCATCATGGGCT
CTGAAGGAACTCTTGGTGTAATAACAGAAGCTACAATAAAAATCAGACCAACTCCTGAATACCA
AAAGTATGGTTCAGTGGCTTTCCCTAATTTTGAACAAGGTGTAGCCTGTTTAAGAGAAATTGCA
AAGCAGAGATGTGCTCCTGCATCTATCCGCCTCATGGACAACCAGCAGTTTCAGTTTGGGCATG
CTCTTAAACCTCAGGTCTCCTCTATTTTTACGTCATTTTTGGATGGATTCAAAAAGTTTTATAT
TACAAAGTTTAAAGGATTTGATCCAAATCAAATAAGCGTAGCCACATTACTGTTCGAGGGAGAC
CGTGAGAAGGTTCTTCAGCATGAAAAACAAGTGTATGACATCGCAGCAAAATTTGGTGGTCTGG
CTGCTGGAGAAGATAACGGGCAGAGGGGTTATTTGCTGACTTATGTCATTGCATACATGCGTGA
TTTGGGTTTGGAATACTATGTAGTAGGAGAATCTTTTGAGACTTCTGCTCCTTGGGACAGGGTT
ATAGATCTGTGTAGAAATGTAAAAGAAAGGATAAGAAGGGAATGCAAAGAAAGGGGAGTTCAGT
TTGCGCCTCTTTCTACGTGCAGGGTGACGCAGACTTACGATGCAGGTGCATGTATCTACTTCTA
TTTTGCCTTTAACTACAGGGGAATTAGTGACCCACTGACTGTGTTTGAACAGACTGAGGCAGCT
GCTAGAGATGAAATCCTTGCCAATGGAGGGAGCCTGTCACATCACCATGGAGTGGGCAAGTTAC
GAAAGCAGTGGCTAAAGGAGAGCATCTCTGATGTCGGCTTTGGGATGCTAAAGTCTGTCAAAGA
CTATGTGGACCCCAGTAACATCTTTGGAAACAGAAACCTTTTATAACTCCATTAATATCATTAT
GGAAAATGTTACCTTTTAAAAAGTCATCAGCTATGGTTATACCAGTAATCGAATATATCATGGG
ACTGTATTTCAGCTAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_445802	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAG43235	(Get FASTA)	NCBI Sequence Viewer
	CAB40909	(Get FASTA)	NCBI Sequence Viewer
	EDL79213	(Get FASTA)	NCBI Sequence Viewer
	EDL79214	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000079560
GenBank Protein	Q9EQR2	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_445802 ⟸ NM_053350

- UniProtKB:

A0A8I5ZN98 (UniProtKB/TrEMBL), A6HMG2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MVARGAALSDLSPAPSGLGRQHKAEAMAEAAGEAGASERDPDAVRARRRLRVLSGHLLGRPQEA
PSTNECKARRAASAAGASPAASPAAPESGTIPKKRQELMKWNGWGYNDSKFLLNKKGQVELTGK
RYPLSGLALPTLKDWIQNTLGVNLEHKTTSKPSINPSEAPPSIVNEDFLQELKEAHISYSQDAD
DRVFRAHGHCLHEIFLLREGMFERIPDIVVWPTCHDDVVKIVNLACKYNLCIIPIGGGTSVSYG
LMCPADETRTIISLDTSQMNRILWVDENNLTAHVEAGITGQDLERQLKESGYCTGHEPDSLEFS
IVGGWISTRASGMKKNVYGNIEDLVVHMKMVTPRGVIEKSSQGPRMSTGPDIHHFIMGSEGTLG
VITEATIKIRPTPEYQKYGSVAFPNFEQGVACLREIAKQRCAPASIRLMDNQQFQFGHALKPQV
SSIFTSFLDGFKKFYITKFKGFDPNQISVATLLFEGDREKVLQHEKQVYDIAAKFGGLAAGEDN
GQRGYLLTYVIAYMRDLGLEYYVVGESFETSAPWDRVIDLCRNVKERIRRECKERGVQFAPLST
CRVTQTYDAGACIYFYFAFNYRGISDPLTVFEQTEAAARDEILANGGSLSHHHGVGKLRKQWLK
ESISDVGFGMLKSVKDYVDPSNIFGNRNLL

hide sequence

Ensembl Acc Id:

ENSRNOP00000002111 ⟸ ENSRNOT00000002111

Ensembl Acc Id:

ENSRNOP00000095474 ⟸ ENSRNOT00000093964

Ensembl Acc Id:

ENSRNOP00000079560 ⟸ ENSRNOT00000096806

Protein Domains

FAD-binding PCMH-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9EQR2-F1-model_v2	AlphaFold	Q9EQR2	1-644	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692154

Promoter ID:

EPDNEW_R2679

Type:

initiation region

Name:

Agps_1

Description:

alkylglycerone phosphate synthase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	62,648,430 - 62,648,490	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620364	AgrOrtholog
BioCyc Gene	G2FUF-49298	BioCyc
BioCyc Pathway	PWY-7782 [plasmalogen biosynthesis]	BioCyc
BioCyc Pathway Image	PWY-7782	BioCyc
Ensembl Genes	ENSRNOG00000001547	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000096806	ENTREZGENE
Gene3D-CATH	3.30.160.650	UniProtKB/Swiss-Prot
	3.30.300.330	UniProtKB/Swiss-Prot
	3.30.43.10	UniProtKB/Swiss-Prot
	3.30.465.10	UniProtKB/Swiss-Prot
	3.30.70.3450	UniProtKB/Swiss-Prot
	Vanillyl-alcohol Oxidase, Chain A, domain 4	UniProtKB/Swiss-Prot
InterPro	Alkyl-DHAP_Synthase	UniProtKB/Swiss-Prot
	FAD-bd_PCMH	UniProtKB/Swiss-Prot
	FAD-bd_PCMH-like_sf	UniProtKB/Swiss-Prot
	FAD-bd_PCMH_sub1	UniProtKB/Swiss-Prot
	FAD-bd_PCMH_sub2	UniProtKB/Swiss-Prot
	FAD-linked_Oxase-like_C	UniProtKB/Swiss-Prot
	FAD-linked_oxidase_C	UniProtKB/Swiss-Prot
	Oxid_FAD_bind_N	UniProtKB/Swiss-Prot
	Vanillyl_alc_oxidase_C-sub2	UniProtKB/Swiss-Prot
KEGG Report	rno:84114	UniProtKB/Swiss-Prot
NCBI Gene	84114	ENTREZGENE
PANTHER	ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE, PEROXISOMAL	UniProtKB/Swiss-Prot
	PTHR46568	UniProtKB/Swiss-Prot
Pfam	FAD-oxidase_C	UniProtKB/Swiss-Prot
	FAD_binding_4	UniProtKB/Swiss-Prot
PhenoGen	Agps	PhenoGen
PROSITE	FAD_PCMH	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000001547	RatGTEx
Superfamily-SCOP	SSF55103	UniProtKB/Swiss-Prot
	SSF56176	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZN98	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6GLM9_RAT	UniProtKB/TrEMBL
	A6HMG2	ENTREZGENE, UniProtKB/TrEMBL
	A6HMG3_RAT	UniProtKB/TrEMBL
	ADAS_RAT	UniProtKB/Swiss-Prot
	F1M9Q8_RAT	UniProtKB/TrEMBL
	Q9EQR2	ENTREZGENE
	Q9WUW6_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-04-17	Agps	alkylglycerone phosphate synthase	LOC100360503	alkylglycerone phosphate synthase-like	Data merged from RGD:2321954	737654	PROVISIONAL
2010-05-06	LOC100360503	alkylglycerone phosphate synthase-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2005-01-20	Agps	alkylglycerone phosphate synthase		alkyl-dihydroxyacetonephosphate synthase precursor	Name updated	1299863	APPROVED
2002-08-07	Agps	alkyl-dihydroxyacetonephosphate synthase precursor			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways