Advanced Search (OLGA)

Gene: Mlycd (malonyl-CoA decarboxylase) Rattus norvegicus

Analyze

Symbol:

Mlycd

Name:

malonyl-CoA decarboxylase

RGD ID:

620234

Description:

Enables malonyl-CoA decarboxylase activity. Involved in several processes, including fatty acid metabolic process; regulation of small molecule metabolic process; and response to ischemia. Located in mitochondrial matrix and peroxisomal matrix. Biomarker of metabolic dysfunction-associated steatotic liver disease. Human ortholog(s) of this gene implicated in cardiomyopathy. Orthologous to human MLYCD (malonyl-CoA decarboxylase); PARTICIPATES IN malonic aciduria pathway; methylmalonic aciduria, cobalamin-related pathway; propanoate metabolic pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrotoluene; ammonium chloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

malonyl-CoA decarboxylase, mitochondrial; Mcd

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MLYCD (malonyl-CoA decarboxylase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Mlycd (malonyl-CoA decarboxylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MLYCD (malonyl-CoA decarboxylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MLYCD (malonyl-CoA decarboxylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mlycd (malonyl-CoA decarboxylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MLYCD (malonyl-CoA decarboxylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MLYCD (malonyl-CoA decarboxylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Mlycd (malonyl-CoA decarboxylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Mlycd (malonyl-CoA decarboxylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	IFT88 (intraflagellar transport 88)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	MLYCD (malonyl-CoA decarboxylase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Mlycd (malonyl-CoA decarboxylase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	mlycd (malonyl-CoA decarboxylase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mlcd-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	mlycd	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	64,356,582 - 64,372,447 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	19	64,356,223 - 64,372,446 (+)	Ensembl				GRCr8
mRatBN7.2	19	47,447,931 - 47,463,794 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	47,447,970 - 47,463,793 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	19	54,242,309 - 54,258,174 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	54,922,657 - 54,938,880 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	57,137,162 - 57,153,264 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	52,032,950 - 52,048,773 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	52,032,886 - 52,048,753 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	19	62,781,490 - 62,797,313 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	19	49,637,193 - 49,653,016 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	19	46,707,681 - 46,723,504 (+)	NCBI		Celera
RGSC_v3.1	19	49,642,073 - 49,657,896 (+)	NCBI
Cytogenetic Map	19	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Cardiac Fibrosis (IEP)

cardiomyopathy (ISO)

Cardiotoxicity (IEP)

genetic disease (ISO)

Hypertriglyceridemia (IEP)

Insulin Resistance (IEP)

intellectual disability (ISO)

Malonic Aciduria (ISO)

metabolic dysfunction-associated steatotic liver disease (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-beta-thujone (ISO)

(R)-camphor (ISO)

(R)-linalyl acetate (ISO)

1,2-dimethylhydrazine (ISO)

1,8-cineole (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

4,4'-sulfonyldiphenol (ISO)

acrylamide (ISO)

amiodarone (ISO)

ammonium chloride (EXP)

azoxystrobin (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

bisphenol F (ISO)

camphor (ISO)

cannabidiol (ISO)

carnitine (EXP)

chlorpyrifos (EXP)

clofibrate (EXP)

cobalt dichloride (EXP)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (ISO)

corn oil (EXP)

cyclosporin A (ISO)

dioxygen (ISO)

doxorubicin (ISO)

ethanol (ISO)

fenofibrate (EXP)

fenthion (ISO)

finasteride (EXP)

fipronil (ISO)

folic acid (ISO)

fructose (EXP)

glyphosate (EXP)

GSK-J4 (ISO)

imidacloprid (EXP)

indometacin (EXP)

ketoconazole (EXP)

leflunomide (EXP,ISO)

linalool (ISO)

linalyl acetate (ISO)

malonyl-CoA (ISO)

methidathion (ISO)

methylmercury chloride (ISO)

mono(2-ethylhexyl) phthalate (ISO)

Muraglitazar (EXP)

nefazodone (EXP)

nimesulide (EXP)

nordihydroguaiaretic acid (EXP)

okadaic acid (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

PhIP (EXP)

pirinixic acid (EXP,ISO)

pravastatin (EXP,ISO)

rac-lactic acid (ISO)

resveratrol (EXP)

rotenone (EXP)

sabinene (ISO)

sodium arsenate (ISO)

sodium arsenite (EXP)

spathulenol (ISO)

sunitinib (EXP)

Tesaglitazar (EXP)

tetrachloromethane (EXP,ISO)

thiabendazole (EXP)

thioacetamide (EXP)

trichloroethene (EXP)

triphenyl phosphate (ISO)

triptonide (ISO)

troglitazone (EXP)

urethane (ISO)

valproic acid (ISO)

zaragozic acid A (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

acetyl-CoA biosynthetic process (IBA,IDA,IEA,ISO)

acyl-CoA metabolic process (IEA)

fatty acid biosynthetic process (IBA,IEA,IMP,ISO)

fatty acid metabolic process (IEA)

fatty acid oxidation (IDA)

lipid metabolic process (IEA)

malonyl-CoA catabolic process (IBA,IEA,ISO,ISS)

positive regulation of fatty acid oxidation (IEA,ISO,ISS)

regulation of fatty acid beta-oxidation (IDA)

regulation of fatty acid oxidation (IEA,IMP)

regulation of glucose metabolic process (IEA,IMP,ISO)

response to ischemia (IMP)

response to nutrient (IEP)

Cellular Component

cytoplasm (IDA,IEA,ISO)

mitochondrial matrix (IBA,IDA,IEA,ISO)

mitochondrion (IEA,ISO)

peroxisomal matrix (IBA,IDA,IEA)

peroxisome (IDA,IEA,ISO)

Molecular Function

carboxy-lyase activity (IEA)

identical protein binding (IEA,ISO)

lyase activity (IEA)

malonyl-CoA decarboxylase activity (IBA,IDA,IEA,ISO)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

beta-alanine metabolic pathway (IEA)

malonic aciduria pathway (ISO)

methylmalonic aciduria, cobalamin-related pathway (ISO)

propanoate metabolic pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Malonyl coenzyme a decarboxylase inhibition protects the ischemic heart by inhibiting fatty acid oxidation and stimulating glucose oxidation.	Dyck JR, etal., Circ Res. 2004 May 14;94(9):e78-84. Epub 2004 Apr 22.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Regulation of fatty acid oxidation of the heart by MCD and ACC during contractile stimulation.	Goodwin GW and Taegtmeyer H, Am J Physiol. 1999 Oct;277(4 Pt 1):E772-7.
5.	Malonyl-CoA decarboxylase is present in the cytosolic, mitochondrial and peroxisomal compartments of rat hepatocytes.	Joly E, etal., FEBS Lett. 2005 Dec 5;579(29):6581-6. Epub 2005 Nov 9.
6.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
7.	Genomic organization and characterization of the promoter of rat malonyl-CoA decarboxylase gene.	Lee GY, etal., Biochim Biophys Acta 2002 Aug 19;1577(1):133-8.
8.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
9.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
11.	Coordinate regulation of malonyl-CoA decarboxylase, sn-glycerol-3-phosphate acyltransferase, and acetyl-CoA carboxylase by AMP-activated protein kinase in rat tissues in response to exercise.	Park H, etal., J Biol Chem 2002 Sep 6;277(36):32571-7.
12.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
13.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
14.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
15.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
16.	MCD encodes peroxisomal and cytoplasmic forms of malonyl-CoA decarboxylase and is mutated in malonyl-CoA decarboxylase deficiency.	Sacksteder KA, etal., J Biol Chem. 1999 Aug 27;274(35):24461-8.
17.	Carnitine Supplementation Attenuates Sunitinib-Induced Inhibition of AMP-Activated Protein Kinase Downstream Signals in Cardiac Tissues.	Sayed-Ahmed MM, etal., Cardiovasc Toxicol. 2019 Aug;19(4):344-356. doi: 10.1007/s12012-018-9500-0.
18.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
19.	Cloning and expression of rat pancreatic beta-cell malonyl-CoA decarboxylase.	Voilley N, etal., Biochem J 1999 May 15;340 ( Pt 1):213-7.
20.	Assay of the activity of malonyl-coenzyme A decarboxylase by gas chromatography-mass spectrometry.	Wang X, etal., Anal Biochem. 2007 Apr 15;363(2):169-74. Epub 2007 Jan 13.
21.	Effect of Creosote Bush-Derived NDGA on Expression of Genes Involved in Lipid Metabolism in Liver of High-Fructose Fed Rats: Relevance to NDGA Amelioration of Hypertriglyceridemia and Hepatic Steatosis.	Zhang H, etal., PLoS One. 2015 Sep 22;10(9):e0138203. doi: 10.1371/journal.pone.0138203. eCollection 2015.

Additional References at PubMed

PMID:9869665	PMID:10417274	PMID:14641110	PMID:14651853	PMID:15003260	PMID:15206948	PMID:15489334	PMID:18314420	PMID:18614015	PMID:20178365	PMID:23746352	PMID:23791943
PMID:26767982

Genomics

Comparative Map Data

Mlycd
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	64,356,582 - 64,372,447 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	19	64,356,223 - 64,372,446 (+)	Ensembl				GRCr8
mRatBN7.2	19	47,447,931 - 47,463,794 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	47,447,970 - 47,463,793 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	19	54,242,309 - 54,258,174 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	54,922,657 - 54,938,880 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	57,137,162 - 57,153,264 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	52,032,950 - 52,048,773 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	52,032,886 - 52,048,753 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	19	62,781,490 - 62,797,313 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	19	49,637,193 - 49,653,016 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	19	46,707,681 - 46,723,504 (+)	NCBI		Celera
RGSC_v3.1	19	49,642,073 - 49,657,896 (+)	NCBI
Cytogenetic Map	19	q12	NCBI

MLYCD
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	83,899,115 - 83,927,031 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	83,899,115 - 83,951,445 (+)	Ensembl			hg38	GRCh38
GRCh37	16	83,932,720 - 83,960,636 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	82,490,231 - 82,507,288 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	16	82,490,272 - 82,507,277	NCBI
Celera	16	68,233,776 - 68,250,834 (+)	NCBI		Celera
Cytogenetic Map	16	q23.3	NCBI
HuRef	16	69,684,307 - 69,701,406 (+)	NCBI		HuRef
CHM1_1	16	85,344,095 - 85,361,152 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	16	89,964,788 - 89,992,706 (+)	NCBI		T2T-CHM13v2.0

Mlycd
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	120,121,591 - 120,148,577 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	120,121,617 - 120,137,841 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	8	119,394,852 - 119,421,838 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	119,394,878 - 119,411,102 (+)	Ensembl			mm10	GRCm38
MGSCv37	8	121,918,792 - 121,934,988 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	8	122,280,869 - 122,297,065 (+)	NCBI		MGSCv36	mm8
MGSCv36	4	123,800,115 - 123,816,910 (+)	NCBI		MGSCv36	mm8
Celera	8	123,611,072 - 123,627,694 (+)	NCBI		Celera
Cytogenetic Map	8	E1	NCBI
cM Map	8	67.64	NCBI

MLYCD
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	93,643,962 - 93,661,512 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	99,562,880 - 99,579,831 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	64,520,860 - 64,537,955 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	83,912,793 - 83,929,856 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	83,912,793 - 83,929,162 (+)	Ensembl			panPan2	panpan1.1

MLYCD
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	68,385,058 - 68,399,965 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	68,384,618 - 68,399,965 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	68,398,888 - 68,413,778 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	68,683,230 - 68,698,120 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	68,683,230 - 68,698,120 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	68,631,023 - 68,645,876 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	68,467,455 - 68,482,348 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	68,883,325 - 68,898,237 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Mlycd
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	28,082,871 - 28,110,598 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936641	3,836,418 - 3,846,485 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MLYCD
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	4,681,664 - 4,698,661 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	4,683,386 - 4,698,698 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

MLYCD
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	69,312,978 - 69,329,346 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	69,313,062 - 69,329,102 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666047	6,492,522 - 6,508,731 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mlycd
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624746	3,604,773 - 3,619,775 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624746	3,604,773 - 3,619,790 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Mlycd
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	17	39,040,413 - 39,056,454 (+)	NCBI		Rrattus_CSIRO_v1

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	195
Count of miRNA genes:	139
Interacting mature miRNAs:	154
Transcripts:	ENSRNOT00000019923
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
724546	Kidm3	Kidney mass QTL 3	3.1		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	19	46226778	74246245	Rat
631840	Niddm38	Non-insulin dependent diabetes mellitus QTL 38	3.86		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	19	10329076	74246245	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	32365311	74246245	Rat
724518	Uae19	Urinary albumin excretion QTL 19	5.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	24093973	69093973	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	36289	74246245	Rat
2303628	Vencon9	Ventilatory control QTL 9		0.005	respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	19	23188586	68188586	Rat
61423	Cia14	Collagen induced arthritis QTL 14	3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	19	10833618	74246245	Rat
2313395	Anxrr26	Anxiety related response QTL 26			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	19	44385134	74246245	Rat
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	32539615	74246245	Rat
5135224	Leukc1	Leukocyte quantity QTL 1			eosinophil quantity (VT:0002602)	blood eosinophil count (CMO:0000033)	19	61249161	74246245	Rat
1331788	Rf45	Renal function QTL 45	2.818		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	19	31777888	74246245	Rat
1554318	Bmd5	Bone mineral density QTL 5	12.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	19	23188586	68188586	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	20109306	65109306	Rat
1549835	Tcas7	Tongue tumor susceptibility QTL 7		0.001	tongue integrity trait (VT:0010553)	squamous cell carcinoma of the head and neck tumor number (CMO:0001876)	19	41722546	74246245	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2194317	74246245	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2194317	74246245	Rat

Markers in Region

RH144263

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	47,458,178 - 47,458,333 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	52,043,158 - 52,043,312	NCBI	Rnor6.0
Rnor_5.0	19	62,791,698 - 62,791,852	UniSTS	Rnor5.0
RGSC_v3.4	19	49,647,401 - 49,647,555	UniSTS	RGSC3.4
Celera	19	46,717,889 - 46,718,043	UniSTS
RH 3.4 Map	19	650.4	UniSTS
Cytogenetic Map	19	q12	UniSTS

AI044337

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	47,463,485 - 47,463,699 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	52,048,465 - 52,048,678	NCBI	Rnor6.0
Rnor_5.0	19	62,797,005 - 62,797,218	UniSTS	Rnor5.0
RGSC_v3.4	19	49,652,708 - 49,652,921	UniSTS	RGSC3.4
Celera	19	46,723,196 - 46,723,409	UniSTS
RH 3.4 Map	19	633.5	UniSTS
Cytogenetic Map	19	q12	UniSTS

Mlycd

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	47,463,126 - 47,463,196 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	52,048,106 - 52,048,175	NCBI	Rnor6.0
Rnor_5.0	19	62,796,646 - 62,796,715	UniSTS	Rnor5.0
RGSC_v3.4	19	49,652,349 - 49,652,418	UniSTS	RGSC3.4
Celera	19	46,722,837 - 46,722,906	UniSTS
Cytogenetic Map	19	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	162	91	90	59	92	59	6	356	192	11	141	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053477	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF304865	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF442960	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ007704	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC061845	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000019923 ⟹ ENSRNOP00000019923

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	19	64,356,223 - 64,372,446 (+)	Ensembl
mRatBN7.2 Ensembl	19	47,447,970 - 47,463,793 (+)	Ensembl
Rnor_6.0 Ensembl	19	52,032,886 - 52,048,753 (+)	Ensembl

RefSeq Acc Id:

NM_053477 ⟹ NP_445929

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	64,356,582 - 64,372,447 (+)	NCBI
mRatBN7.2	19	47,447,931 - 47,463,794 (+)	NCBI
Rnor_6.0	19	52,032,950 - 52,048,773 (+)	NCBI
Rnor_5.0	19	62,781,490 - 62,797,313 (+)	NCBI
RGSC_v3.4	19	49,637,193 - 49,653,016 (+)	RGD
Celera	19	46,707,681 - 46,723,504 (+)	RGD

Sequence:

show sequence

ATGAGAGGCTTGGGGCCAAGCTTGAGGGCTCGGCGCCTGCTCCCACTGCGGTACCCGCCGCGGC
CTCCGGGGCCTCGGGGACCTAGGCTGTGCAGCGGGCTCACGGCTAGCGCCATGGACGAGCTGCT
ACGGCGAGCCGTGCCACCCACGCCGGCCTACGAGCTGCGCGAGAAGACGCCGGCCCCGGCCGAG
GGGCAGTGCGCGGACTTCGTGAGCTTTTACGGCGGCCTGGCCGAGGCGGCCCAGCGCGCCGAGC
TGCTCGGCCGCCTGGCTCAGGGCTTCGGCGTGGATCACGGCCAGGTAGCGGAGCAGAGCGCCGG
AGTGCTGCAGCTGCGCCAGCAGTCGCGCGAGGCGGCCGTGCTGCTGCAGGCAGAGGACCGGCTA
CGCTATGCCCTCGTGCCGCGATACCGTGGCCTCTTCCACCACATCAGTAAGCTGGACGGCGGCG
TGCGCTTCCTGGTACAGCTGCGGGCCGATCTGCTGGAGGCGCAGGCCCTCAAGCTGGTGGAAGG
GCCGCACGTCCGGGAAATGAACGGAGTGCTAAAAAGCATGCTGTCCGAGTGGTTCTCCTCTGGC
TTCCTGAACCTGGAGCGGGTCACCTGGCACTCGCCCTGTGAGGTGCTTCAGAAGATCAGCGATT
GTGAGGCTGTGCAGCCTGTGAAAAACTGGATGGACATGAAGCGGCGTGTGGGGCCATACCGGAG
GTGTTACTTCTTCTCCCACTGCTCCACCCCCGGGGACCCCCTGGTTGTTCTGCATGTGGCTCTG
ACCGGTGACATTTCCAACAACATCCAGAGCATTGTGAAAGAGTGCCCTCCGTCTGAAACAGAGG
AGAAGAACCGGATCGCTGCTGCTGTCTTCTACTCCATCAGCCTGACCCAGCAGGGCCTGCAGGG
CGTGGGACTCGGCACCTTCCTCATAAAGCGAGTGGTCAAGGAGCTGCAGAAGGAGTTTCCTCAT
CTGGGGGCCTTTTCCAGCCTGTCACCTATACCCGGATTCACCAAGTGGCTGCTGGGCCTTCTGA
ATGTGCAGGGAAAGGAGTATGGGAGGAACGAGCTGTTCACAGACTCAGAGTGCAAAGAAATCGC
AGAGGTCACGGGCGACCCTGTTCACGAGAGCCTCAAGGGTCTCCTGAGCAGTGGTGAGTGGGCG
AAGTCTGAGAAGCTGGCACAGGCACTGCAGGGGCCACTGATGAGACTGTGTGCCTGGTACCTTT
ACGGTGAGAAGCACCGATACGCCCTCAATCCAGTGGCCAACTTCCACCTGCAGAACGGGGCTGT
GATGTGGCGTATCAACTGGATGGCTGACAGCAGCCTCAAAGGCCTCACCAGCTCGTGCGGCCTC
ATGGTCAACTACCGTTACTACCTGGAGGAGACCGGCCCCAACAGCATCTCCTACCTGGGCTCCA
AGAACATCAAAGCTTCCGAGCAGATCCTCAGCCTGGTAGCCCAGTTCCAGAGCAACAGCAAACT
CTAGGGACATCCTGCCCAGCGCTTGGCCCTGCTCAGAAAGGAGGCTGTATTCTGATGGGCCAGC
GCTGCTCACCACAGCAACCACTCAGGAGGCCACACCTCAGCTGTCACTGTGCTGGCGGACTCAC
TGGTTGGAGTGGTGGTGGTTTTGGGTACACCTGCCCTGAGGATGTCACTGTGCTTCTCCAAAAG
CCCTTGCTGCTGCCCCCACAGCCTGTGCTTTCAGAAAGCTCTACAGATGCAGCCACAGGCCGCC
CAGGACGGAGCCCAGAGCACAGACCCTGTAGAGTACAGAGAGTTGGCAGTCATGTCCTCTATTC
GGGAGAGGGCTAAGGTCTGTGCCGTGGCTGCTACCACAGCTTAAGCTCAGACTAGGGAGACCTT
GTGGTGTGCACAGGGTGTGATCTGCAACCCAGGGATGCTGCTACTTGAGGCCAGAATAGGCTCG
TAGGGTTTAAATGAGATCCCAGTTCATAATGAACTGAACAGTAAAGAACAAATTTGTTCTGTAA
ACATTAAACATGATTGTTCACTGTAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_445929	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH61845	(Get FASTA)	NCBI Sequence Viewer
	AAL09352	(Get FASTA)	NCBI Sequence Viewer
	AAN51977	(Get FASTA)	NCBI Sequence Viewer
	CAB46681	(Get FASTA)	NCBI Sequence Viewer
	EDL92663	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000019923
	ENSRNOP00000019923.3
GenBank Protein	Q920F5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_445929 ⟸ NM_053477

- UniProtKB:

Q920F5 (UniProtKB/Swiss-Prot), Q9WUY2 (UniProtKB/Swiss-Prot), A6IZI5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MRGLGPSLRARRLLPLRYPPRPPGPRGPRLCSGLTASAMDELLRRAVPPTPAYELREKTPAPAE
GQCADFVSFYGGLAEAAQRAELLGRLAQGFGVDHGQVAEQSAGVLQLRQQSREAAVLLQAEDRL
RYALVPRYRGLFHHISKLDGGVRFLVQLRADLLEAQALKLVEGPHVREMNGVLKSMLSEWFSSG
FLNLERVTWHSPCEVLQKISDCEAVQPVKNWMDMKRRVGPYRRCYFFSHCSTPGDPLVVLHVAL
TGDISNNIQSIVKECPPSETEEKNRIAAAVFYSISLTQQGLQGVGLGTFLIKRVVKELQKEFPH
LGAFSSLSPIPGFTKWLLGLLNVQGKEYGRNELFTDSECKEIAEVTGDPVHESLKGLLSSGEWA
KSEKLAQALQGPLMRLCAWYLYGEKHRYALNPVANFHLQNGAVMWRINWMADSSLKGLTSSCGL
MVNYRYYLEETGPNSISYLGSKNIKASEQILSLVAQFQSNSKL

hide sequence

Ensembl Acc Id:

ENSRNOP00000019923 ⟸ ENSRNOT00000019923

Protein Domains

Malonyl-CoA decarboxylase C-terminal Malonyl-CoA decarboxylase N-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q920F5-F1-model_v2	AlphaFold	Q920F5	1-492	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13701178

Promoter ID:

EPDNEW_R11700

Type:

initiation region

Name:

Mlycd_1

Description:

malonyl-CoA decarboxylase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	19	52,032,907 - 52,032,967	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620234	AgrOrtholog
BioCyc Gene	G2FUF-5521	BioCyc
Ensembl Genes	ENSRNOG00000014522	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000019923	ENTREZGENE
	ENSRNOT00000019923.6	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.140.90	UniProtKB/Swiss-Prot
	3.40.630.150	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:5621015	IMAGE-MGC_LOAD
InterPro	Malonyl_CoA_deC	UniProtKB/Swiss-Prot
	Malonyl_CoA_deC_C	UniProtKB/Swiss-Prot
	Malonyl_CoA_deC_C_sf	UniProtKB/Swiss-Prot
	MCD_N	UniProtKB/Swiss-Prot
	MCD_N_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:85239	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72361	IMAGE-MGC_LOAD
NCBI Gene	85239	ENTREZGENE
PANTHER	MALONYL-COA DECARBOXYLASE, MITOCHONDRIAL	UniProtKB/Swiss-Prot
	PTHR28641	UniProtKB/Swiss-Prot
Pfam	MCD	UniProtKB/Swiss-Prot
	MCD_N	UniProtKB/Swiss-Prot
PhenoGen	Mlycd	PhenoGen
RatGTEx	ENSRNOG00000014522	RatGTEx
UniProt	A6IZI5	ENTREZGENE, UniProtKB/TrEMBL
	DCMC_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q9WUY2	ENTREZGENE
UniProt Secondary	Q9WUY2	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-09-10	Mlycd	malonyl-CoA decarboxylase			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Mlycd	malonyl-CoA decarboxylase			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in liver, skeletal muscle, and adipose tissue	631891
gene_regulation	enzyme activity increases in response to exercise	631891

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)