Symbol:
Ppt1
Name:
palmitoyl-protein thioesterase 1
RGD ID:
61994
Description:
Predicted to enable lysophosphatidic acid binding activity; sulfatide binding activity; and thiolester hydrolase activity. Predicted to be involved in several processes, including lysosomal lumen acidification; negative regulation of toll-like receptor 9 signaling pathway; and positive regulation of endocytosis. Predicted to act upstream of or within several processes, including endocytosis; grooming behavior; and regulation of phospholipase A2 activity. Located in neuronal cell body and synaptic vesicle. Human ortholog(s) of this gene implicated in neuronal ceroid lipofuscinosis 1. Orthologous to human PPT1 (palmitoyl-protein thioesterase 1); PARTICIPATES IN fatty acid elongation pathway; INTERACTS WITH 3H-1,2-dithiole-3-thione; ammonium chloride; bexarotene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
palmitoyl-protein hydrolase 1; palmitoyl-protein thioesterase; Ppt; PPT-1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 140,406,318 - 140,427,201 (+) NCBI GRCr8 mRatBN7.2 5 135,121,164 - 135,142,048 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 135,121,163 - 135,142,048 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 137,827,992 - 137,847,852 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 139,598,471 - 139,618,368 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 139,605,087 - 139,624,952 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 140,538,260 - 140,558,163 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 140,538,260 - 140,558,162 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 144,329,263 - 144,349,162 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 142,153,498 - 142,173,401 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 142,158,725 - 142,179,598 (+) NCBI Celera 5 133,659,813 - 133,679,711 (+) NCBI Celera RH 3.4 Map 5 890.0 RGD Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ppt1 Rat 1,2-dimethylhydrazine increases expression ISO Ppt1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of PPT1 mRNA CTD PMID:22206623 Ppt1 Rat 1-chloro-2,4-dinitrobenzene affects binding ISO PPT1 (Homo sapiens) 6480464 Dinitrochlorobenzene binds to PPT1 protein CTD PMID:32991956 Ppt1 Rat 17alpha-ethynylestradiol decreases expression ISO Ppt1 (Mus musculus) 6480464 Ethinyl Estradiol results in decreased expression of PPT1 mRNA CTD PMID:17555576 Ppt1 Rat 17beta-estradiol decreases expression ISO Ppt1 (Mus musculus) 6480464 Estradiol results in decreased expression of PPT1 mRNA CTD PMID:39298647 Ppt1 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO PPT1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Ppt1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ppt1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PPT1 mRNA CTD PMID:24680724 Ppt1 Rat 2,4,6-tribromophenol decreases expression ISO PPT1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Ppt1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Ppt1 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Ppt1 Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of PPT1 mRNA CTD PMID:19162173 Ppt1 Rat 4,4'-diaminodiphenylmethane increases expression ISO Ppt1 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of PPT1 mRNA CTD PMID:18648102 Ppt1 Rat 4,4'-sulfonyldiphenol decreases expression ISO Ppt1 (Mus musculus) 6480464 bisphenol S results in decreased expression of PPT1 mRNA CTD PMID:39298647 Ppt1 Rat acrolein multiple interactions ISO PPT1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of and results in increased oxidation of PPT1 mRNA more ... CTD PMID:32699268 and PMID:32845096 Ppt1 Rat all-trans-retinoic acid increases expression ISO PPT1 (Homo sapiens) 6480464 Tretinoin results in increased expression of PPT1 mRNA CTD PMID:33167477 Ppt1 Rat alpha-pinene multiple interactions ISO PPT1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of and results in increased oxidation of PPT1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of and results in increased oxidation of PPT1 mRNA CTD PMID:32699268 Ppt1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PPT1 mRNA CTD PMID:16483693 Ppt1 Rat antirheumatic drug decreases expression ISO PPT1 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of PPT1 mRNA CTD PMID:24449571 Ppt1 Rat aristolochic acid A decreases expression ISO PPT1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of PPT1 mRNA CTD PMID:33212167 Ppt1 Rat beauvericin multiple interactions ISO PPT1 (Homo sapiens) 6480464 [beauvericin co-treated with enniatins] results in decreased expression of PPT1 protein CTD PMID:32407736 Ppt1 Rat benzo[a]pyrene increases expression ISO Ppt1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PPT1 mRNA CTD PMID:22228805 and PMID:35678645 Ppt1 Rat benzo[a]pyrene increases expression ISO PPT1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of PPT1 mRNA CTD PMID:32234424 Ppt1 Rat benzo[a]pyrene affects methylation ISO PPT1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PPT1 promoter CTD PMID:27901495 Ppt1 Rat benzo[e]pyrene increases methylation ISO PPT1 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of PPT1 intron CTD PMID:30157460 Ppt1 Rat bexarotene decreases expression EXP 6480464 bexarotene results in decreased expression of PPT1 mRNA CTD PMID:16648578 Ppt1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Ppt1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of PPT1 mRNA CTD PMID:33162236 and PMID:33754040 Ppt1 Rat bisphenol A increases expression ISO PPT1 (Homo sapiens) 6480464 bisphenol A results in increased expression of PPT1 mRNA CTD PMID:20678512 Ppt1 Rat bisphenol A decreases expression ISO PPT1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of PPT1 protein CTD PMID:31675489 Ppt1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of PPT1 mRNA CTD PMID:25181051 Ppt1 Rat bisphenol AF increases expression ISO PPT1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of PPT1 protein CTD PMID:34186270 Ppt1 Rat cadmium atom multiple interactions ISO PPT1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PPT1 mRNA CTD PMID:35301059 Ppt1 Rat cadmium dichloride decreases expression ISO PPT1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of PPT1 mRNA CTD PMID:38568856 Ppt1 Rat cadmium dichloride multiple interactions ISO PPT1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PPT1 mRNA CTD PMID:35301059 Ppt1 Rat chloroquine multiple interactions ISO PPT1 (Homo sapiens) 6480464 Chloroquine analog binds to and results in decreased activity of PPT1 protein and Chloroquine binds to and results in decreased activity of PPT1 protein CTD PMID:30442709 Ppt1 Rat choline multiple interactions ISO Ppt1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of PPT1 mRNA CTD PMID:20938992 Ppt1 Rat cobalt dichloride decreases expression ISO PPT1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of PPT1 mRNA CTD PMID:19320972 Ppt1 Rat cyclosporin A decreases expression ISO PPT1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of PPT1 mRNA CTD PMID:20106945 and PMID:25562108 Ppt1 Rat cypermethrin decreases expression ISO Ppt1 (Mus musculus) 6480464 cypermethrin results in decreased expression of PPT1 mRNA CTD PMID:29020013 Ppt1 Rat D-glucitol increases expression ISO Ppt1 (Mus musculus) 6480464 Sorbitol results in increased expression of PPT1 mRNA CTD PMID:35678645 Ppt1 Rat decabromodiphenyl ether increases expression ISO PPT1 (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of PPT1 protein CTD PMID:31675489 Ppt1 Rat Dibutyl phosphate affects expression ISO PPT1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of PPT1 mRNA CTD PMID:37042841 Ppt1 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of PPT1 mRNA CTD PMID:21266533 Ppt1 Rat dibutyl phthalate decreases expression ISO Ppt1 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of PPT1 mRNA CTD PMID:17361019 and PMID:21266533 Ppt1 Rat diethylstilbestrol decreases expression ISO PPT1 (Homo sapiens) 6480464 Diethylstilbestrol results in decreased expression of PPT1 mRNA CTD PMID:36621641 Ppt1 Rat doxorubicin decreases expression ISO PPT1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PPT1 mRNA CTD PMID:29803840 Ppt1 Rat enniatin multiple interactions ISO PPT1 (Homo sapiens) 6480464 [beauvericin co-treated with enniatins] results in decreased expression of PPT1 protein CTD PMID:32407736 Ppt1 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of PPT1 mRNA CTD PMID:24136188 Ppt1 Rat folic acid multiple interactions ISO Ppt1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of PPT1 mRNA CTD PMID:20938992 Ppt1 Rat furan increases methylation EXP 6480464 furan results in increased methylation of PPT1 gene CTD PMID:22079235 Ppt1 Rat gallic acid decreases expression ISO PPT1 (Homo sapiens) 6480464 Gallic Acid results in decreased expression of PPT1 mRNA CTD PMID:34408198 Ppt1 Rat genistein affects expression ISO Ppt1 (Mus musculus) 6480464 Genistein affects the expression of PPT1 mRNA CTD PMID:32186404 Ppt1 Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of PPT1 mRNA CTD PMID:24136188 Ppt1 Rat glycidyl methacrylate decreases expression ISO PPT1 (Homo sapiens) 6480464 glycidyl methacrylate results in decreased expression of PPT1 protein CTD PMID:36641056 Ppt1 Rat glyphosate decreases expression EXP 6480464 Glyphosate results in decreased expression of PPT1 mRNA CTD PMID:26302742 Ppt1 Rat glyphosate increases expression ISO Ppt1 (Mus musculus) 6480464 Glyphosate results in increased expression of PPT1 mRNA CTD PMID:36608876 Ppt1 Rat hydroxychloroquine multiple interactions ISO PPT1 (Homo sapiens) 6480464 Hydroxychloroquine binds to and results in decreased activity of PPT1 protein CTD PMID:30442709 Ppt1 Rat indometacin decreases expression EXP 6480464 Indomethacin results in decreased expression of PPT1 mRNA CTD PMID:36868495 Ppt1 Rat ivermectin decreases expression ISO PPT1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of PPT1 protein CTD PMID:32959892 Ppt1 Rat L-methionine multiple interactions ISO Ppt1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of PPT1 mRNA CTD PMID:20938992 Ppt1 Rat methapyrilene increases methylation ISO PPT1 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of PPT1 intron CTD PMID:30157460 Ppt1 Rat N-methyl-4-phenylpyridinium decreases response to substance ISO Ppt1 (Mus musculus) 6480464 PPT1 protein results in decreased susceptibility to 1-Methyl-4-phenylpyridinium CTD PMID:27722792 Ppt1 Rat NAD zwitterion affects abundance ISO Ppt1 (Mus musculus) 6480464 PPT1 gene mutant form affects the abundance of NAD CTD PMID:21224254 Ppt1 Rat NAD(+) affects abundance ISO Ppt1 (Mus musculus) 6480464 PPT1 gene mutant form affects the abundance of NAD CTD PMID:21224254 Ppt1 Rat orlistat decreases expression ISO PPT1 (Homo sapiens) 6480464 Orlistat results in decreased expression of PPT1 protein CTD PMID:30667213 Ppt1 Rat ozone multiple interactions ISO PPT1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of and results in increased oxidation of PPT1 mRNA more ... CTD PMID:32699268 more ... Ppt1 Rat ozone multiple interactions ISO Ppt1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of PPT1 mRNA CTD PMID:34911549 Ppt1 Rat paclitaxel decreases expression ISO PPT1 (Homo sapiens) 6480464 Paclitaxel results in decreased expression of PPT1 protein CTD PMID:30667213 Ppt1 Rat paracetamol increases expression ISO PPT1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of PPT1 mRNA CTD PMID:22230336 Ppt1 Rat pentachlorophenol increases expression ISO Ppt1 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of PPT1 mRNA CTD PMID:23892564 Ppt1 Rat perfluorooctanoic acid increases expression ISO Ppt1 (Mus musculus) 6480464 perfluorooctanoic acid results in increased expression of PPT1 mRNA CTD PMID:35678645 Ppt1 Rat resveratrol multiple interactions ISO Ppt1 (Mus musculus) 6480464 resveratrol inhibits the reaction [PPT1 gene mutant form results in decreased expression of SYP protein] more ... CTD PMID:21224254 Ppt1 Rat sarin decreases expression ISO PPT1 (Homo sapiens) 6480464 Sarin results in decreased expression of PPT1 mRNA CTD PMID:19522546 Ppt1 Rat SB 431542 multiple interactions ISO PPT1 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of PPT1 protein CTD PMID:37664457 Ppt1 Rat silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of PPT1 mRNA CTD PMID:32721576 Ppt1 Rat sodium arsenite affects expression ISO PPT1 (Homo sapiens) 6480464 sodium arsenite affects the expression of PPT1 mRNA CTD PMID:29319823 Ppt1 Rat sodium azide increases response to substance ISO Ppt1 (Mus musculus) 6480464 PPT1 protein results in increased susceptibility to Sodium Azide CTD PMID:27722792 Ppt1 Rat sodium fluoride decreases expression ISO Ppt1 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of PPT1 protein CTD PMID:28918527 Ppt1 Rat sulindac decreases expression EXP 6480464 Sulindac results in decreased expression of PPT1 mRNA CTD PMID:24136188 Ppt1 Rat sulindac sulfide decreases expression ISO PPT1 (Homo sapiens) 6480464 sulindac sulfide results in decreased expression of PPT1 mRNA CTD PMID:16184548 Ppt1 Rat tamoxifen affects expression ISO Ppt1 (Mus musculus) 6480464 Tamoxifen affects the expression of PPT1 mRNA CTD PMID:17555576 Ppt1 Rat tetrachloromethane affects expression ISO Ppt1 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of PPT1 mRNA CTD PMID:17484886 Ppt1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of PPT1 mRNA CTD PMID:31150632 Ppt1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PPT1 mRNA CTD PMID:34492290 Ppt1 Rat thiram decreases expression ISO PPT1 (Homo sapiens) 6480464 Thiram results in decreased expression of PPT1 mRNA CTD PMID:38568856 Ppt1 Rat triphenyl phosphate affects expression ISO PPT1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PPT1 mRNA CTD PMID:37042841 Ppt1 Rat triptonide increases expression ISO Ppt1 (Mus musculus) 6480464 triptonide results in increased expression of PPT1 mRNA CTD PMID:33045310 Ppt1 Rat valproic acid decreases expression ISO PPT1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of PPT1 mRNA CTD PMID:23179753 Ppt1 Rat valproic acid increases expression ISO PPT1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of PPT1 mRNA CTD PMID:29154799
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
1,2-dimethylhydrazine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4,6-tribromophenol (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) acrolein (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) ammonium chloride (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) beauvericin (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bexarotene (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) cadmium atom (ISO) cadmium dichloride (ISO) chloroquine (ISO) choline (ISO) cobalt dichloride (ISO) cyclosporin A (ISO) cypermethrin (ISO) D-glucitol (ISO) decabromodiphenyl ether (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) diethylstilbestrol (ISO) doxorubicin (ISO) enniatin (ISO) finasteride (EXP) folic acid (ISO) furan (EXP) gallic acid (ISO) genistein (ISO) glafenine (EXP) glycidyl methacrylate (ISO) glyphosate (EXP,ISO) hydroxychloroquine (ISO) indometacin (EXP) ivermectin (ISO) L-methionine (ISO) methapyrilene (ISO) N-methyl-4-phenylpyridinium (ISO) NAD zwitterion (ISO) NAD(+) (ISO) orlistat (ISO) ozone (ISO) paclitaxel (ISO) paracetamol (ISO) pentachlorophenol (ISO) perfluorooctanoic acid (ISO) resveratrol (ISO) sarin (ISO) SB 431542 (ISO) silicon dioxide (EXP) sodium arsenite (ISO) sodium azide (ISO) sodium fluoride (ISO) sulindac (EXP) sulindac sulfide (ISO) tamoxifen (ISO) tetrachloromethane (EXP,ISO) thioacetamide (EXP) thiram (ISO) triphenyl phosphate (ISO) triptonide (ISO) valproic acid (ISO)
Biological Process
adult locomotory behavior (IEA,ISO) associative learning (IEA,ISO) brain development (IEA,ISO,ISS) endocytosis (IBA) grooming behavior (IEA,ISO) lipid catabolic process (IEA,ISO,ISS) lysosomal lumen acidification (IEA,ISO,ISS) lysosome organization (IEA,ISO) macromolecule catabolic process (IEA,ISO) macromolecule depalmitoylation (IEA) membrane raft organization (IEA,ISO,ISS) negative regulation of apoptotic process (IEA,ISO,ISS) negative regulation of cell growth (IEA,ISO,ISS) negative regulation of neuron apoptotic process (IEA,ISO,ISS) negative regulation of toll-like receptor 9 signaling pathway (IEA,ISO) nervous system development (IBA,IEA,ISO,ISS) neurotransmitter secretion (IEA,ISO) pinocytosis (IEA,ISO) positive regulation of pinocytosis (IEA,ISO,ISS) positive regulation of receptor-mediated endocytosis (IEA,ISO,ISS) protein catabolic process (IEA,ISO) protein depalmitoylation (ISO,ISS) protein transport (IEA,ISO,ISS) receptor-mediated endocytosis (IEA,ISO) regulation of synaptic plasticity (TAS) visual perception (IEA,ISO)
Cellular Component
axon (IEA,ISO,ISS) cytosol (ISS) dendrite (IEA,ISO) extracellular region (IBA,IEA,ISO,ISS) extracellular space (IEA,ISO) Golgi apparatus (IEA,ISO,ISS) intracellular membrane-bounded organelle (IEA,ISO) lysosomal membrane (IEA,ISO) lysosome (IBA,IEA,ISO,ISS) membrane raft (IEA,ISO,ISS) neuronal cell body (IDA,IEA,ISO) nucleus (IEA,ISO,ISS) presynaptic cytosol (IEA,ISO) synaptic vesicle (IDA,IEA,ISO,ISS) synaptic vesicle membrane (IEA,ISO)
1.
Molecular cloning and expression of palmitoyl-protein thioesterase.
Camp LA, etal., J Biol Chem 1994 Sep 16;269(37):23212-9.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
Disruption of PPT1 or PPT2 causes neuronal ceroid lipofuscinosis in knockout mice.
Gupta P, etal., Proc Natl Acad Sci U S A 2001 Nov 20;98(24):13566-71.
5.
Human palmitoyl protein thioesterase: evidence for lysosomal targeting of the enzyme and disturbed cellular routing in infantile neuronal ceroid lipofuscinosis.
Hellsten E, etal., EMBO J. 1996 Oct 1;15(19):5240-5.
6.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
7.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
8.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
10.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
11.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
12.
GOA pipeline
RGD automated data pipeline
13.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
15.
Status epilepticus induces changes in the expression and localization of endogenous palmitoyl-protein thioesterase 1.
Suopanki J, etal., Neurobiol Dis 2002 Aug;10(3):247-57.
16.
Palmitoyl-protein thioesterase, an enzyme implicated in neurodegeneration, is localized in neurons and is developmentally regulated in rat brain.
Suopanki J, etal., Neurosci Lett. 1999 Apr 9;265(1):53-6.
17.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
Ppt1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 140,406,318 - 140,427,201 (+) NCBI GRCr8 mRatBN7.2 5 135,121,164 - 135,142,048 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 135,121,163 - 135,142,048 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 137,827,992 - 137,847,852 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 139,598,471 - 139,618,368 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 139,605,087 - 139,624,952 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 140,538,260 - 140,558,163 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 140,538,260 - 140,558,162 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 144,329,263 - 144,349,162 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 142,153,498 - 142,173,401 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 142,158,725 - 142,179,598 (+) NCBI Celera 5 133,659,813 - 133,679,711 (+) NCBI Celera RH 3.4 Map 5 890.0 RGD Cytogenetic Map 5 q36 NCBI
PPT1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 40,071,461 - 40,097,252 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 40,072,710 - 40,097,260 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 40,537,133 - 40,562,924 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 40,310,969 - 40,335,555 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 40,207,476 - 40,232,061 NCBI Celera 1 38,820,669 - 38,845,442 (-) NCBI Celera Cytogenetic Map 1 p34.2 NCBI HuRef 1 38,656,433 - 38,681,192 (-) NCBI HuRef CHM1_1 1 40,653,983 - 40,678,773 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 39,940,889 - 39,966,711 (-) NCBI T2T-CHM13v2.0
Ppt1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 122,729,879 - 122,752,968 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 122,730,035 - 122,752,968 (+) Ensembl GRCm39 Ensembl GRCm38 4 122,836,077 - 122,859,175 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 122,836,242 - 122,859,175 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 122,513,485 - 122,536,418 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 122,338,558 - 122,360,685 (+) NCBI MGSCv36 mm8 Celera 4 121,166,717 - 121,189,624 (+) NCBI Celera Cytogenetic Map 4 D2.2 NCBI cM Map 4 57.27 NCBI
Ppt1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955452 17,529,115 - 17,549,664 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955452 17,518,345 - 17,549,112 (-) NCBI ChiLan1.0 ChiLan1.0
PPT1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 186,729,114 - 186,753,833 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 185,866,794 - 185,891,455 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 39,358,424 - 39,383,087 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 40,683,841 - 40,708,609 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 40,683,841 - 40,708,609 (-) Ensembl panpan1.1 panPan2
PPT1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 2,815,428 - 2,886,474 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 15 2,859,979 - 2,894,425 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 3,117,325 - 3,143,210 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 2,902,313 - 2,973,313 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 15 2,946,653 - 2,981,365 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 15 2,854,181 - 2,880,060 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 2,914,086 - 2,939,964 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 2,930,482 - 2,956,365 (+) NCBI UU_Cfam_GSD_1.0
Ppt1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 56,056,908 - 56,081,782 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 21,881,712 - 21,906,569 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 21,881,692 - 21,906,564 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PPT1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 95,840,908 - 95,860,858 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 95,840,906 - 95,860,858 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 89,280,518 - 89,300,475 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PPT1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 92,809,373 - 92,833,048 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 92,809,552 - 92,833,244 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 24,006,277 - 24,030,955 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ppt1
.
Predicted Target Of
Count of predictions: 161 Count of miRNA genes: 115 Interacting mature miRNAs: 144 Transcripts: ENSRNOT00000017998 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331796 Thshl2 Thyroid stimulating hormone level QTL 2 2.3 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 5 97059760 147465714 Rat 10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 1300122 Wbc1 White blood cell count QTL 1 2.75 leukocyte quantity (VT:0000217) total white blood cell count (CMO:0000365) 5 125392826 139989768 Rat 61452 Ciaa5 CIA Autoantibody QTL 5 3.5 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 5 94858972 143070159 Rat 70156 Niddm30 Non-insulin dependent diabetes mellitus QTL 30 3.98 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 5 129132447 151006154 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 1331803 Rf32 Renal function QTL 32 2.798 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 129132428 143070159 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 7207486 Bss109 Bone structure and strength QTL 109 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 5 106906205 151906205 Rat 7207481 Bss106 Bone structure and strength QTL 106 7.9 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 106906205 151906205 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 631505 Bp103 Blood pressure QTL 103 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 132717196 165560427 Rat 1549838 Bss4 Bone structure and strength QTL 4 9.2 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 5 106906205 151906205 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 2317753 Glom24 Glomerulus QTL 24 3.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 5 97570330 136479578 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 1581510 Cm54 Cardiac mass QTL 54 3.4 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 5 120740824 143608494 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 2317056 Wbc3 White blood cell count QTL 3 2.51 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 5 105999803 150999803 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 2293642 Bss37 Bone structure and strength QTL 37 4.64 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 120740824 151018848 Rat 1578673 Bmd13 Bone mineral density QTL 13 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 5 103689353 148689353 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 7207488 Bss110 Bone structure and strength QTL 1 8.4 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 5 106906205 151906205 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 631527 Tls1 T-lymphoma susceptibility QTL 1 0 0.001 thymus integrity trait (VT:0010555) post-insult time to onset of T-cell lymphoma (CMO:0001907) 5 90450144 135450144 Rat 7207491 Bss112 Bone structure and strength QTL 112 7 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 5 106906205 151906205 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat 7411722 Strs6 Sensitivity to stroke QTL 6 3.9 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 5 134972980 138113556 Rat 1358187 Emca1 Estrogen-induced mammary cancer QTL 1 4.4 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 5 99216724 148607142 Rat
Ppt
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 135,141,351 - 135,141,556 (+) MAPPER mRatBN7.2 Rnor_6.0 5 140,558,439 - 140,558,643 NCBI Rnor6.0 Rnor_5.0 5 144,349,438 - 144,349,642 UniSTS Rnor5.0 RGSC_v3.4 5 142,173,677 - 142,173,881 UniSTS RGSC3.4 Celera 5 133,679,987 - 133,680,191 UniSTS Cytogenetic Map 5 q36 UniSTS
RH142418
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 135,141,673 - 135,141,856 (+) MAPPER mRatBN7.2 Rnor_6.0 5 140,558,761 - 140,558,943 NCBI Rnor6.0 Rnor_5.0 5 144,349,760 - 144,349,942 UniSTS Rnor5.0 RGSC_v3.4 5 142,173,999 - 142,174,181 UniSTS RGSC3.4 Celera 5 133,680,309 - 133,680,491 UniSTS RH 3.4 Map 5 890.0 UniSTS Cytogenetic Map 5 q36 UniSTS
RH127550
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 135,141,796 - 135,142,005 (+) MAPPER mRatBN7.2 Rnor_6.0 5 140,558,884 - 140,559,092 NCBI Rnor6.0 Rnor_5.0 5 144,349,883 - 144,350,091 UniSTS Rnor5.0 RGSC_v3.4 5 142,174,122 - 142,174,330 UniSTS RGSC3.4 Celera 5 133,680,432 - 133,680,640 UniSTS RH 3.4 Map 5 876.9 UniSTS Cytogenetic Map 5 q36 UniSTS
AA851880
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 5 140,427,338 - 140,427,529 (+) Marker Load Pipeline mRatBN7.2 5 135,142,185 - 135,142,377 (+) MAPPER mRatBN7.2 Rnor_6.0 5 140,559,273 - 140,559,463 NCBI Rnor6.0 Rnor_5.0 5 144,350,272 - 144,350,462 UniSTS Rnor5.0 RGSC_v3.4 5 142,174,511 - 142,174,701 UniSTS RGSC3.4 Celera 5 133,680,821 - 133,681,011 UniSTS RH 3.4 Map 5 900.7 UniSTS Cytogenetic Map 5 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000017998 ⟹ ENSRNOP00000017998
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 135,121,173 - 135,141,080 (+) Ensembl Rnor_6.0 Ensembl 5 140,538,260 - 140,558,162 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000109802 ⟹ ENSRNOP00000084196
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 135,126,095 - 135,142,048 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000111724 ⟹ ENSRNOP00000093361
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 135,121,163 - 135,132,782 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000112154 ⟹ ENSRNOP00000091845
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 135,121,163 - 135,142,048 (+) Ensembl
RefSeq Acc Id:
NM_022502 ⟹ NP_071947
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 140,406,318 - 140,427,201 (+) NCBI mRatBN7.2 5 135,121,164 - 135,142,048 (+) NCBI Rnor_6.0 5 140,538,260 - 140,558,163 (+) NCBI Rnor_5.0 5 144,329,263 - 144,349,162 (+) NCBI RGSC_v3.4 5 142,153,498 - 142,173,401 (+) RGD Celera 5 133,659,813 - 133,679,711 (+) RGD
Sequence:
AGATGGCGTCGCCCGGTTACCGGAGGCTGCTAGCTGCGGCTCTGCTTCCTTGGTGTTGCGCCGCCTGGGCCCTGGGACATCTGGACCCACCTTCTCCACCACCGCTGGTGATCTGGCATGGGATGGGG
hide sequence
RefSeq Acc Id:
NP_071947 ⟸ NM_022502
- Peptide Label:
precursor
- UniProtKB:
A0JN20 (UniProtKB/Swiss-Prot), P45479 (UniProtKB/Swiss-Prot), A6IS08 (UniProtKB/TrEMBL), A0A8I6A0R6 (UniProtKB/TrEMBL)
- Sequence:
MASPGYRRLLAAALLPWCCAAWALGHLDPPSPPPLVIWHGMGDSCCNPMSMGSIKKMVEKEIPGIYVLSLEIGKNMVEDVENSFFLNVNLQVGMACQILEKDPKLQHGYNAIGFSQGGQFLRAVAQRC
hide sequence
Ensembl Acc Id:
ENSRNOP00000017998 ⟸ ENSRNOT00000017998
Ensembl Acc Id:
ENSRNOP00000093361 ⟸ ENSRNOT00000111724
Ensembl Acc Id:
ENSRNOP00000091845 ⟸ ENSRNOT00000112154
Ensembl Acc Id:
ENSRNOP00000084196 ⟸ ENSRNOT00000109802
RGD ID: 13693998 Promoter ID: EPDNEW_R4523 Type: multiple initiation site Name: Ppt1_1 Description: palmitoyl-protein thioesterase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 140,538,248 - 140,538,308 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2006-03-30
Ppt1
palmitoyl-protein thioesterase 1
Ppt
palmitoyl-protein thioesterase
Name updated
1299863 APPROVED
2002-06-10
Ppt
palmitoyl-protein thioesterase
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_regulation
induced by epileptic seizures
633701
