Cd79b (CD79b molecule) - Rat Genome Database

Name: Cd79b
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Cd79b (CD79b molecule) Rattus norvegicus

Analyze

Symbol:

Cd79b

Name:

CD79b molecule

RGD ID:

620012

Description:

Predicted to enable identical protein binding activity and transmembrane signaling receptor activity. Predicted to be involved in B cell differentiation and B cell receptor signaling pathway. Predicted to act upstream of or within response to bacterium. Predicted to be part of IgM B cell receptor complex. Predicted to be active in external side of plasma membrane. Human ortholog(s) of this gene implicated in agammaglobulinemia 6 and lymphoma (multiple). Orthologous to human CD79B (CD79b molecule); PARTICIPATES IN B cell receptor signaling pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

B-cell antigen receptor complex-associated protein beta chain; B29; CD79B antigen; Cd79b molecule, immunoglobulin-associated beta; Igb; immunoglobulin-associated beta; MGC108607

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CD79B (CD79b molecule)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Cd79b (CD79B antigen)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cd79b (CD79b molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CD79B (CD79b molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CD79B (CD79b molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cd79b (CD79b molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CD79B (CD79b molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CD79B (CD79b molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cd79b (CD79b molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	PRKDC (protein kinase, DNA-activated, catalytic subunit)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	CD79B (CD79b molecule)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cd79b (CD79B antigen)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cd79b (CD79b molecule, immunoglobulin-associated beta)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	91,739,134 - 91,742,312 (-)	NCBI		GRCr8
mRatBN7.2	10	91,239,354 - 91,242,500 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	91,239,356 - 91,242,625 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	96,293,979 - 96,297,125 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	95,757,144 - 95,760,290 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	91,167,742 - 91,170,888 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	94,497,445 - 94,500,591 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	94,497,448 - 94,500,591 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	94,248,655 - 94,251,801 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	95,703,129 - 95,706,275 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	95,717,499 - 95,720,645 (-)	NCBI
Celera	10	89,914,837 - 89,917,983 (-)	NCBI		Celera
Cytogenetic Map	10	q32.1	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

acute lymphoblastic leukemia (ISO)

agammaglobulinemia (ISO)

agammaglobulinemia 6 (ISO)

B-Cell Chronic Lymphocytic Leukemia (ISO)

Burkitt lymphoma (ISO)

central nervous system lymphoma (ISO)

chronic lymphocytic leukemia (ISO)

diffuse large B-cell lymphoma (ISO)

follicular lymphoma (ISO)

genetic disease (ISO)

hyperkalemic periodic paralysis (ISO)

liver disease (ISO)

mantle cell lymphoma (ISO)

non-Hodgkin lymphoma (ISO)

splenic marginal zone lymphoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-butoxyethanol (ISO)

3,7-dihydropurine-6-thione (EXP)

acetohydrazide (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

aluminium trifluoride (ISO)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

bisphenol A (EXP,ISO)

buta-1,3-diene (ISO)

butanal (ISO)

C60 fullerene (EXP)

carbon nanotube (ISO)

chloroprene (ISO)

chrysene (ISO)

cyclophosphamide (ISO)

dextran sulfate (ISO)

dichloroacetic acid (ISO)

dimethylarsinic acid (ISO)

dioxygen (ISO)

disodium selenite (ISO)

furan (EXP)

genistein (ISO)

gentamycin (EXP)

lipopolysaccharide (EXP,ISO)

mercaptopurine (EXP)

methylarsonic acid (ISO)

morphine (ISO)

nitrobenzenes (EXP)

ozone (ISO)

paracetamol (EXP)

pentanal (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenylarsine oxide (ISO)

pirinixic acid (ISO)

propanal (ISO)

protein kinase inhibitor (ISO)

purine-6-thiol (EXP)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

serpentine asbestos (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

tetrachloromethane (EXP,ISO)

tetraphene (ISO)

thimerosal (ISO)

thioacetamide (EXP)

titanium dioxide (EXP,ISO)

triptonide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

B cell differentiation (IBA)

B cell receptor signaling pathway (IBA,ISO)

biological_process (ND)

response to bacterium (ISO)

Cellular Component

B cell receptor complex (IBA,ISO)

external side of plasma membrane (IBA,ISO)

IgM B cell receptor complex (ISO)

Molecular Function

identical protein binding (ISO)

protein binding (ISO)

transmembrane signaling receptor activity (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

B cell receptor signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	An alternatively spliced form of CD79b gene may account for altered B-cell receptor expression in B-chronic lymphocytic leukemia.	Alfarano A, etal., Blood. 1999 Apr 1;93(7):2327-35.
2.	Quantitative analysis of CD79b, CD5 and CD19 in mature B-cell lymphoproliferative disorders.	Cabezudo E, etal., Haematologica. 1999 May;84(5):413-8.
3.	Patients with primary breast and primary female genital tract diffuse large B cell lymphoma have a high frequency of MYD88 and CD79B mutations.	Cao XX, etal., Ann Hematol. 2017 Nov;96(11):1867-1871. doi: 10.1007/s00277-017-3094-7. Epub 2017 Aug 12.
4.	Morphologic Patterns and the Correlation With MYD88 L265P, CD79B Mutations in Primary Adrenal Diffuse Large B-Cell Lymphoma.	Chen Z, etal., Am J Surg Pathol. 2020 Apr;44(4):444-455. doi: 10.1097/PAS.0000000000001386.
5.	New markers for minimal residual disease detection in acute lymphoblastic leukemia.	Coustan-Smith E, etal., Blood. 2011 Jun 9;117(23):6267-76. doi: 10.1182/blood-2010-12-324004. Epub 2011 Apr 12.
6.	Therapeutic potential of an anti-CD79b antibody-drug conjugate, anti-CD79b-vc-MMAE, for the treatment of non-Hodgkin lymphoma.	Dornan D, etal., Blood. 2009 Sep 24;114(13):2721-9. doi: 10.1182/blood-2009-02-205500. Epub 2009 Jul 24.
7.	CD79b expression in B cell chronic lymphocytic leukemia: its implication for minimal residual disease detection.	Garcia Vela J, etal., Leukemia. 1999 Oct;13(10):1501-5. doi: 10.1038/sj.leu.2401511.
8.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
9.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
10.	Ibrutinib Unmasks Critical Role of Bruton Tyrosine Kinase in Primary CNS Lymphoma.	Grommes C, etal., Cancer Discov. 2017 Sep;7(9):1018-1029. doi: 10.1158/2159-8290.CD-17-0613. Epub 2017 Jun 15.
11.	Novel regulatory regions found downstream of the rat B29/Ig-beta gene.	Komatsu A, etal., Eur J Biochem 2002 Feb;269(4):1227-36.
12.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
13.	Physical linkage of the B29/Ig-beta (CD79B) gene to the skeletal muscle, sodium-channel, and growth hormone genes in rat and human.	Nakazato S, etal., Genomics 1998 Mar 15;48(3):363-8.
14.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
15.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
16.	Analysis of the B-cell receptor B29 (CD79b) gene in familial chronic lymphocytic leukemia.	Payelle-Brogard B, etal., Blood. 1999 Nov 15;94(10):3516-22.
17.	Anti-CD22 and anti-CD79B antibody drug conjugates are active in different molecular diffuse large B-cell lymphoma subtypes.	Pfeifer M, etal., Leukemia. 2015 Jul;29(7):1578-86. doi: 10.1038/leu.2015.48. Epub 2015 Feb 24.
18.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
19.	Antibody-drug conjugates targeted to CD79 for the treatment of non-Hodgkin lymphoma.	Polson AG, etal., Blood. 2007 Jul 15;110(2):616-23. doi: 10.1182/blood-2007-01-066704. Epub 2007 Mar 20.
20.	Expression of Ig-beta (CD79b) by chronic lymphocytic leukemia B cells that lack immunoglobulin heavy-chain allelic exclusion.	Rassenti LZ and Kipps TJ, Blood. 2000 Apr 15;95(8):2725-7.
21.	GOA pipeline	RGD automated data pipeline
22.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
23.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
24.	Comprehensive gene review and curation	RGD comprehensive gene curation
25.	Aberrations of the B-cell receptor B29 (CD79b) gene in chronic lymphocytic leukemia.	Thompson AA, etal., Blood. 1997 Aug 15;90(4):1387-94.
26.	Primary diffuse large B-cell lymphomas of central nervous system exhibit remarkably high prevalence of oncogenic MYD88 and CD79B mutations.	Yamada S, etal., Leuk Lymphoma. 2015 Jul;56(7):2141-5. doi: 10.3109/10428194.2014.979413. Epub 2015 Jan 14.

Additional References at PubMed

PMID:1373499	PMID:8626447	PMID:12477932	PMID:14967045	PMID:16920149	PMID:20458337	PMID:20696394	PMID:23012479

Genomics

Comparative Map Data

Cd79b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	91,739,134 - 91,742,312 (-)	NCBI		GRCr8
mRatBN7.2	10	91,239,354 - 91,242,500 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	91,239,356 - 91,242,625 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	96,293,979 - 96,297,125 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	95,757,144 - 95,760,290 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	91,167,742 - 91,170,888 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	94,497,445 - 94,500,591 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	94,497,448 - 94,500,591 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	94,248,655 - 94,251,801 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	95,703,129 - 95,706,275 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	95,717,499 - 95,720,645 (-)	NCBI
Celera	10	89,914,837 - 89,917,983 (-)	NCBI		Celera
Cytogenetic Map	10	q32.1	NCBI

CD79B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	63,928,740 - 63,932,331 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	63,928,738 - 63,932,336 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	62,006,100 - 62,009,691 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	59,359,830 - 59,363,436 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	59,359,831 - 59,363,446	NCBI
Celera	17	56,394,160 - 56,397,766 (-)	NCBI		Celera
Cytogenetic Map	17	q23.3	NCBI
HuRef	17	57,373,817 - 57,377,419 (-)	NCBI		HuRef
CHM1_1	17	62,070,017 - 62,073,623 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	64,799,505 - 64,803,094 (-)	NCBI		T2T-CHM13v2.0

Cd79b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	106,202,167 - 106,205,388 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	106,202,167 - 106,205,588 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	106,311,341 - 106,314,562 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	106,311,341 - 106,314,762 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	106,172,655 - 106,175,843 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	106,127,431 - 106,130,760 (-)	NCBI		MGSCv36	mm8
Celera	11	118,042,026 - 118,045,214 (-)	NCBI		Celera
Cytogenetic Map	11	E1	NCBI
cM Map	11	68.89	NCBI

Cd79b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955478	7,909,153 - 7,913,166 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955478	7,909,353 - 7,912,814 (+)	NCBI	ChiLan1.0	ChiLan1.0

CD79B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	80,111,641 - 80,115,624 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	84,931,947 - 84,935,931 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	58,022,375 - 58,026,359 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	63,116,722 - 63,120,335 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	63,116,722 - 63,120,335 (-)	Ensembl	panpan1.1		panPan2

CD79B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	11,834,230 - 11,844,946 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	11,842,190 - 11,844,843 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	12,801,263 - 12,804,585 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	13,502,931 - 13,506,253 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	13,502,935 - 13,506,208 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	12,449,684 - 12,453,001 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	15,079,310 - 15,082,632 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	15,081,786 - 15,085,109 (+)	NCBI		UU_Cfam_GSD_1.0

Cd79b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	14,657,115 - 14,660,367 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936541	4,534,246 - 4,537,590 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936541	4,534,233 - 4,537,448 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CD79B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	15,053,007 - 15,056,438 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	15,052,966 - 15,056,441 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	15,044,369 - 15,047,831 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CD79B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	57,339,492 - 57,343,085 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	57,339,457 - 57,343,358 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666077	27,952,012 - 27,955,604 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cd79b
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624849	1,429,912 - 1,432,955 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624849	1,429,446 - 1,432,835 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Cd79b
8 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	232
Count of miRNA genes:	164
Interacting mature miRNAs:	177
Transcripts:	ENSRNOT00000015976
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40035094	102359817	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42045676	104670812	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45029650	95600334	Rat
631547	Bp87	Blood pressure QTL 87	4.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	47369470	92369470	Rat
1549846	Scl47	Serum cholesterol level QTL 47	3.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	50574707	95574707	Rat
70364	Bp72	Blood pressure QTL 72			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	51121100	96121100	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	51770177	107211142	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	51770177	107211142	Rat
1359017	Hrtrt21	Heart rate QTL 21	2.4		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	10	51772940	96772940	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	51774612	95600334	Rat
631535	Cm51	Cardiac mass QTL 51	3		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	51786282	91669536	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	53797385	107211142	Rat
70164	Bw21	Body weight QTL 21	4.36	0.00005	body mass (VT:0001259)	body weight (CMO:0000012)	10	53797494	98952626	Rat
1354608	Cm33	Cardiac mass QTL 33	2.8		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	10	54809292	99809292	Rat
2312662	Slep8	Serum leptin concentration QTL 8		0.05	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	10	57134272	102134272	Rat
2312668	Scl65	Serum cholesterol level QTL 65		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	57134272	102134272	Rat
2312672	Insul15	Insulin level QTL 15		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	10	57134272	102134272	Rat
1549831	Bss6	Bone structure and strength QTL 6	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	10	57576521	102576521	Rat
2293698	Bss43	Bone structure and strength QTL 43	5.33	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	10	59209888	104209888	Rat
2306970	Anxrr22	Anxiety related response QTL 22	5.95		fear/anxiety-related behavior trait (VT:1000241)	number of periods of voluntary immobility (CMO:0001045)	10	61345276	98211570	Rat
6893336	Cm75	Cardiac mass QTL 75	0.1	0.87	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	61345276	99703528	Rat
1558643	Cm44	Cardiac mass QTL 44	4.8	0.0000368	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	61345276	99703528	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62057807	107057807	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62057807	107057807	Rat
61449	Ciaa2	CIA Autoantibody QTL 2	7.1		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	10	63221094	107211142	Rat
1357344	Bp249	Blood pressure QTL 249		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	66743655	98003205	Rat
2317029	Aia19	Adjuvant induced arthritis QTL 19	2.98		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	66978955	107211142	Rat
2317039	Aia6	Adjuvant induced arthritis QTL 6	4.31		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	66978955	107211142	Rat
10450498	Bp384	Blood pressure QTL 384		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	67750049	107211142	Rat
1642980	Bp300	Blood pressure QTL 300			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68383129	107211142	Rat
61396	Bp9	Blood pressure QTL 9	4.8	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68420376	107211142	Rat
2300172	Bmd57	Bone mineral density QTL 57	9.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	10	69738412	107211142	Rat
2293646	Bss25	Bone structure and strength QTL 25	10.96	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	10	69738412	107211142	Rat
2293663	Bss33	Bone structure and strength QTL 33	9.34	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	10	69738412	107211142	Rat
6893366	Bw106	Body weight QTL 106	0.3	0.47	body mass (VT:0001259)	body weight (CMO:0000012)	10	70199100	107211142	Rat
70193	Mcs7	Mammary carcinoma susceptibility QTL 7	2.38		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72224939	107211142	Rat
2298548	Neuinf7	Neuroinflammation QTL 7	3.4		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	10	72224939	107211142	Rat
2306793	Ean5	Experimental allergic neuritis QTL 5	4.7		nervous system integrity trait (VT:0010566)	IFNG-secreting splenocyte count (CMO:0002122)	10	72552416	93995749	Rat
1358188	Ept9	Estrogen-induced pituitary tumorigenesis QTL 9	3.9		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	10	73453136	96120911	Rat
2292617	Ept18	Estrogen-induced pituitary tumorigenesis QTL 18	3.9		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	10	73453136	96120911	Rat
1579919	Bp281	Blood pressure QTL 281		0.01	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	74372084	94965338	Rat
10450495	Bp383	Blood pressure QTL 383		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	76246085	94965338	Rat
2292438	Bp311	Blood pressure QTL 311			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	76246085	107211142	Rat
1302404	Cia27	Collagen induced arthritis QTL 27	2.6	0.0045	joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	10	76452683	107211142	Rat
4889492	Pancm2	Pancreatic morphology QTL 2	3.2		pancreatic beta cell morphology trait (VT:0005217)	ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814)	10	76748906	107211142	Rat
1300107	Rf18	Renal function QTL 18	3.41		urine output (VT:0003620)	timed urine volume (CMO:0000260)	10	78775516	98279596	Rat
6893357	Bw102	Body weight QTL 102	0.5	0.36	body mass (VT:0001259)	body weight (CMO:0000012)	10	80515287	101325465	Rat
2303589	Bw87	Body weight QTL 87	2		body mass (VT:0001259)	body weight (CMO:0000012)	10	81285008	107211142	Rat
4889948	Bss91	Bone structure and strength QTL 91	4		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	10	82564856	92369470	Rat
2317754	Glom25	Glomerulus QTL 25	3.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	82685200	107211142	Rat
12880055	Am11	Aortic mass QTL 11		0.004	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	84007272	95933025	Rat
2301398	Kidm38	Kidney mass QTL 38		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	84007272	95933025	Rat
2306792	Ean4	Experimental allergic neuritis QTL 4	4		nervous system integrity trait (VT:0010566)	IFNG-secreting splenocyte count (CMO:0002122)	10	84022321	93995963	Rat
1600367	Mcs15	Mammary carcinoma susceptibility QTL 15	4.5		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	85565469	103884409	Rat
631538	Oia5	Oil induced arthritis QTL 5			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	87055121	107211142	Rat
2313856	Bp342	Blood pressure QTL 342	4.4	0.0001	life span trait (VT:0005372)	age at time of death (CMO:0001193)	10	87307617	96121100	Rat
61363	Oia3	Oil induced arthritis QTL 3		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	87307617	107211142	Rat
634320	Niddm49	Non-insulin dependent diabetes mellitus QTL 49	4.41		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	10	88539139	107211142	Rat
12880395	Cm109	Cardiac mass QTL 109		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	10	90404397	107211142	Rat
12880396	Am13	Aortic mass QTL 13		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	90404397	107211142	Rat
12880398	Kidm67	Kidney mass QTL 67		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	90404397	107211142	Rat
12880384	Cm107	Cardiac mass QTL 107		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)		90404397	107211142	Rat
12880385	Cm108	Cardiac mass QTL 108		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)		90404397	107211142	Rat
1579915	Bp280	Blood pressure QTL 280		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	90404397	107211142	Rat
1300137	Bp186	Blood pressure QTL 186	3.57		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	10	90627439	107057807	Rat
724530	Bp149	Blood pressure QTL 149		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	90627439	107211142	Rat
61436	Cia5	Collagen induced arthritis QTL 5	4.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	91228102	104060283	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High					1
Medium	2		6		16							8
Low		17	48	40	2	40	2	2	11	25	26	3	2
Below cutoff	1	19	3	1		1	5	8	62	10	14		5

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_133533	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268365	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB004831	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC133055	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC088115	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226266	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227061	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227788	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230261	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232054	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232680	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232790	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233507	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234082	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234487	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000015976 ⟹ ENSRNOP00000015977

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	91,239,357 - 91,242,625 (-)	Ensembl
Rnor_6.0 Ensembl	10	94,497,448 - 94,500,591 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000102931 ⟹ ENSRNOP00000077025

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	91,239,356 - 91,242,514 (-)	Ensembl

RefSeq Acc Id:

NM_133533 ⟹ NP_598217

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	91,739,134 - 91,742,280 (-)	NCBI
mRatBN7.2	10	91,239,354 - 91,242,500 (-)	NCBI
Rnor_6.0	10	94,497,445 - 94,500,591 (-)	NCBI
Rnor_5.0	10	94,248,655 - 94,251,801 (-)	NCBI
RGSC_v3.4	10	95,703,129 - 95,706,275 (-)	RGD
Celera	10	89,914,837 - 89,917,983 (-)	RGD

Sequence:

show sequence

CACACAGTTACATGTTTTGCCCCAGACCCTCCTTGGGCTCAGAGACAGAGCAGTGACCATGGCC
ACACTGGTGCTGTCTCCTGTGCCCTGCCACTGGCTGATGTTCCTGCTGCTGCTCCTCTCAGGTG
AGCCAGTACCAGCGATGACAAAGAGTGACCAGCCACCGATTTTCCAAGGAAGCCCTTGTTCCAA
GATCTGGCAGCACCCGAGGTTTGCAGCCAAAAAGCGGAGCTCCATGGTGAAGTTTCACTGCCAC
ACAGACTACTCAGGTGTCATGACCTGGTTCCGGCAGAAAGGGAACCAGAGGCCTCAGGAACTGT
TCCCAGAAGACGGACACATTTCGCAGACCCGGAATGGCTCTGTCTACACCCTCACTCTCCAAAA
CATCCAGTATGAGGATAACGGCATCTACTTCTGCCAGCAGAAGTGCAACAGCACCGAACCTGAT
GTTACCGATGGCTGTGGCACGGAACTTCTAGTCTTAGGATTCAGCACGTTGGACCAACTGAAGC
GGCGGAACACGCTGAAAGATGGCATTATCATGATCCAGACCCTCCTCATCATCCTCTTCATCAT
CGTCCCCATCTTCTTACTACTAGACAAGGATGACAGCAAGGCCGGGATGGAAGAGGACCACACC
TATGAGGGCTTGAACATTGACCAGACAGCCACCTATGAAGACATAGTGACTCTTCGGACAGGGG
AGGTAAAGTGGTCTGTGGGAGAGCACCCAGGCCAGGAGTGAGGGCCACCTCCATCCTGCTCAAC
TCTTGGGCCTCACTGTTTCCAAACTGCCTGGCTCACAGTCTGTTCCCTGCTTCCTGGATACCCT
GGCCAGCATCTGAAGTTGGACCATCAATGTCACCTCTCTTTCTAGCCTCTGGTCCCCAGCTCTT
GCTGAAGGGCCCGGGGTAGAAGGACAATAGGGTGGTGGCATGGAGTAAGGAGTTCTCTGGGGGA
TAGACTTGACCCAAGGCTTCTGGAAATGCTATGCAGTTTCTGTCCCCATGTTTGGGACAGGAAA
GCAGAGACTTGTTGGAATCTGCAAATGGACTCAGCACATTGGCTTCCTGAGGAGTCCGGGAAGG
ACCACGGTTCACAGTGGCACCTAGAAGGGAATGCCAGAATGCCACTTCTCCCTCTCATCCCAGG
GATCCCCTAAAGCCTATAGCCCATCCTCCTGTGGAATAAACAGCGTATCTGACACCAGAAAAAA
AAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063268365 ⟹ XP_063124435

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	91,739,134 - 91,742,312 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_598217	(Get FASTA)	NCBI Sequence Viewer
	XP_063124435	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88115	(Get FASTA)	NCBI Sequence Viewer
	BAA25652	(Get FASTA)	NCBI Sequence Viewer
	EDM06394	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000015977.6
	ENSRNOP00000077025.1

RefSeq Acc Id:	NP_598217 ⟸ NM_133533
- Peptide Label:	precursor
- UniProtKB:	O70153 (UniProtKB/TrEMBL), F1MAP5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MATLVLSPVPCHWLMFLLLLLSGEPVPAMTKSDQPPIFQGSPCSKIWQHPRFAAKKRSSMVKFH CHTDYSGVMTWFRQKGNQRPQELFPEDGHISQTRNGSVYTLTLQNIQYEDNGIYFCQQKCNSTE PDVTDGCGTELLVLGFSTLDQLKRRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEED HTYEGLNIDQTATYEDIVTLRTGEVKWSVGEHPGQE hide sequence

RefSeq Acc Id:

ENSRNOP00000015977 ⟸ ENSRNOT00000015976

RefSeq Acc Id:

ENSRNOP00000077025 ⟸ ENSRNOT00000102931

RefSeq Acc Id:	XP_063124435 ⟸ XM_063268365
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I5Y5U3 (UniProtKB/TrEMBL)

Protein Domains

Ig-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O70153-F1-model_v2	AlphaFold	O70153	1-228	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697843

Promoter ID:

EPDNEW_R8368

Type:

initiation region

Name:

Cd79b_1

Description:

CD79b molecule

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	94,500,586 - 94,500,646	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620012	AgrOrtholog
BioCyc Gene	G2FUF-22952	BioCyc
Ensembl Genes	ENSRNOG00000011917	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000015976.7	UniProtKB/TrEMBL
	ENSRNOT00000102931.1	UniProtKB/TrEMBL
Gene3D-CATH	2.60.40.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7325406	IMAGE-MGC_LOAD
InterPro	CD79a/CD79b	UniProtKB/TrEMBL
	Ig-like	UniProtKB/TrEMBL
	Ig-like_dom_sf	UniProtKB/TrEMBL
	Ig-like_fold	UniProtKB/TrEMBL
	Ig_sub	UniProtKB/TrEMBL
	Ig_V-set	UniProtKB/TrEMBL
	Phos_immunorcpt_sig_ITAM	UniProtKB/TrEMBL
KEGG Report	rno:171055	UniProtKB/TrEMBL
MGC_CLONE	MGC:108607	IMAGE-MGC_LOAD
NCBI Gene	171055	ENTREZGENE
PANTHER	B-CELL ANTIGEN RECEPTOR COMPLEX-ASSOCIATED PROTEIN BETA CHAIN	UniProtKB/TrEMBL
	PTHR14334	UniProtKB/TrEMBL
Pfam	ITAM	UniProtKB/TrEMBL
	V-set	UniProtKB/TrEMBL
PhenoGen	Cd79b	PhenoGen
PROSITE	IG_LIKE	UniProtKB/TrEMBL
	ITAM_1	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000011917	RatGTEx
SMART	ITAM	UniProtKB/TrEMBL
	SM00409	UniProtKB/TrEMBL
Superfamily-SCOP	SSF48726	UniProtKB/TrEMBL
UniProt	A0A8I5Y5U3	ENTREZGENE, UniProtKB/TrEMBL
	A0A8J8XPU7_RAT	UniProtKB/TrEMBL
	A6HK39_RAT	UniProtKB/TrEMBL
	F1MAP5	ENTREZGENE
	O70153	ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary	F1MAP5	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-11-25	Cd79b	CD79b molecule	Cd79b	Cd79b molecule, immunoglobulin-associated beta	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-29	Cd79b	Cd79b molecule, immunoglobulin-associated beta	Cd79b	CD79B antigen	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Cd79b	CD79B antigen	Igb	immunoglobulin-associated beta	Symbol and Name updated	1299863	APPROVED
2002-08-07	Igb	immunoglobulin-associated beta			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_domains	immunoglobulin, membrane proximal, transmembrane, and cytoplasmic	625627
gene_expression	expressed early in B-cell development	625627
gene_homology	85% similar to the mouse and 69% similar to mouse and human amino acids	633033
gene_other	located between the polyadenylation site of Scn4a and the 5 end of Gh1	633033
gene_physical_interaction	forms a Iga(mb1)/Igb heterodimer to mediate signal transduction	625627
gene_protein	228 amino acids	625627
gene_transcript	gene is 3.1 kb in size and has 6 exons	633033
gene_transcript	a regulatory enhancer region was identified downstream of the gene and lacks the TATA box and has multiple transcriptional initiation sites	625627

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)