Advanced Search (OLGA)

Gene: Gdi2 (GDP dissociation inhibitor 2) Rattus norvegicus

Analyze

Symbol:

Gdi2

Name:

GDP dissociation inhibitor 2

RGD ID:

61802

Description:

Enables Rab GDP-dissociation inhibitor activity and small GTPase binding activity. Involved in vesicle-mediated transport. Is active in synapse. Orthologous to human GDI2 (GDP dissociation inhibitor 2); PARTICIPATES IN Rab family mediated signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2-ethoxyethanol; 2-methoxyethanol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

GDI-2; GDI-3; Gdi3; guanosine diphosphate (GDP) dissociation inhibitor 3; guanosine diphosphate dissociation inhibitor 2; guanosine diphosphate dissociation inhibitor 3; rab GDI beta; rab GDP dissociation inhibitor beta

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GDI2 (GDP dissociation inhibitor 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Gdi2 (GDP dissociation inhibitor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gdi2 (GDP dissociation inhibitor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GDI2 (GDP dissociation inhibitor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GDI2 (GDP dissociation inhibitor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gdi2 (GDP dissociation inhibitor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GDI2 (GDP dissociation inhibitor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GDI2 (GDP dissociation inhibitor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gdi2 (GDP dissociation inhibitor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Gdi2 (GDP dissociation inhibitor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	GDI1 (GDP dissociation inhibitor 1)	HGNC	OrthoDB
Homo sapiens (human):	GC (GC vitamin D binding protein)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Gdi2 (GDP dissociation inhibitor 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gdi2 (GDP dissociation inhibitor 2)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	GDI2 (GDP dissociation inhibitor 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Homo sapiens (human):	GDI2 (GDP dissociation inhibitor 2)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	gdi2 (GDP dissociation inhibitor 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gdi2 (GDP dissociation inhibitor 2)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	GDI1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	GDI1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Gdi	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Gdi	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	gdi-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	gdi-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gdi2	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	gdi2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	71,559,460 - 71,586,147 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	17	71,559,461 - 71,586,147 (-)	Ensembl				GRCr8
mRatBN7.2	17	66,649,616 - 66,676,299 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	66,649,619 - 66,676,366 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	17	70,135,173 - 70,161,857 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	73,963,986 - 73,990,671 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	68,006,986 - 68,033,671 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	70,299,177 - 70,325,864 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	70,299,183 - 70,325,855 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	17	72,003,428 - 72,030,115 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	17	77,843,481 - 77,870,171 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	17	66,154,818 - 66,181,499 (-)	NCBI		Celera
RGSC_v3.1	17	77,854,314 - 77,881,004 (-)	NCBI
Cytogenetic Map	17	q12.2	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Down syndrome (ISO)

esophagus squamous cell carcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-dimethoxyphenol (ISO)

2-bromohexadecanoic acid (ISO)

2-ethoxyethanol (EXP)

2-methoxyethanol (EXP)

4,4'-sulfonyldiphenol (ISO)

acrolein (ISO)

actinomycin D (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

beta-naphthoflavone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

buspirone (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

carmustine (ISO)

chloropicrin (ISO)

choline (EXP)

cobalt dichloride (EXP,ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

diarsenic trioxide (ISO)

dichlorine (EXP)

dicrotophos (ISO)

diethylstilbestrol (ISO)

dimethylarsinic acid (EXP)

doxorubicin (ISO)

enzyme inhibitor (ISO)

ethanol (ISO)

folic acid (EXP,ISO)

fulvestrant (ISO)

furfural (ISO)

gentamycin (EXP)

ivermectin (ISO)

ketoconazole (ISO)

L-methionine (EXP)

lovastatin (ISO)

menadione (ISO)

methidathion (ISO)

N-nitrosomorpholine (EXP)

nickel subsulfide (EXP)

nitrates (ISO)

nitric oxide (ISO)

Nonylphenol (EXP)

Nutlin-3 (ISO)

ozone (EXP,ISO)

paracetamol (EXP,ISO)

PCB138 (EXP)

phenol red (ISO)

propiconazole (ISO)

rotenone (ISO)

S-butyl-DL-homocysteine (S,R)-sulfoximine (ISO)

silicon dioxide (ISO)

simvastatin (EXP)

sodium arsenite (ISO)

sodium chloride (ISO)

thapsigargin (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

valproic acid (ISO)

warfarin (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

negative regulation of cilium assembly (IEA,ISO,ISS)

negative regulation of protein localization to cilium (IEA,ISO,ISS)

protein transport (IEA)

small GTPase-mediated signal transduction (IEA,ISO)

vesicle-mediated transport (IBA,IEP)

Cellular Component

cytoplasm (IEA)

cytosol (IBA,IEA,ISO)

Golgi apparatus (IEA,ISO)

membrane (IEA)

synapse (EXP,IDA)

Molecular Function

GDP-dissociation inhibitor activity (IEA)

GTPase activator activity (IEA,ISO)

protein binding (ISO)

Rab GDP-dissociation inhibitor activity (IBA,IDA,IEA)

small GTPase binding (IDA,IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

Rab family mediated signaling pathway (TAS)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
4.	Molecular cloning and characterization of two rab GDI species from rat brain: brain-specific and ubiquitous types.	Nishimura N, etal., J Biol Chem 1994 May 13;269(19):14191-8.
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
8.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
9.	Reduction of nucleoside diphosphate kinase B, Rab GDP-dissociation inhibitor beta and histidine triad nucleotide-binding protein in fetal Down syndrome brain.	Weitzdoerfer R, etal., J Neural Transm Suppl. 2001;(61):347-59.
10.	Composition of isolated synaptic boutons reveals the amounts of vesicle trafficking proteins.	Wilhelm BG, etal., Science. 2014 May 30;344(6187):1023-8. doi: 10.1126/science.1252884.

Additional References at PubMed

PMID:7642711	PMID:7779099	PMID:7782346	PMID:15489334	PMID:17634366	PMID:19056867	PMID:19190083	PMID:21423176	PMID:22082260	PMID:22681889	PMID:22871113	PMID:23376485
PMID:23533145	PMID:28131823	PMID:29476059

Genomics

Comparative Map Data

Gdi2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	71,559,460 - 71,586,147 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	17	71,559,461 - 71,586,147 (-)	Ensembl				GRCr8
mRatBN7.2	17	66,649,616 - 66,676,299 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	66,649,619 - 66,676,366 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	17	70,135,173 - 70,161,857 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	73,963,986 - 73,990,671 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	68,006,986 - 68,033,671 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	70,299,177 - 70,325,864 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	70,299,183 - 70,325,855 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	17	72,003,428 - 72,030,115 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	17	77,843,481 - 77,870,171 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	17	66,154,818 - 66,181,499 (-)	NCBI		Celera
RGSC_v3.1	17	77,854,314 - 77,881,004 (-)	NCBI
Cytogenetic Map	17	q12.2	NCBI

GDI2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	5,765,223 - 5,813,434 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	5,765,221 - 5,842,132 (-)	Ensembl			hg38	GRCh38
GRCh37	10	5,807,186 - 5,855,397 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	5,847,192 - 5,895,379 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	10	5,847,191 - 5,895,379	NCBI
Celera	10	5,737,566 - 5,785,880 (-)	NCBI		Celera
Cytogenetic Map	10	p15.1	NCBI
HuRef	10	5,737,326 - 5,785,616 (-)	NCBI		HuRef
CHM1_1	10	5,807,126 - 5,855,477 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	10	5,769,012 - 5,817,195 (-)	NCBI		T2T-CHM13v2.0

Gdi2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	3,588,075 - 3,616,261 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	3,588,063 - 3,617,871 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	13	3,538,075 - 3,566,261 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	3,538,063 - 3,567,871 (+)	Ensembl			mm10	GRCm38
MGSCv37	13	3,537,321 - 3,565,507 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	13	3,537,379 - 3,567,117 (+)	NCBI		MGSCv36	mm8
Celera	13	3,527,746 - 3,555,904 (+)	NCBI		Celera
Cytogenetic Map	13	A1	NCBI
cM Map	13	1.98	NCBI

Gdi2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955421	22,450,402 - 22,480,512 (-)	Ensembl
ChiLan1.0	NW_004955421	22,449,620 - 22,480,721 (-)	NCBI	ChiLan1.0	ChiLan1.0

GDI2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	18,318,702 - 18,369,407 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	18,324,025 - 18,372,670 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	5,806,336 - 5,854,676 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	5,790,651 - 5,839,003 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	5,789,496 - 5,839,003 (-)	Ensembl			panPan2	panpan1.1

GDI2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	30,150,769 - 30,168,957 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	30,150,769 - 30,169,110 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	27,170,581 - 27,198,461 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	30,521,228 - 30,549,903 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	30,520,947 - 30,549,902 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	27,617,910 - 27,645,820 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	28,454,277 - 28,482,176 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	29,172,555 - 29,200,474 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Gdi2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	32,582,901 - 32,610,040 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936484	8,747,984 - 8,779,236 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936484	8,748,050 - 8,775,234 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GDI2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	10	65,160,653 - 65,196,447 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	10	65,160,700 - 65,196,447 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	10	71,276,439 - 71,312,186 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GDI2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	5,876,245 - 5,923,011 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	5,877,042 - 5,922,968 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666051	11,178,905 - 11,225,679 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gdi2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624775	594,472 - 622,592 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624775	594,477 - 622,592 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Gdi2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	14	17,891,416 - 17,917,430 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Gdi2
95 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	131
Count of miRNA genes:	111
Interacting mature miRNAs:	119
Transcripts:	ENSRNOT00000024952
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70210	Cm15	Cardiac mass QTL 15	6.5		heart right ventricle mass (VT:0007033)	heart right ventricle wet weight (CMO:0000072)	17	30066472	75066472	Rat
152023626	Bp403	Blood pressure QTL 403	3.86		arterial blood pressure trait (VT:2000000)		17	24136127	84432719	Rat
2301412	Kidm40	Kidney mass QTL 40		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	42388164	87388164	Rat
631502	Cm26	Cardiac mass QTL 26	3.71		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	17	70613502	86062352	Rat
1354588	Bvd4	Brain ventricular dilatation QTL 4	5.31	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	58194064	87388164	Rat
9590107	Sffal7	Serum free fatty acids level QTL 7	4.81	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	17	33104645	78104645	Rat
1354654	Spl7	Serum phospholipid level QTL 7	5.5		blood phospholipid amount (VT:0006084)	blood phospholipid level (CMO:0001169)	17	38031354	83031354	Rat
2317038	Ginf3	Gastrointestinal inflammation QTL 3	2.89	0.005	liver integrity trait (VT:0010547)	liver granuloma severity score (CMO:0002157)	17	54829503	93515804	Rat
1598871	Memor5	Memory QTL 5	5.3		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	17	40968017	89341781	Rat
1581512	Cm55	Cardiac mass QTL 55	2.8	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	27233445	83975845	Rat
1354629	Scl31	Serum cholesterol level QTL 31	4.1		blood cholesterol amount (VT:0000180)	blood total cholesterol level (CMO:0000051)	17	38031354	83031354	Rat
1600398	Edcs5	Endometrial carcinoma susceptibility QTL 5	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	17	35446949	75762341	Rat
152025238	Slep14	Serum leptin concentration QTL 14	4.62		blood leptin amount (VT:0005667)		17	24390595	84432719	Rat
1354638	Insul1	Insulin level QTL 1	4.8		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	38031354	83031354	Rat
61466	Niddm12	Non-insulin dependent diabetes mellitus QTL 12	3.2	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	17	65154872	93515804	Rat
1354635	Bp245	Blood pressure QTL 245	6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	38031354	83031354	Rat
8552928	Pigfal9	Plasma insulin-like growth factor 1 level QTL 9	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	17	33104645	78104645	Rat
12904736	Cm121	Cardiac mass QTL 121		0.043	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	17	42388164	87388164	Rat
1300148	Bp192	Blood pressure QTL 192	3.47		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	17	46050126	91050126	Rat
4889891	Eae32	Experimental allergic encephalomyelitis QTL 32	4.8	0.0002	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	17	27233445	72233445	Rat
4889894	Eae33	Experimental allergic encephalomyelitis QTL 33	5.2	0.0001	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	17	55604597	93006569	Rat
2324621	Coatc5	Coat color QTL 5			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	17	42654895	87654895	Rat
1354619	Bp242	Blood pressure QTL 242	6.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	37687877	82687877	Rat
1300131	Bp193	Blood pressure QTL 193	3.3		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	68550040	93515804	Rat
7488963	Bp369	Blood pressure QTL 369		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	63697147	82818564	Rat
1300129	Rf25	Renal function QTL 25	3.03		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	17	41062352	86062352	Rat
152023740	Bp406	Blood pressure QTL 406	6.06		arterial blood pressure trait (VT:2000000)		17	24136127	84432719	Rat
1354663	Bvd5	Brain ventricular dilatation QTL 5	3.51	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	32199534	86201342	Rat
152023737	Bp405	Blood pressure QTL 405	5.06		arterial blood pressure trait (VT:2000000)			24136127	84432719	Rat
152023736	Bp404	Blood pressure QTL 404	3.78		arterial blood pressure trait (VT:2000000)		17	24136127	84432719	Rat
724528	Uae4	Urinary albumin excretion QTL 4	4.9	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	17	36045537	81045537	Rat
2302365	Gluco40	Glucose level QTL 40	4.79		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	64569820	86954580	Rat

Markers in Region

RH127379

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	66,676,692 - 66,676,912 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	70,326,258 - 70,326,477	NCBI	Rnor6.0
Rnor_5.0	17	72,030,509 - 72,030,728	UniSTS	Rnor5.0
RGSC_v3.4	17	77,870,565 - 77,870,784	UniSTS	RGSC3.4
Celera	17	66,181,893 - 66,182,112	UniSTS
Cytogenetic Map	17	q12.3	UniSTS

RH133700

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	66,675,498 - 66,675,683 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	70,325,064 - 70,325,248	NCBI	Rnor6.0
Rnor_5.0	17	72,029,315 - 72,029,499	UniSTS	Rnor5.0
RGSC_v3.4	17	77,869,371 - 77,869,555	UniSTS	RGSC3.4
Celera	17	66,180,699 - 66,180,883	UniSTS
RH 3.4 Map	17	637.4	UniSTS
Cytogenetic Map	17	q12.3	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_017276	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC061767	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473990	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221605	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X74401	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000024952 ⟹ ENSRNOP00000024952

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	71,559,461 - 71,586,147 (-)	Ensembl
mRatBN7.2 Ensembl	17	66,649,628 - 66,676,351 (-)	Ensembl
Rnor_6.0 Ensembl	17	70,299,183 - 70,325,855 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000104020 ⟹ ENSRNOP00000077443

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	71,559,461 - 71,586,047 (-)	Ensembl
mRatBN7.2 Ensembl	17	66,649,619 - 66,676,199 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000109674 ⟹ ENSRNOP00000082980

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	66,649,619 - 66,676,366 (-)	Ensembl

RefSeq Acc Id:

NM_017276 ⟹ NP_058972

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	71,559,460 - 71,586,147 (-)	NCBI
mRatBN7.2	17	66,649,616 - 66,676,299 (-)	NCBI
Rnor_6.0	17	70,299,177 - 70,325,864 (-)	NCBI
Rnor_5.0	17	72,003,428 - 72,030,115 (-)	NCBI
RGSC_v3.4	17	77,843,481 - 77,870,171 (-)	RGD
Celera	17	66,154,818 - 66,181,499 (-)	RGD

Sequence:

show sequence

CGCTTTTTTCCCTCTTCCCCCCGGGGCCCAGAACGGCCGGACTTCTCGCTCCCTTCTCTACGGT
GGCCTCCGAGCCCTTGTGTGCGCTCCTTTCCCCGCCATGAATGAGGAATACGACGTGATCGTGC
TGGGCACCGGCCTGACGGAATGTATCCTGTCGGGGATAATGTCAGTGAATGGAAAGAAGGTTCT
TCATATGGATCAGAACCCATACTATGGAGGAGAAAGTGCATCTATAACACCGCTGGAAGATTTA
TACAAAAGATTTAAATTACCAGGACAACCACCAGCATCGATGGGGAGAGGAAGAGACTGGAATG
TTGACTTAATTCCCAAGTTCCTTATGGCCAATGGTCAGTTGGTGAAGATGCTGCTTTTCACAGA
GGTCACTCGTTATATGGACTTCAAAGTGATCGAAGGGAGCTTTGTCTACAAGGGAGGGAAAATC
TACAAGGTTCCTTCCACTGAAGCAGAAGCCCTGGCGTCTAGCTTAATGGGACTGTTTGAGAAAC
GCCGCTTCAGGAAGTTCCTAGTTTATGTTGCCAACTTTGATGAAAAAGATCCTAGAACTTTTGA
GGGTGTGGATCCTAAGAAGACCTCCATGAGAGATGTGTATAAGAAGTTTGATTTGGGCCAGGAT
GTTATAGACTTTACTGGCCATTCTCTTGCATTGTACAGAACAGATGACTACTTAGACCAGCCAT
GTTGTGAAACGATTAACAGAATTAAACTTTACAGCGAGTCTTTGGCAAGATATGGTAAAAGCCC
ATACCTCTATCCACTTTATGGTCTTGGGGAATTGCCACAAGGATTTGCAAGGTTAAGTGCTATA
TATGGAGGTACCTACATGTTGAATAAGCCAATTGAAGAAATCATTGTGCAAAATGGAAAAGTGG
TTGGCGTGAAATCTGAAGGAGAGATTGCTCGCTGTAAGCAGCTCATCTGTGATCCCAGCTATGT
CAAGGATCGGGTTGAAAAAGTAGGCCAGGTAATCAGAGTGATCTGTATCCTTAGCCACCCCATC
AAGAACACCAACGATGCTAACTCCTGCCAGATCATCATTCCACAGAACCAAGTCAACCGCAAGT
CAGATATCTATGTTTGCATGATCTCCTTTGCACATAATGTGGCAGCACAGGGCAAGTATATTGC
CATTGTAAGTACAACTGTGGAGACTAAGGAACCAGAGAAAGAAATCAGACCAGCTTTGGAGCTC
TTGGAACCAATTGAACAAAAATTTGTCAGCATCAGCGACCTCTTTGTACCTAAAGATTTGGGAA
CAGATAGTCAGATCTTTATTTCCCGTGCCTATGATGCTACCACACACTTTGAGACAACCTGTGA
TGACATCAAAGATATCTATAAGAGGATGACAGGGTCTGAGTTTGACTTTGAAGAAATGAAGCGC
AAGAAGAATGACATTTATGGAGAAGACTAACAGCAGTACATATTATGTAATTAGGACAAACTTA
AAATTTGGCAAATAATGTATATTGTATGAAATCAATATTGTAAGCCCTGCTTTTATGATCGAAG
TGGAGATTGAAGAGTGCTATACCAGTGAATGCTCCCTCACTTTTCTAATATCATGTATTAACTT
GTTTTCATGGAATGGCTAGTCAGAATTGGTTGGTTCTGTTCAGTTTAACCAAACTGCATTTTTT
TTTTTTTGTAGTGAAGGAGCTGTTCTAAACATATATTGATATCGATAGAGAACTTGATACAGTA
CTTGTATCTTTTAATCACTGTAGCCTTTACGATTGTGTGATGTTGCCCAAGAGCTGGATCCATA
CAATTTGTTGCCATCCTGATATTGGGAGTCAAATTGAATATCCTTTGGTTTCTGAAAACGTTCA
GTTTTCGCTATTTTGTTATGTCAAGTATTACAGCAGGGCCCAGATAGGAGAGCCACATGTTTTG
TTTATGTGGGTATAAACTTTAACCAAACTTCAGACTTAGGGAGTTGTTTGGAGAAGCCAATATG
TGGTATTTTAACCTACAATTGCTGAGAAAGGGAAAGCAGGTAAAAATATAGAAGCACCTTTTAT
CCCAGGTATGGCTTCTTCAACGGACCAAGCTGCAATGCAGTATTGATTTGACAGAGCCTCAATT
TCGATGATGTCTGTTCCAAAATGGCTCCAAATGATTTCTGTACTGCAAAATAAAGCCAAACTCT
GGAAACCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_058972	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH61767	(Get FASTA)	NCBI Sequence Viewer
	CAA52412	(Get FASTA)	NCBI Sequence Viewer
	EDL78588	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000024952
	ENSRNOP00000082980.1
GenBank Protein	P50399	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_058972 ⟸ NM_017276

- UniProtKB:

Q6P797 (UniProtKB/Swiss-Prot), P50399 (UniProtKB/Swiss-Prot), A6JLR2 (UniProtKB/TrEMBL), A0A8L2QEQ4 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDQNPYYGGESASITPLEDLYKRFKLPGQPPA
SMGRGRDWNVDLIPKFLMANGQLVKMLLFTEVTRYMDFKVIEGSFVYKGGKIYKVPSTEAEALA
SSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGVDPKKTSMRDVYKKFDLGQDVIDFTGHSLALY
RTDDYLDQPCCETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIE
EIIVQNGKVVGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQII
IPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSIS
DLFVPKDLGTDSQIFISRAYDATTHFETTCDDIKDIYKRMTGSEFDFEEMKRKKNDIYGED

hide sequence

Ensembl Acc Id:

ENSRNOP00000024952 ⟸ ENSRNOT00000024952

Ensembl Acc Id:

ENSRNOP00000082980 ⟸ ENSRNOT00000109674

Ensembl Acc Id:

ENSRNOP00000077443 ⟸ ENSRNOT00000104020

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P50399-F1-model_v2	AlphaFold	P50399	1-445	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700553

Promoter ID:

EPDNEW_R11077

Type:

multiple initiation site

Name:

Gdi2_1

Description:

GDP dissociation inhibitor 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	17	70,325,927 - 70,325,987	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:61802	AgrOrtholog
BioCyc Gene	G2FUF-8812	BioCyc
Ensembl Genes	ENSRNOG00000018091	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000024952	ENTREZGENE
	ENSRNOT00000109674.1	UniProtKB/Swiss-Prot
Gene3D-CATH	3.50.50.60	UniProtKB/Swiss-Prot
	Guanine Nucleotide Dissociation Inhibitor, domain 1	UniProtKB/Swiss-Prot
	Guanine Nucleotide Dissociation Inhibitor, domain 2	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:5621162	IMAGE-MGC_LOAD
InterPro	FAD/NAD-bd_sf	UniProtKB/Swiss-Prot
	GDP_dissociation_inhibitor	UniProtKB/Swiss-Prot
	RabGDI	UniProtKB/Swiss-Prot
KEGG Report	rno:29662	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72501	IMAGE-MGC_LOAD
NCBI Gene	29662	ENTREZGENE
PANTHER	PTHR11787	UniProtKB/Swiss-Prot
	RAB GDP DISSOCIATION INHIBITOR BETA	UniProtKB/Swiss-Prot
Pfam	GDI	UniProtKB/Swiss-Prot
PhenoGen	Gdi2	PhenoGen
PRINTS	RABGDI	UniProtKB/Swiss-Prot
	RABGDIREP	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000018091	RatGTEx
Superfamily-SCOP	SSF51905	UniProtKB/Swiss-Prot
TIGR	TC204503
UniProt	A0A8I5YBU1_RAT	UniProtKB/TrEMBL
	A0A8L2QEQ4	ENTREZGENE, UniProtKB/TrEMBL
	A6JLR2	ENTREZGENE, UniProtKB/TrEMBL
	GDIB_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q6P797	ENTREZGENE
UniProt Secondary	Q6P797	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-09-10	Gdi2	GDP dissociation inhibitor 2	Gdi3	guanosine diphosphate dissociation inhibitor 3	Symbol and Name updated	1299863	APPROVED
2002-06-10	Gdi3	guanosine diphosphate dissociation inhibitor 3			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	ubiquitously expressed	61604

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - CTD

RGD Manual Annotations