Advanced Search (OLGA)

Gene: Gabarap (GABA type A receptor-associated protein) Rattus norvegicus

Analyze

Symbol:

Gabarap

Name:

GABA type A receptor-associated protein

RGD ID:

61911

Description:

Enables GABA receptor binding activity. Predicted to be involved in several processes, including macroautophagy; positive regulation of protein metabolic process; and regulation of neurotransmitter receptor localization to postsynaptic specialization membrane. Predicted to act upstream of or within microtubule cytoskeleton organization. Located in cell body and perinuclear region of cytoplasm. Is active in GABA-ergic synapse and postsynaptic specialization, intracellular component. Orthologous to human GABARAP (GABA type A receptor-associated protein); PARTICIPATES IN autophagy pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrotoluene; ammonium chloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

GABA(A) receptor-associated protein; gamma-aminobutyric acid receptor associated protein; gamma-aminobutyric acid receptor-associated protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	55,213,465 - 55,216,787 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	55,212,075 - 55,216,154 (+)	Ensembl				GRCr8
mRatBN7.2	10	54,714,777 - 54,718,099 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	54,714,198 - 54,717,765 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	59,376,972 - 59,380,294 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	58,865,552 - 58,868,874 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	54,372,830 - 54,376,146 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	56,601,288 - 56,604,223 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	56,601,288 - 56,604,221 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	56,346,407 - 56,349,342 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	56,837,772 - 56,840,707 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	53,868,419 - 53,871,353 (+)	NCBI		Celera
RGSC_v3.1	10	56,851,394 - 56,854,330 (+)	NCBI
Cytogenetic Map	10	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-alpha-phellandrene (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3-methyladenine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-nitrophenol (ISO)

acetylsalicylic acid (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-phellandrene (ISO)

ammonium chloride (EXP)

arsenite(3-) (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

cadmium atom (ISO)

cadmium dichloride (EXP)

captan (ISO)

chlormequat chloride (EXP)

chlorpyrifos (ISO)

clofibrate (ISO)

copper(II) chloride (ISO)

dexamethasone (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP)

dicyclanil (ISO)

doxorubicin (ISO)

Erionite (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

fenthion (ISO)

fenvalerate (EXP)

folic acid (ISO)

folpet (ISO)

formaldehyde (ISO)

gentamycin (EXP)

hexadecanoic acid (ISO)

hydralazine (ISO)

indometacin (ISO)

L-ascorbic acid (ISO)

methidathion (ISO)

methyl methanesulfonate (ISO)

rac-lactic acid (ISO)

raloxifene (EXP)

resveratrol (ISO)

sarin (ISO)

sirolimus (ISO)

sodium arsenite (ISO)

sodium dichromate (ISO)

Soman (EXP)

stigmasterol (ISO)

testosterone (EXP)

tetrachloromethane (ISO)

titanium dioxide (ISO)

toluene (EXP)

triadimefon (EXP)

triphenyl phosphate (ISO)

triptonide (ISO)

valproic acid (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

apoptotic process (IEA)

autophagosome assembly (IBA)

autophagosome maturation (IBA)

autophagy (IEA)

cellular response to nitrogen starvation (IBA)

extrinsic apoptotic signaling pathway via death domain receptors (ISO,ISS)

microtubule cytoskeleton organization (ISO)

mitophagy (IBA)

positive regulation of proteasomal ubiquitin-dependent protein catabolic process (ISO,ISS)

positive regulation of protein K48-linked ubiquitination (ISO,ISS)

protein transport (IEA)

regulation of neurotransmitter receptor localization to postsynaptic specialization membrane (ISO)

regulation of Rac protein signal transduction (ISO,ISS)

Cellular Component

actin cytoskeleton (ISO)

autophagosome (ISO,ISS)

autophagosome membrane (IBA,IEA,ISO)

axoneme (ISO,ISS)

cell body (IDA)

cytoplasmic vesicle (IEA)

cytoskeleton (IEA)

endomembrane system (IEA)

GABA-ergic synapse (IDA,ISO)

Golgi apparatus (ISO)

Golgi membrane (IEA)

lysosome (ISO)

membrane (IEA)

microtubule (IEA)

microtubule associated complex (ISO)

perinuclear region of cytoplasm (IDA)

plasma membrane (ISO)

postsynaptic specialization, intracellular component (IDA)

smooth endoplasmic reticulum (ISO)

sperm midpiece (ISO)

Molecular Function

beta-tubulin binding (ISO)

GABA receptor binding (IBA,IPI,ISO)

microtubule binding (ISO)

phosphatidylethanolamine binding (IBA,ISO)

protein binding (IPI,ISO)

ubiquitin protein ligase binding (IBA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

autophagy pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Network organization of the human autophagy system.	Behrends C, etal., Nature. 2010 Jul 1;466(7302):68-76. Epub 2010 Jun 20.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	The subcellular distribution of GABARAP and its ability to interact with NSF suggest a role for this protein in the intracellular transport of GABA(A) receptors.	Kittler JT, etal., Mol Cell Neurosci. 2001 Jul;18(1):13-25. doi: 10.1006/mcne.2001.1005.
5.	GABAA receptor-associated protein traffics GABAA receptors to the plasma membrane in neurons.	Leil TA, etal., J Neurosci. 2004 Dec 15;24(50):11429-38.
6.	NMDA receptor activation potentiates inhibitory transmission through GABA receptor-associated protein-dependent exocytosis of GABA(A) receptors.	Marsden KC, etal., J Neurosci. 2007 Dec 26;27(52):14326-37.
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	Electronic Annotations Based on Mouse Homologs (MGI)	MGI
9.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
11.	GOA pipeline	RGD automated data pipeline
12.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
14.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
15.	LC3 conjugation system in mammalian autophagy.	Tanida I, etal., Int J Biochem Cell Biol. 2004 Dec;36(12):2503-18.
16.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data

Additional References at PubMed

PMID:9892355	PMID:10899939	PMID:10900017	PMID:11146101	PMID:11818336	PMID:15169837	PMID:15489334	PMID:15814572	PMID:15977068	PMID:16431922	PMID:17581952	PMID:17916189
PMID:18027972	PMID:19056683	PMID:19766149	PMID:22033522	PMID:24089209	PMID:24240096	PMID:25127057	PMID:25684710

Genomics

Comparative Map Data

Gabarap
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	55,213,465 - 55,216,787 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	55,212,075 - 55,216,154 (+)	Ensembl				GRCr8
mRatBN7.2	10	54,714,777 - 54,718,099 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	54,714,198 - 54,717,765 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	59,376,972 - 59,380,294 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	58,865,552 - 58,868,874 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	54,372,830 - 54,376,146 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	56,601,288 - 56,604,223 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	56,601,288 - 56,604,221 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	56,346,407 - 56,349,342 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	56,837,772 - 56,840,707 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	53,868,419 - 53,871,353 (+)	NCBI		Celera
RGSC_v3.1	10	56,851,394 - 56,854,330 (+)	NCBI
Cytogenetic Map	10	q24	NCBI

GABARAP
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	7,240,008 - 7,242,449 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	7,240,008 - 7,242,449 (-)	Ensembl			hg38	GRCh38
GRCh37	17	7,143,327 - 7,145,768 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	7,084,462 - 7,086,477 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	17	7,084,462 - 7,086,477	NCBI
Celera	17	7,168,385 - 7,170,397 (-)	NCBI		Celera
Cytogenetic Map	17	p13.1	NCBI
HuRef	17	7,035,144 - 7,037,156 (-)	NCBI		HuRef
CHM1_1	17	7,152,530 - 7,154,546 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	7,140,933 - 7,143,371 (-)	NCBI		T2T-CHM13v2.0

Gabarap
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	69,882,196 - 69,885,775 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	69,881,969 - 69,885,777 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	11	69,991,370 - 69,994,949 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	69,991,143 - 69,994,951 (+)	Ensembl			mm10	GRCm38
MGSCv37	11	69,804,872 - 69,808,451 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	11	69,807,565 - 69,811,141 (+)	NCBI		MGSCv36	mm8
Celera	11	77,539,180 - 77,542,759 (+)	NCBI		Celera
Cytogenetic Map	11	B3	NCBI
cM Map	11	42.95	NCBI

Gabarap
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955467	9,667,941 - 9,670,067 (+)	Ensembl
ChiLan1.0	NW_004955467	9,667,938 - 9,670,067 (+)	NCBI	ChiLan1.0	ChiLan1.0

GABARAP
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	14,833,095 - 14,836,107 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	16,799,099 - 16,801,668 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	7,270,316 - 7,272,365 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	7,257,659 - 7,260,276 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	7,257,659 - 7,260,276 (-)	Ensembl			panPan2	panpan1.1

GABARAP
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	32,207,879 - 32,209,976 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	32,207,887 - 32,209,908 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	32,346,200 - 32,348,297 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	32,313,526 - 32,315,623 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	32,313,534 - 32,315,555 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	32,278,810 - 32,280,907 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	32,237,838 - 32,239,935 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	32,414,791 - 32,416,888 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Gabarap
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	47,059,854 - 47,061,872 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936595	533,977 - 536,271 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936595	534,042 - 536,289 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GABARAP
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	52,596,543 - 52,598,194 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	12	52,596,130 - 52,598,166 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	54,842,339 - 54,844,400 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GABARAP
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	6,614,478 - 6,616,516 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	6,614,688 - 6,616,443 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666059	14,793,285 - 14,796,280 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gabarap
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624786	9,857,370 - 9,860,063 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624786	9,857,370 - 9,859,675 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Gabarap
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	9	49,598,028 - 49,601,746 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Gabarap
51 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	76
Count of miRNA genes:	58
Interacting mature miRNAs:	74
Transcripts:	ENSRNOT00000023724
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61441	Btemp1	Thermal response to stress QTL 1	4		body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	10	35893451	64140567	Rat
1549846	Scl47	Serum cholesterol level QTL 47	3.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	51071897	96071897	Rat
152025229	Scl83	Serum cholesterol level QTL 83	4.33		blood cholesterol amount (VT:0000180)		10	36211556	69161158	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31796281	76796281	Rat
152025227	Bw195	Body weight QTL 195	5.73		body mass (VT:0001259)		10	47489017	69161158	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15776754	60776754	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	27023535	98502431	Rat
2293669	Bmd33	Bone mineral density QTL 33	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	10	27443787	72443787	Rat
152025224	Bw193	Body weight QTL 193	6.47		body mass (VT:0001259)		10	52162433	75582749	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	35509383	91417879	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1250554	64349221	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
2293679	Bmd30	Bone mineral density QTL 30	3.5	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	27443787	72443787	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42546145	107713808	Rat
1578762	Toxo1	Toxoplasma gondii resistance QTL 1			brain integrity trait (VT:0010579)	percentage of study population displaying Toxoplasma gondii brain cysts at a point in time (CMO:0002028)	10	52699004	59876693	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	19939207	64939207	Rat
61332	Eau3	Experimental allergic uveoretinitis QTL 3		0.004	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	18035782	63035782	Rat
70164	Bw21	Body weight QTL 21	4.36	0.00005	body mass (VT:0001259)	body weight (CMO:0000012)	10	54296336	99451733	Rat
61463	Bp12	Blood pressure QTL 12	6.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	41831278	86831278	Rat
1579919	Bp281	Blood pressure QTL 281		0.01	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	50464802	95464802	Rat
8694173	Bw149	Body weight QTL 149	4.38	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	10	44939359	89939359	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45529164	96099749	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	54296227	107713808	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18668419	63668419	Rat
1581497	Esta1	Estrogen-induced thymic atrophy QTL 1			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	21833758	61843633	Rat
10450493	Bp382	Blood pressure QTL 382		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	50860288	95860288	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28950353	73950353	Rat
1358897	Stresp6	Stress response QTL 6	4.17	0.022	blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	35893263	64653589	Rat
1331762	Rf40	Renal function QTL 40	3.873		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	10	29800910	64653589	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	27443787	72443787	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14991535	86964295	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	42823274	87823274	Rat
9589030	Epfw9	Epididymal fat weight QTL 9	19.24	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	10	44939359	89939359	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14991535	107556066	Rat
2293652	Bmd22	Bone mineral density QTL 22	4.9	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	27443787	72443787	Rat
70198	BpQTLcluster9	Blood pressure QTL cluster 9	2.94		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	42823274	87823274	Rat
2306787	Ean3	Experimental allergic neuritis QTL 3	3.1		nervous system integrity trait (VT:0010566)	body weight loss (CMO:0001399)	10	54296227	67476781	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22931373	91127454	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6660923	73950353	Rat
2306792	Ean4	Experimental allergic neuritis QTL 4	4		nervous system integrity trait (VT:0010566)	IFNG-secreting splenocyte count (CMO:0002122)	10	49495492	94495492	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	52269185	107713808	Rat
1354585	Eae18a	Experimental allergic encephalomyelitis QTL 18a	7.5	0.0004	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	10	54296227	58944345	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	14653541	59653541	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15533012	73695498	Rat
634329	Pia15	Pristane induced arthritis QTL 15	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	24662123	73695339	Rat
70224	Eae3	Experimental allergic encephalomyelitis QTL 3	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	27023535	61843633	Rat
2298480	Eau7	Experimental allergic uveoretinitis QTL 7		0.0049	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	35509383	80509383	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29800910	91417879	Rat
2298495	Eae23	Experimental allergic encephalomyelitis QTL 23	16.93		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis duration (CMO:0001424)	10	16175525	61175525	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	20110614	65110614	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	27587226	96099902	Rat
2289985	Bp305	Blood pressure QTL 305			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	29076978	74076978	Rat
631532	Cm50	Cardiac mass QTL 50	6.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	18035782	63035782	Rat
8552805	Bw145	Body weight QTL 145	2.2		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	10	43608793	88608793	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
2293705	Bmd25	Bone mineral density QTL 25	7.1	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	27443787	72443787	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40535708	107713808	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14991535	107713808	Rat
7207811	Bmd90	Bone mineral density QTL 90	5.2		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	10	49943710	94943710	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31129113	76129113	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
7411614	Foco18	Food consumption QTL 18		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	44939359	89939359	Rat
631547	Bp87	Blood pressure QTL 87	4.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	47869129	92869129	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6864618	96620484	Rat
12880050	Am10	Aortic mass QTL 10		0.016	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	39503487	84503487	Rat
2292436	Bp310	Blood pressure QTL 310			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	50604677	95604677	Rat
6893342	Cm78	Cardiac mass QTL 78	0.1	0.88	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	35509383	88177745	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	20110614	65110614	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	27023535	99451848	Rat

Markers in Region

RH128955

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_5.0	4	190,527,965 - 190,528,140	NCBI	Rnor5.0
Rnor_5.0	10	56,349,164 - 56,349,340	NCBI	Rnor5.0
RGSC_v3.4	10	56,840,530 - 56,840,705	UniSTS	RGSC3.4
RGSC_v3.4	4	128,311,608 - 128,311,782	UniSTS	RGSC3.4
Celera	10	53,871,176 - 53,871,351	UniSTS
Celera	4	115,437,302 - 115,437,476	UniSTS
RH 3.4 Map	4	757.8	UniSTS
Cytogenetic Map	10	q24	UniSTS
Cytogenetic Map	4	q34	UniSTS

UniSTS:224312

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	54,717,653 - 54,717,766 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	56,604,108 - 56,604,220	NCBI	Rnor6.0
Rnor_5.0	10	56,349,227 - 56,349,339	UniSTS	Rnor5.0
RGSC_v3.4	10	56,840,592 - 56,840,704	UniSTS	RGSC3.4
Celera	10	53,871,238 - 53,871,350	UniSTS
Cytogenetic Map	10	q24	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_172036	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF161588	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC058441	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213199	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224284	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227125	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229256	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ231156	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000023724 ⟹ ENSRNOP00000023724

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	55,212,075 - 55,216,154 (+)	Ensembl
mRatBN7.2 Ensembl	10	54,714,198 - 54,717,765 (+)	Ensembl
Rnor_6.0 Ensembl	10	56,601,288 - 56,604,221 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000095189 ⟹ ENSRNOP00000083334

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	54,714,198 - 54,717,696 (+)	Ensembl

RefSeq Acc Id:

NM_172036 ⟹ NP_742033

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	55,213,465 - 55,216,787 (+)	NCBI
mRatBN7.2	10	54,714,777 - 54,718,099 (+)	NCBI
Rnor_6.0	10	56,601,288 - 56,604,223 (+)	NCBI
Rnor_5.0	10	56,346,407 - 56,349,342 (+)	NCBI
RGSC_v3.4	10	56,837,772 - 56,840,707 (+)	RGD
Celera	10	53,868,419 - 53,871,353 (+)	RGD

Sequence:

show sequence

CCCCCTGGGTTCCCTCAGCCCAGCTCGGTCCAGCCCGGTTCTCGGGAGAATGAAGTTCGTGTAC
AAAGAGGAGCATCCGTTCGAGAAGCGCCGCTCTGAGGGCGAGAAAATCCGAAAGAAATACCCAG
ACCGGGTCCCGGTGATAGTGGAAAAAGCTCCCAAAGCTCGGATAGGGGACCTGGACAAAAAGAA
ATACTTGGTGCCTTCTGATCTTACAGTTGGTCAATTCTACTTCTTGATCCGGAAGCGAATTCAT
CTCCGTGCTGAAGATGCCTTGTTTTTCTTTGTCAACAATGTCATTCCACCCACCAGTGCCACGA
TGGGTCAGCTGTACCAGGAACACCATGAAGAAGACTTCTTTCTATACATTGCCTACAGTGATGA
AAGCGTCTACGGTCTGTGAAGTTGCTGTCCCGGAGGTGGGGGTTCCATTCTACAAAGAGAGGTG
GCGCTCCTTCCTTGGCATCCAGTTCCTCCTTCAGGCTCAAACACCATCTCCTTTCTTCAGGACC
TGCACTTAATGTTTGAGGCTGTCTCTCCAGTCCCTCTGAGCAGGAGGGGTAATGGTAGATGCAG
CCGCTGTACATCTCTCTTTCCCCTTGTTTACCCTCCATTCCCACTCTGCTTTAGACTTCTGGAT
TGTCGATCTCTGTCACATCGGATGATTGTTTTGGTTTCTATTCCCTTTCTAACTGCCCACTGGG
CTCAGAACCCCAATAAACCCTTCCTTTCACTACCTTCTTTTTGGGGGGTAGATGGAAGGGGTTG
ACATTGGGTGGGGGAGGTAGGAGGCACATCAATAAAGAGGAAACCACCGAGCTGAAATAAAAAA
AAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_742033	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAD47643	(Get FASTA)	NCBI Sequence Viewer
	AAH58441	(Get FASTA)	NCBI Sequence Viewer
	EDM04951	(Get FASTA)	NCBI Sequence Viewer
	EDM04952	(Get FASTA)	NCBI Sequence Viewer
	EDM04953	(Get FASTA)	NCBI Sequence Viewer
	P60517	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_742033 ⟸ NM_172036
- UniProtKB:	Q9QUI7 (UniProtKB/Swiss-Prot), P60517 (UniProtKB/Swiss-Prot), A6HFZ8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLI RKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL hide sequence

Ensembl Acc Id:

ENSRNOP00000023724 ⟸ ENSRNOT00000023724

Ensembl Acc Id:

ENSRNOP00000083334 ⟸ ENSRNOT00000095189

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P60517-F1-model_v2	AlphaFold	P60517	1-117	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697342

Promoter ID:

EPDNEW_R7867

Type:

initiation region

Name:

Gabarap_1

Description:

GABA type A receptor-associated protein

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	56,601,239 - 56,601,299	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:61911	AgrOrtholog
BioCyc Gene	G2FUF-24492	BioCyc
Ensembl Genes	ENSRNOG00000017417	Ensembl
Gene3D-CATH	Phosphatidylinositol 3-kinase Catalytic Subunit, Chain A, domain 1	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:6918795	IMAGE-MGC_LOAD
InterPro	Atg8-like	UniProtKB/Swiss-Prot
	Ubiquitin-like_domsf	UniProtKB/Swiss-Prot
KEGG Report	rno:58974	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72672	IMAGE-MGC_LOAD
NCBI Gene	58974	ENTREZGENE
PANTHER	PTHR10969	UniProtKB/Swiss-Prot
Pfam	Atg8	UniProtKB/Swiss-Prot
PhenoGen	Gabarap	PhenoGen
RatGTEx	ENSRNOG00000017417	RatGTEx
Superfamily-SCOP	SSF54236	UniProtKB/Swiss-Prot
TIGR	TC228981
UniProt	A0A8L2UJV4_RAT	UniProtKB/TrEMBL
	A6HFZ6_RAT	UniProtKB/TrEMBL
	A6HFZ7_RAT	UniProtKB/TrEMBL
	A6HFZ8	ENTREZGENE, UniProtKB/TrEMBL
	GBRAP_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q9QUI7	ENTREZGENE
UniProt Secondary	Q9QUI7	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-29	Gabarap	GABA type A receptor-associated protein	Gabarap	GABA(A) receptor-associated protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-19	Gabarap	GABA(A) receptor-associated protein	Gabarap	gamma-aminobutyric acid receptor associated protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Gabarap	gamma-aminobutyric acid receptor associated protein			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

RGD Manual Annotations

Imported Annotations - KEGG (archival)