Symbol:
Abcc9
Name:
ATP binding cassette subfamily C member 9
RGD ID:
3787
Description:
Enables several functions, including identical protein binding activity; potassium channel activator activity; and sulfonylurea receptor activity. Involved in potassium ion import across plasma membrane; response to ATP; and response to xenobiotic stimulus. Located in T-tubule and acrosomal vesicle. Part of inward rectifying potassium channel. Biomarker of Parkinsonism; hypertension; and sciatic neuropathy. Human ortholog(s) of this gene implicated in dilated cardiomyopathy; dilated cardiomyopathy 1O; familial atrial fibrillation; hypertrichotic osteochondrodysplasia Cantu type; and intellectual disability and myopathy syndrome. Orthologous to human ABCC9 (ATP binding cassette subfamily C member 9); PARTICIPATES IN acebutolol pharmacodynamics pathway; adrenergic beta receptor agonist and beta-blocker pharmacodynamics pathway; amiodarone pharmacodynamics pathway; INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 17beta-estradiol 3-benzoate.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
ATP-binding cassette sub-family C member 9; ATP-binding cassette transporter sub-family C member 9; ATP-binding cassette, sub-family C (CFTR/MRP), member 9; ATP-binding cassette, sub-family C, member 9-like; ATP-binding cassette, subfamily C (CFTR/MRP), member 9; LOC100360403; Sulfonylurea receptor 2; Sur2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ABCC9 (ATP binding cassette subfamily C member 9) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther
Mus musculus (house mouse):
Abcc9 (ATP-binding cassette, sub-family C member 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Abcc9 (ATP binding cassette subfamily C member 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ABCC9 (ATP binding cassette subfamily C member 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ABCC9 (ATP binding cassette subfamily C member 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Abcc9 (ATP binding cassette subfamily C member 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ABCC9 (ATP binding cassette subfamily C member 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ABCC9 (ATP binding cassette subfamily C member 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Abcc9 (ATP binding cassette subfamily C member 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
C10orf90 (chromosome 10 open reading frame 90) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Abcc9 (ATP-binding cassette, sub-family C member 9)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
ABCC9 (ATP binding cassette subfamily C member 9)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
abcc9 (ATP-binding cassette, sub-family C (CFTR/MRP), member 9)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Sur
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder)
Allele / Splice:
Abcc9_v1
Abcc9_v2
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 177,262,848 - 177,386,837 (-) NCBI GRCr8 mRatBN7.2 4 175,531,854 - 175,655,849 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 175,532,547 - 175,655,356 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 181,826,663 - 181,950,019 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 177,610,938 - 177,734,298 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 176,231,509 - 176,354,867 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 176,806,098 - 176,928,540 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 176,805,431 - 176,922,424 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 241,019,980 - 241,139,051 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 180,165,979 - 180,236,791 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 33,877,146 - 33,883,992 NCBI Celera 4 164,064,977 - 164,186,502 (-) NCBI Celera Cytogenetic Map 4 q44 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Abcc9 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of ABCC9 mRNA CTD PMID:15901920 and PMID:29097150 Abcc9 Rat 17beta-estradiol affects binding ISO Abcc9 (Mus musculus) 6480464 Estradiol binds to ABCC9 protein mutant form CTD PMID:19095654 Abcc9 Rat 17beta-estradiol increases expression ISO Abcc9 (Mus musculus) 6480464 Estradiol results in increased expression of ABCC9 mRNA CTD PMID:39298647 Abcc9 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of ABCC9 mRNA CTD PMID:32145629 Abcc9 Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of ABCC9 mRNA CTD PMID:32741896 Abcc9 Rat 17beta-estradiol multiple interactions ISO Abcc9 (Mus musculus) 6480464 Estradiol inhibits the reaction [Glyburide binds to ABCC9 protein mutant form] CTD PMID:19095654 Abcc9 Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of ABCC9 mRNA CTD PMID:32741896 Abcc9 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO ABCC9 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of ABCC9 mRNA CTD PMID:22298810 Abcc9 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ABCC9 mRNA CTD PMID:34747641 Abcc9 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO ABCC9 (Homo sapiens) 6480464 [Endosulfan co-treated with Tetrachlorodibenzodioxin] results in decreased expression of ABCC9 mRNA CTD PMID:26159488 Abcc9 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ABCC9 mRNA CTD PMID:21215274 Abcc9 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 AHR protein alternative form affects the reaction [Tetrachlorodibenzodioxin results in decreased expression of ABCC9 mRNA] CTD PMID:21215274 Abcc9 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Abcc9 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Abcc9 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Abcc9 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of ABCC9 mRNA CTD PMID:21346803 Abcc9 Rat 2-deoxy-D-glucose multiple interactions ISO Abcc9 (Mus musculus) 6480464 [Oligomycins co-treated with Deoxyglucose] results in increased activity of [KCNJ11 protein binds to ABCC9 protein] and Glyburide inhibits the reaction [[Oligomycins co-treated with Deoxyglucose] results in increased activity of [KCNJ11 protein binds to ABCC9 protein]] CTD PMID:28842488 Abcc9 Rat 2-palmitoylglycerol increases expression ISO ABCC9 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of ABCC9 mRNA CTD PMID:37199045 Abcc9 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Abcc9 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of ABCC9 mRNA CTD PMID:26251327 Abcc9 Rat 4,4'-sulfonyldiphenol affects expression ISO Abcc9 (Mus musculus) 6480464 bisphenol S affects the expression of ABCC9 mRNA CTD PMID:39298647 Abcc9 Rat 4,4'-sulfonyldiphenol decreases methylation ISO ABCC9 (Homo sapiens) 6480464 bisphenol S results in decreased methylation of ABCC9 gene CTD PMID:31601247 Abcc9 Rat 4-hydroxyphenyl retinamide increases expression ISO Abcc9 (Mus musculus) 6480464 Fenretinide results in increased expression of ABCC9 mRNA CTD PMID:28973697 Abcc9 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of ABCC9 mRNA CTD PMID:31881176 Abcc9 Rat adenosine 5'-monophosphate multiple interactions ISO Abcc9 (Mus musculus) 6480464 Adenosine Monophosphate inhibits the reaction [Adenosine Triphosphate results in decreased activity of [KCNJ11 protein binds to ABCC9 protein]] and Creatine metabolite inhibits the reaction [Adenosine Monophosphate inhibits the reaction [Adenosine Triphosphate results in decreased activity of [KCNJ11 protein binds to ABCC9 protein]]] CTD PMID:11390963 Abcc9 Rat aflatoxin B1 decreases expression ISO ABCC9 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of ABCC9 mRNA CTD PMID:22100608 Abcc9 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of ABCC9 mRNA CTD PMID:25378103 Abcc9 Rat aflatoxin B1 decreases methylation ISO ABCC9 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of ABCC9 gene CTD PMID:27153756 Abcc9 Rat aflatoxin M1 decreases expression ISO ABCC9 (Homo sapiens) 6480464 Aflatoxin M1 results in decreased expression of ABCC9 mRNA CTD PMID:30928695 Abcc9 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of ABCC9 mRNA CTD PMID:35163327 Abcc9 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of ABCC9 mRNA CTD PMID:16483693 Abcc9 Rat antirheumatic drug increases expression ISO ABCC9 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of ABCC9 mRNA CTD PMID:24449571 Abcc9 Rat arsenite(3-) increases expression ISO Abcc9 (Mus musculus) 6480464 arsenite results in increased expression of ABCC9 protein CTD PMID:37955338 Abcc9 Rat ATP multiple interactions EXP 6480464 Adenosine Triphosphate results in decreased activity of [KCNJ8 protein binds to ABCC9 protein] CTD PMID:28842488 Abcc9 Rat ATP multiple interactions ISO Abcc9 (Mus musculus) 6480464 Adenosine Monophosphate inhibits the reaction [Adenosine Triphosphate results in decreased activity of [KCNJ11 protein binds to ABCC9 protein]] more ... CTD PMID:11390963 and PMID:28842488 Abcc9 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of ABCC9 gene CTD PMID:35440735 Abcc9 Rat Azoxymethane multiple interactions ISO Abcc9 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of ABCC9 mRNA CTD PMID:29950665 Abcc9 Rat benzo[a]pyrene decreases expression ISO ABCC9 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of ABCC9 mRNA CTD PMID:22316170 and PMID:32234424 Abcc9 Rat benzo[a]pyrene increases methylation ISO Abcc9 (Mus musculus) 6480464 Benzo(a)pyrene results in increased methylation of ABCC9 intron CTD PMID:27901495 Abcc9 Rat benzo[a]pyrene increases methylation ISO ABCC9 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of ABCC9 promoter CTD PMID:27901495 Abcc9 Rat benzo[a]pyrene decreases methylation ISO ABCC9 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of ABCC9 exon CTD PMID:27901495 Abcc9 Rat benzo[a]pyrene increases expression ISO Abcc9 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of ABCC9 mRNA CTD PMID:22228805 Abcc9 Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of ABCC9 mRNA CTD PMID:18164116 Abcc9 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ABCC9 mRNA CTD PMID:15901920 more ... Abcc9 Rat bisphenol A increases expression ISO Abcc9 (Mus musculus) 6480464 bisphenol A results in increased expression of ABCC9 mRNA CTD PMID:30245210 Abcc9 Rat bisphenol A decreases methylation ISO Abcc9 (Mus musculus) 6480464 bisphenol A results in decreased methylation of ABCC9 promoter CTD PMID:27312807 Abcc9 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of ABCC9 gene CTD PMID:28505145 Abcc9 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ABCC9 mRNA CTD PMID:25181051 Abcc9 Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of ABCC9 promoter CTD PMID:22457795 Abcc9 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of ABCC9 mRNA CTD PMID:25993096 Abcc9 Rat cantharidin decreases expression ISO Abcc9 (Mus musculus) 6480464 Cantharidin results in decreased expression of ABCC9 mRNA CTD PMID:36907384 Abcc9 Rat captan decreases expression ISO Abcc9 (Mus musculus) 6480464 Captan results in decreased expression of ABCC9 mRNA CTD PMID:31558096 Abcc9 Rat carbon nanotube decreases expression ISO Abcc9 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Abcc9 Rat CGP 52608 multiple interactions ISO ABCC9 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to ABCC9 gene] CTD PMID:28238834 Abcc9 Rat cisplatin decreases expression ISO ABCC9 (Homo sapiens) 6480464 Cisplatin results in decreased expression of ABCC9 mRNA CTD PMID:27594783 Abcc9 Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of ABCC9 mRNA CTD PMID:20187946 Abcc9 Rat copper atom increases expression EXP 6480464 Copper results in increased expression of ABCC9 mRNA CTD PMID:30556269 Abcc9 Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of ABCC9 mRNA CTD PMID:30556269 Abcc9 Rat copper(II) sulfate increases expression ISO ABCC9 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of ABCC9 mRNA CTD PMID:19549813 Abcc9 Rat creatine multiple interactions ISO Abcc9 (Mus musculus) 6480464 Creatine metabolite inhibits the reaction [Adenosine Monophosphate inhibits the reaction [Adenosine Triphosphate results in decreased activity of [KCNJ11 protein binds to ABCC9 protein]]] CTD PMID:11390963 Abcc9 Rat cyclosporin A decreases expression ISO ABCC9 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of ABCC9 mRNA CTD PMID:27989131 Abcc9 Rat dextran sulfate multiple interactions ISO Abcc9 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of ABCC9 mRNA CTD PMID:29950665 Abcc9 Rat diallyl trisulfide increases expression ISO ABCC9 (Homo sapiens) 6480464 diallyl trisulfide results in increased expression of ABCC9 mRNA CTD PMID:34995734 Abcc9 Rat dibenzofurans decreases expression ISO Abcc9 (Mus musculus) 6480464 Dibenzofurans results in decreased expression of ABCC9 mRNA CTD PMID:34254344 Abcc9 Rat dicyclanil decreases expression ISO Abcc9 (Mus musculus) 6480464 dicyclanil results in decreased expression of ABCC9 mRNA CTD PMID:15664270 Abcc9 Rat dimethylarsinic acid decreases expression EXP 6480464 Cacodylic Acid results in decreased expression of ABCC9 mRNA CTD PMID:37567419 Abcc9 Rat dioxygen multiple interactions ISO Abcc9 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of ABCC9 mRNA CTD PMID:30529165 Abcc9 Rat doxorubicin decreases expression ISO ABCC9 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of ABCC9 mRNA CTD PMID:29803840 Abcc9 Rat endosulfan multiple interactions ISO ABCC9 (Homo sapiens) 6480464 [Endosulfan co-treated with Tetrachlorodibenzodioxin] results in decreased expression of ABCC9 mRNA CTD PMID:26159488 Abcc9 Rat folic acid decreases expression ISO Abcc9 (Mus musculus) 6480464 Folic Acid results in decreased expression of ABCC9 mRNA CTD PMID:25629700 Abcc9 Rat genistein increases expression EXP 6480464 Genistein results in increased expression of ABCC9 mRNA CTD PMID:15901920 Abcc9 Rat genistein increases expression ISO Abcc9 (Mus musculus) 6480464 Genistein results in increased expression of ABCC9 mRNA CTD PMID:32186404 Abcc9 Rat glyburide multiple interactions ISO Abcc9 (Mus musculus) 6480464 [Glyburide results in decreased activity of ABCC9 protein] which results in increased expression of XDH protein more ... CTD PMID:17138562 more ... Abcc9 Rat glyburide decreases activity ISO Abcc9 (Mus musculus) 6480464 Glyburide results in decreased activity of ABCC9 protein CTD PMID:22622455 Abcc9 Rat glyburide affects binding ISO Abcc9 (Mus musculus) 6480464 Glyburide binds to ABCC9 protein mutant form CTD PMID:19095654 Abcc9 Rat inulin multiple interactions ISO Abcc9 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of ABCC9 mRNA CTD PMID:36331819 Abcc9 Rat ivermectin decreases expression ISO ABCC9 (Homo sapiens) 6480464 Ivermectin results in decreased expression of ABCC9 protein CTD PMID:32959892 Abcc9 Rat kojic acid multiple interactions ISO Abcc9 (Mus musculus) 6480464 [Diethylnitrosamine co-treated with kojic acid] results in increased expression of ABCC9 mRNA CTD PMID:17917374 Abcc9 Rat lipopolysaccharide multiple interactions ISO ABCC9 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Abcc9 Rat MeIQx decreases expression ISO ABCC9 (Homo sapiens) 6480464 2-amino-3 more ... CTD PMID:20816883 Abcc9 Rat metformin multiple interactions ISO Abcc9 (Mus musculus) 6480464 [rosiglitazone co-treated with Metformin] results in increased expression of ABCC9 mRNA alternative form and [rosiglitazone co-treated with Metformin] results in increased expression of ABCC9 protein alternative form CTD PMID:20823565 Abcc9 Rat N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine increases expression ISO ABCC9 (Homo sapiens) 6480464 N more ... CTD PMID:12756304 Abcc9 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of ABCC9 mRNA CTD PMID:18164116 Abcc9 Rat N-nitrosodiethylamine multiple interactions ISO Abcc9 (Mus musculus) 6480464 [Diethylnitrosamine co-treated with kojic acid] results in increased expression of ABCC9 mRNA CTD PMID:17917374 Abcc9 Rat niclosamide decreases expression ISO ABCC9 (Homo sapiens) 6480464 Niclosamide results in decreased expression of ABCC9 mRNA CTD PMID:36318118 Abcc9 Rat nicorandil increases activity ISO Abcc9 (Mus musculus) 6480464 Nicorandil results in increased activity of ABCC9 protein CTD PMID:22622455 Abcc9 Rat O-methyleugenol decreases expression ISO ABCC9 (Homo sapiens) 6480464 methyleugenol results in decreased expression of ABCC9 mRNA CTD PMID:32234424 Abcc9 Rat oxidopamine increases expression EXP 6480464 Oxidopamine results in increased expression of ABCC9 mRNA and Oxidopamine results in increased expression of ABCC9 protein CTD PMID:15857625 Abcc9 Rat ozone multiple interactions ISO Abcc9 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of ABCC9 mRNA CTD PMID:34911549 Abcc9 Rat paracetamol affects expression ISO Abcc9 (Mus musculus) 6480464 Acetaminophen affects the expression of ABCC9 mRNA CTD PMID:17562736 Abcc9 Rat paracetamol decreases expression ISO ABCC9 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of ABCC9 mRNA CTD PMID:29067470 Abcc9 Rat paracetamol increases expression ISO ABCC9 (Homo sapiens) 6480464 Acetaminophen results in increased expression of ABCC9 mRNA CTD PMID:26690555 Abcc9 Rat paraquat affects expression EXP 6480464 Paraquat affects the expression of ABCC9 mRNA CTD PMID:16854511 Abcc9 Rat perfluorononanoic acid decreases expression ISO ABCC9 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of ABCC9 mRNA CTD PMID:32588087 Abcc9 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Abcc9 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of ABCC9 mRNA CTD PMID:36331819 Abcc9 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of ABCC9 mRNA CTD PMID:35163327 Abcc9 Rat permethrin decreases expression ISO ABCC9 (Homo sapiens) 6480464 Permethrin results in decreased expression of ABCC9 mRNA CTD PMID:37047231 Abcc9 Rat phenobarbital affects expression ISO Abcc9 (Mus musculus) 6480464 Phenobarbital affects the expression of ABCC9 mRNA CTD PMID:23091169 Abcc9 Rat phenylephrine decreases expression EXP 6480464 Phenylephrine results in decreased expression of ABCC9 mRNA CTD PMID:18158353 Abcc9 Rat Pinacidil affects binding EXP 12792001 Pinacidil binds to Abcc9 protein RGD Abcc9 Rat Pinacidil increases activity EXP 6480464 Pinacidil results in increased activity of ABCC9 protein CTD PMID:28842488 Abcc9 Rat Pinacidil affects response to substance ISO Abcc9 (Mus musculus) 6480464 ABCC9 affects the susceptibility to Pinacidil CTD PMID:18511652 Abcc9 Rat pioglitazone multiple interactions ISO Abcc9 (Mus musculus) 6480464 [N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of ABCC9 mRNA CTD PMID:27935865 Abcc9 Rat pirinixic acid multiple interactions ISO Abcc9 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of ABCC9 mRNA CTD PMID:19710929 Abcc9 Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of ABCC9 mRNA CTD PMID:19162173 Abcc9 Rat progesterone increases expression ISO ABCC9 (Homo sapiens) 6480464 Progesterone results in increased expression of ABCC9 mRNA CTD PMID:20864642 Abcc9 Rat progesterone increases expression EXP 6480464 Progesterone results in increased expression of ABCC9 mRNA CTD PMID:20726854 Abcc9 Rat resveratrol affects binding ISO Abcc9 (Mus musculus) 6480464 resveratrol binds to ABCC9 protein CTD PMID:17138562 Abcc9 Rat resveratrol multiple interactions ISO Abcc9 (Mus musculus) 6480464 resveratrol inhibits the reaction [Glyburide binds to ABCC9 protein] CTD PMID:17138562 Abcc9 Rat riddelliine decreases expression EXP 6480464 riddelliine results in decreased expression of ABCC9 mRNA CTD PMID:18047727 Abcc9 Rat rubidium atom multiple interactions ISO Abcc9 (Mus musculus) 6480464 [KCNJ11 protein binds to ABCC9 protein] which results in increased export of Rubidium CTD PMID:28842488 Abcc9 Rat rubidium atom multiple interactions EXP 6480464 [KCNJ8 protein binds to ABCC9 protein] which results in increased export of Rubidium CTD PMID:28842488 Abcc9 Rat S-(1,2-dichlorovinyl)-L-cysteine increases expression ISO ABCC9 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in increased expression of ABCC9 mRNA CTD PMID:35811015 Abcc9 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO ABCC9 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Abcc9 Rat sodium arsenate increases expression ISO Abcc9 (Mus musculus) 6480464 sodium arsenate results in increased expression of ABCC9 mRNA CTD PMID:21795629 Abcc9 Rat sodium arsenite increases expression ISO ABCC9 (Homo sapiens) 6480464 sodium arsenite results in increased expression of ABCC9 mRNA CTD PMID:38568856 Abcc9 Rat sodium disulfite increases expression EXP 6480464 sodium metabisulfite results in increased expression of ABCC9 mRNA and sodium metabisulfite results in increased expression of ABCC9 protein CTD PMID:25463229 and PMID:26015265 Abcc9 Rat sulfur dioxide increases expression EXP 6480464 Sulfur Dioxide results in increased expression of ABCC9 mRNA and Sulfur Dioxide results in increased expression of ABCC9 protein CTD PMID:26112951 Abcc9 Rat sunitinib increases expression ISO ABCC9 (Homo sapiens) 6480464 Sunitinib results in increased expression of ABCC9 mRNA CTD PMID:31533062 Abcc9 Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of ABCC9 mRNA CTD PMID:32741896 Abcc9 Rat tetrachloromethane decreases expression ISO Abcc9 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of ABCC9 mRNA CTD PMID:17484886 Abcc9 Rat tetraphene decreases expression ISO Abcc9 (Mus musculus) 6480464 benz(a)anthracene results in decreased expression of ABCC9 mRNA CTD PMID:26377693 Abcc9 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of ABCC9 mRNA CTD PMID:34492290 Abcc9 Rat titanium dioxide multiple interactions ISO Abcc9 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of ABCC9 mRNA CTD PMID:29950665 Abcc9 Rat toluene increases expression EXP 6480464 Toluene results in increased expression of ABCC9 mRNA CTD PMID:22967744 Abcc9 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of ABCC9 mRNA CTD PMID:33387578 Abcc9 Rat triclosan decreases expression ISO ABCC9 (Homo sapiens) 6480464 Triclosan results in decreased expression of ABCC9 mRNA CTD PMID:30510588 Abcc9 Rat trimellitic anhydride decreases expression ISO Abcc9 (Mus musculus) 6480464 trimellitic anhydride results in decreased expression of ABCC9 mRNA CTD PMID:19042947 Abcc9 Rat troglitazone decreases expression ISO Abcc9 (Mus musculus) 6480464 troglitazone results in decreased expression of ABCC9 mRNA CTD PMID:28973697 Abcc9 Rat valdecoxib decreases expression EXP 6480464 valdecoxib results in decreased expression of ABCC9 mRNA CTD PMID:24136188 Abcc9 Rat valproic acid affects splicing EXP 6480464 Valproic Acid affects the splicing of ABCC9 mRNA CTD PMID:29427782 Abcc9 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of ABCC9 mRNA CTD PMID:23034163 Abcc9 Rat zinc sulfate decreases expression ISO ABCC9 (Homo sapiens) 6480464 Zinc Sulfate results in decreased expression of ABCC9 mRNA CTD PMID:12756304
Imported Annotations - SMPDB
17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrotoluene (EXP) 2-deoxy-D-glucose (ISO) 2-palmitoylglycerol (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) acetamide (EXP) adenosine 5'-monophosphate (ISO) aflatoxin B1 (EXP,ISO) aflatoxin M1 (ISO) alpha-Zearalanol (EXP) ammonium chloride (EXP) antirheumatic drug (ISO) arsenite(3-) (ISO) ATP (EXP,ISO) atrazine (EXP) Azoxymethane (ISO) benzo[a]pyrene (ISO) beta-naphthoflavone (EXP) bisphenol A (EXP,ISO) cadmium dichloride (EXP) cantharidin (ISO) captan (ISO) carbon nanotube (ISO) CGP 52608 (ISO) cisplatin (ISO) cocaine (EXP) copper atom (EXP) copper(0) (EXP) copper(II) sulfate (ISO) creatine (ISO) cyclosporin A (ISO) dextran sulfate (ISO) diallyl trisulfide (ISO) dibenzofurans (ISO) dicyclanil (ISO) dimethylarsinic acid (EXP) dioxygen (ISO) doxorubicin (ISO) endosulfan (ISO) folic acid (ISO) genistein (EXP,ISO) glyburide (ISO) inulin (ISO) ivermectin (ISO) kojic acid (ISO) lipopolysaccharide (ISO) MeIQx (ISO) metformin (ISO) N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO) N-nitrosodiethylamine (EXP,ISO) niclosamide (ISO) nicorandil (ISO) O-methyleugenol (ISO) oxidopamine (EXP) ozone (ISO) paracetamol (ISO) paraquat (EXP) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) permethrin (ISO) phenobarbital (ISO) phenylephrine (EXP) Pinacidil (EXP,ISO) pioglitazone (ISO) pirinixic acid (EXP,ISO) progesterone (EXP,ISO) resveratrol (ISO) riddelliine (EXP) rubidium atom (EXP,ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium disulfite (EXP) sulfur dioxide (EXP) sunitinib (ISO) testosterone (EXP) tetrachloromethane (ISO) tetraphene (ISO) thioacetamide (EXP) titanium dioxide (ISO) toluene (EXP) trichloroethene (EXP) triclosan (ISO) trimellitic anhydride (ISO) troglitazone (ISO) valdecoxib (EXP) valproic acid (EXP) vinclozolin (EXP) zinc sulfate (ISO)
1.
ABCC9 mutations identified in human dilated cardiomyopathy disrupt catalytic KATP channel gating.
Bienengraeber M, etal., Nat Genet 2004 Apr;36(4):382-7. Epub 2004 Mar 21.
2.
Decreased expression of aortic KIR6.1 and SUR2B in hypertension does not correlate with changes in the functional role of K(ATP) channels.
Blanco-Rivero J, etal., Eur J Pharmacol. 2008 Jun 10;587(1-3):204-8. Epub 2008 Mar 30.
3.
Molecular basis of ATP-sensitive K+ channels in rat vascular smooth muscles.
Cao K, etal., Biochem Biophys Res Commun 2002 Aug 16;296(2):463-9.
4.
Increase of ATP-sensitive potassium (K(ATP)) channels in the heart of type-1 diabetic rats.
Chen ZC, etal., Cardiovasc Diabetol. 2012 Jan 18;11:8. doi: 10.1186/1475-2840-11-8.
5.
Conserved functional consequences of disease-associated mutations in the slide helix of Kir6.1 and Kir6.2 subunits of the ATP-sensitive potassium channel.
Cooper PE, etal., J Biol Chem. 2017 Oct 20;292(42):17387-17398. doi: 10.1074/jbc.M117.804971. Epub 2017 Aug 23.
6.
Differential mechanisms of Cantú syndrome-associated gain of function mutations in the ABCC9 (SUR2) subunit of the KATP channel.
Cooper PE, etal., J Gen Physiol. 2015 Dec;146(6):527-40. doi: 10.1085/jgp.201511495.
7.
Subunit composition of ATP-sensitive potassium channels in mitochondria of rat hearts.
Cuong DV, etal., Mitochondrion. 2005 Apr;5(2):121-33.
8.
An amino acid triplet in the NH2 terminus of rat ROMK1 determines interaction with SUR2B.
Dong K, etal., J Biol Chem 2001 Nov 23;276(47):44347-53.
9.
Stoichiometry of sulfonylurea-induced ATP-sensitive potassium channel closure.
Dorschner H, etal., Mol Pharmacol. 1999 Jun;55(6):1060-6.
10.
Tetrameric structure of SUR2B revealed by electron microscopy of oriented single particles.
Fotinou C, etal., FEBS J. 2013 Feb;280(4):1051-63. doi: 10.1111/febs.12097. Epub 2013 Jan 27.
11.
Iptakalim, opener of K(ATP), reverses the enhanced expression of genes encoding K(ATP) subunits in spontaneously hypertensive rats.
Gao M, etal., Life Sci. 2005 Oct 14;77(22):2743-51.
12.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
13.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
14.
Nicorandil protects against lethal ischemic ventricular arrhythmias and up-regulates endothelial nitric oxide synthase expression and sulfonylurea receptor 2 mRNA in conscious rats with acute myocardial infarction.
Horinaka S, etal., Cardiovasc Drugs Ther. 2004 Jan;18(1):13-22.
15.
A family of sulfonylurea receptors determines the pharmacological properties of ATP-sensitive K+ channels.
Inagaki N, etal., Neuron. 1996 May;16(5):1011-7.
16.
Syntaxin-1A inhibits cardiac KATP channels by its actions on nucleotide binding folds 1 and 2 of sulfonylurea receptor 2A.
Kang Y, etal., J Biol Chem. 2004 Nov 5;279(45):47125-31. Epub 2004 Aug 31.
17.
Sulfonylurea receptors regulate the channel pore in ATP-sensitive potassium channels via an intersubunit salt bridge.
Lodwick D, etal., Biochem J. 2014 Dec 15;464(3):343-54. doi: 10.1042/BJ20140273.
18.
Detection of K(ATP) channels subunits in human term placental explants and evaluation of their implication in human placental lactogen (hPL) and human chorionic gonadotropin (hCG) release.
Lybaert P, etal., Placenta. 2013 Jun;34(6):467-73. doi: 10.1016/j.placenta.2013.03.006. Epub 2013 Apr 13.
19.
NMR and fluorescence studies of drug binding to the first nucleotide binding domain of SUR2A.
López-Alonso JP, etal., Biochemistry. 2012 Nov 13;51(45):9211-22. doi: 10.1021/bi301019e. Epub 2012 Nov 1.
20.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
21.
Immunolocalization of KATP channel subunits in mouse and rat cardiac myocytes and the coronary vasculature.
Morrissey A, etal., BMC Physiol. 2005 Jan 12;5(1):1.
22.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
23.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
24.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
25.
Exchange protein activated by cAMP (Epac) mediates cAMP-dependent but protein kinase A-insensitive modulation of vascular ATP-sensitive potassium channels.
Purves GI, etal., J Physiol. 2009 Jul 15;587(Pt 14):3639-50. doi: 10.1113/jphysiol.2009.173534.
26.
Proximal C-terminal domain of sulphonylurea receptor 2A interacts with pore-forming Kir6 subunits in KATP channels.
Rainbow RD, etal., Biochem J. 2004 Apr 1;379(Pt 1):173-81.
27.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
28.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
29.
ATP-sensitive potassium channels mediate dilatation of basilar artery in response to intracellular acidification in vivo.
Santa N, etal., Stroke 2003 May;34(5):1276-80.
30.
Putative subunits of the rat mesangial KATP: a type 2B sulfonylurea receptor and an inwardly rectifying K+ channel.
Szamosfalvi B, etal., Kidney Int 2002 May;61(5):1739-49.
31.
Studies of ATP-sensitive potassium channels on 6-hydroxydopamine and haloperidol rat models of Parkinson's disease: implications for treating Parkinson's disease?
Wang S, etal., Neuropharmacology. 2005 Jun;48(7):984-92.
32.
Reopening of ATP-sensitive potassium channels reduces neuropathic pain and regulates astroglial gap junctions in the rat spinal cord.
Wu XF, etal., Pain. 2011 Nov;152(11):2605-15. doi: 10.1016/j.pain.2011.08.003. Epub 2011 Sep 9.
33.
Different localization of ATP sensitive K+ channel subunits in rat testis.
Zhou M, etal., Anat Rec (Hoboken). 2011 Apr;294(4):729-37. doi: 10.1002/ar.21348. Epub 2011 Feb 15.
Abcc9 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 177,262,848 - 177,386,837 (-) NCBI GRCr8 mRatBN7.2 4 175,531,854 - 175,655,849 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 175,532,547 - 175,655,356 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 181,826,663 - 181,950,019 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 177,610,938 - 177,734,298 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 176,231,509 - 176,354,867 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 176,806,098 - 176,928,540 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 176,805,431 - 176,922,424 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 241,019,980 - 241,139,051 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 180,165,979 - 180,236,791 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 33,877,146 - 33,883,992 NCBI Celera 4 164,064,977 - 164,186,502 (-) NCBI Celera Cytogenetic Map 4 q44 NCBI
ABCC9 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 21,797,389 - 21,941,426 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 21,797,389 - 21,942,543 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 21,950,323 - 22,094,360 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 21,841,590 - 21,980,895 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 21,849,374 - 21,980,875 NCBI Celera 12 27,105,336 - 27,244,581 (-) NCBI Celera Cytogenetic Map 12 p12.1 NCBI HuRef 12 21,723,876 - 21,863,675 (-) NCBI HuRef CHM1_1 12 21,915,604 - 22,054,751 (-) NCBI CHM1_1 T2T-CHM13v2.0 12 21,676,073 - 21,820,886 (-) NCBI T2T-CHM13v2.0
Abcc9 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 142,533,592 - 142,648,472 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 142,533,588 - 142,648,041 (-) Ensembl GRCm39 Ensembl GRCm38 6 142,587,862 - 142,702,766 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 142,587,862 - 142,702,315 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 142,536,382 - 142,650,794 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 142,546,355 - 142,659,495 (-) NCBI MGSCv36 mm8 Celera 6 145,649,701 - 145,764,495 (-) NCBI Celera Cytogenetic Map 6 G2 NCBI cM Map 6 74.35 NCBI
Abcc9 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955413 17,382,564 - 17,510,132 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955413 17,385,966 - 17,510,220 (-) NCBI ChiLan1.0 ChiLan1.0
ABCC9 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 74,851,373 - 75,004,445 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 74,856,027 - 75,000,881 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 64,357,176 - 64,500,358 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 66,960,888 - 67,102,496 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 66,960,888 - 67,102,496 (+) Ensembl panpan1.1 panPan2
ABCC9 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 27 25,199,580 - 25,352,637 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 27 25,200,418 - 25,388,477 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 27 21,008,307 - 21,161,033 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 27 25,419,340 - 25,572,249 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 27 25,419,332 - 25,572,207 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 27 25,218,211 - 25,370,572 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 27 25,241,668 - 25,394,276 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 27 21,179,155 - 21,329,671 (-) NCBI UU_Cfam_GSD_1.0
Abcc9 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 87,079,120 - 87,187,785 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936548 4,987,847 - 5,108,104 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936548 4,983,461 - 5,110,693 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ABCC9 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 51,536,526 - 51,691,595 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 51,536,531 - 51,673,583 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 54,818,859 - 54,944,118 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ABCC9 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 21,658,804 - 21,797,851 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 21,658,794 - 21,797,263 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666069 13,343,449 - 13,484,437 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Abcc9
.
Predicted Target Of
Count of predictions: 119 Count of miRNA genes: 94 Interacting mature miRNAs: 98 Transcripts: ENSRNOT00000055540, ENSRNOT00000067489 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
6478754 Anxrr43 Anxiety related response QTL 43 0.14035 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 144639524 182687754 Rat 1576316 Ept5 Estrogen-induced pituitary tumorigenesis QTL 5 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 4 83428419 177635233 Rat 2303623 Vencon2 Ventilatory control QTL 2 3.8 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 4 135204660 180204660 Rat 724558 Plsm2 Polydactyly-luxate syndrome (PLS) morphotypes QTL 2 0.0003 hindlimb integrity trait (VT:0010563) hind foot phalanges count (CMO:0001949) 4 132422778 177422778 Rat 6478693 Anxrr32 Anxiety related response QTL 32 0.00092 locomotor behavior trait (VT:0001392) measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957) 4 144639524 182687754 Rat 1578674 Bmd12 Bone mineral density QTL 12 3.8 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 4 135699135 180699135 Rat 1331738 Bp209 Blood pressure QTL 209 2.979 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 138503169 179293946 Rat 6478700 Anxrr33 Anxiety related response QTL 33 0.00896 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 10053718 Scort25 Serum corticosterone level QTL 25 2.15 0.0097 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 155561574 182687754 Rat 1549827 Scl46 Serum cholesterol level QTL 46 3.5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 4 132396220 177396220 Rat 2293659 Bmd35 Bone mineral density QTL 35 4.5 0.0001 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 4 137755016 181392681 Rat 10401796 Kidm48 Kidney mass QTL 48 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 4 145568712 182687754 Rat 6478718 Anxrr34 Anxiety related response QTL 34 0.00896 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 6478748 Anxrr42 Anxiety related response QTL 42 0.28008 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 1300109 Rf13 Renal function QTL 13 3.91 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 4 157710145 182687754 Rat
D4Got140
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 176,734,862 - 176,735,053 (+) MAPPER mRatBN7.2 Rnor_6.0 4 178,015,760 - 178,015,950 NCBI Rnor6.0 Rnor_5.0 4 242,219,183 - 242,219,373 UniSTS Rnor5.0 RGSC_v3.4 4 180,347,915 - 180,348,106 RGD RGSC3.4 RGSC_v3.4 4 180,347,916 - 180,348,106 UniSTS RGSC3.4 RGSC_v3.1 4 180,593,040 - 180,593,230 RGD Celera 4 165,262,255 - 165,262,445 UniSTS RH 3.4 Map 4 1060.3 RGD RH 3.4 Map 4 1060.3 UniSTS Cytogenetic Map 4 q44 UniSTS
BE108803
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 176,860,248 - 176,860,432 (+) MAPPER mRatBN7.2 Rnor_6.0 4 178,141,125 - 178,141,308 NCBI Rnor6.0 Rnor_5.0 4 242,344,099 - 242,344,282 UniSTS Rnor5.0 RGSC_v3.4 4 180,472,699 - 180,472,882 UniSTS RGSC3.4 Celera 4 165,387,487 - 165,387,670 UniSTS RH 3.4 Map 4 1057.9 UniSTS Cytogenetic Map 4 q44 UniSTS
RH134712
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 176,786,011 - 176,786,169 (+) MAPPER mRatBN7.2 Rnor_6.0 4 178,066,907 - 178,067,064 NCBI Rnor6.0 Rnor_5.0 4 242,270,935 - 242,271,092 UniSTS Rnor5.0 RGSC_v3.4 4 180,399,064 - 180,399,221 UniSTS RGSC3.4 Celera 4 165,313,400 - 165,313,557 UniSTS RH 3.4 Map 4 1057.9 UniSTS Cytogenetic Map 4 q44 UniSTS
RH139436
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 176,781,873 - 176,782,078 (+) MAPPER mRatBN7.2 Rnor_6.0 4 178,062,769 - 178,062,973 NCBI Rnor6.0 Rnor_5.0 4 242,266,797 - 242,267,001 UniSTS Rnor5.0 RGSC_v3.4 4 180,394,926 - 180,395,130 UniSTS RGSC3.4 Celera 4 165,309,262 - 165,309,466 UniSTS RH 3.4 Map 4 1057.1 UniSTS Cytogenetic Map 4 q44 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000055540 ⟹ ENSRNOP00000052402
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 4 176,807,804 - 176,922,424 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000067489 ⟹ ENSRNOP00000063326
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 175,532,547 - 175,655,356 (-) Ensembl Rnor_6.0 Ensembl 4 176,805,431 - 176,909,075 (-) Ensembl
RefSeq Acc Id:
NM_013040 ⟹ NP_037172
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 177,262,848 - 177,386,348 (-) NCBI mRatBN7.2 4 175,531,854 - 175,655,356 (-) NCBI Rnor_6.0 4 176,806,098 - 176,928,540 (-) NCBI Rnor_5.0 4 241,019,980 - 241,139,051 (-) NCBI Celera 4 164,064,977 - 164,186,502 (-) RGD
Sequence:
AGCAGCTGGCCTCCCACCACCCTAAAAATAATCCACTCGCCGCTGTCTGCTGACCCGGGAGGAAAACTTGTCATCCCATGGAGTGTGTGAGCTCCTCGGCTTGCTCCAGAGAGATCCCCAACCGCTTT
hide sequence
RefSeq Acc Id:
XM_039107117 ⟹ XP_038963045
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 177,265,205 - 177,386,433 (-) NCBI mRatBN7.2 4 175,534,211 - 175,655,299 (-) NCBI
RefSeq Acc Id:
XM_039107119 ⟹ XP_038963047
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 177,262,848 - 177,386,837 (-) NCBI mRatBN7.2 4 175,534,046 - 175,655,849 (-) NCBI
RefSeq Acc Id:
XM_039107120 ⟹ XP_038963048
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 177,262,848 - 177,386,556 (-) NCBI mRatBN7.2 4 175,534,046 - 175,655,548 (-) NCBI
RefSeq Acc Id:
XM_039107122 ⟹ XP_038963050
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 177,262,848 - 177,386,434 (-) NCBI mRatBN7.2 4 175,534,212 - 175,655,452 (-) NCBI
RefSeq Acc Id:
XM_039107123 ⟹ XP_038963051
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 177,265,205 - 177,386,434 (-) NCBI mRatBN7.2 4 175,534,211 - 175,655,451 (-) NCBI
RefSeq Acc Id:
XM_039107124 ⟹ XP_038963052
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 177,262,848 - 177,386,433 (-) NCBI mRatBN7.2 4 175,534,212 - 175,655,451 (-) NCBI
RefSeq Acc Id:
XM_063285616 ⟹ XP_063141686
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 177,262,848 - 177,342,130 (-) NCBI
RefSeq Acc Id:
XM_063285617 ⟹ XP_063141687
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 177,265,205 - 177,386,435 (-) NCBI
RefSeq Acc Id:
XM_063285618 ⟹ XP_063141688
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 177,265,205 - 177,386,435 (-) NCBI
RefSeq Acc Id:
NP_037172 ⟸ NM_013040
- UniProtKB:
A6IMV7 (UniProtKB/TrEMBL), Q9JJ67 (UniProtKB/TrEMBL)
- Sequence:
MSLSFCGNNISSYNIYHGVLQNPCFVDALNLVPHVFLLFITFPILFIGWGSQSSKVQIHHNTWLHFPGHNLRWILTFALLFVHVCEIAEGIVSDSQRASRHLHLFMPAVMGFVATTTSIVYYHNIETS
hide sequence
Ensembl Acc Id:
ENSRNOP00000052402 ⟸ ENSRNOT00000055540
Ensembl Acc Id:
ENSRNOP00000063326 ⟸ ENSRNOT00000067489
RefSeq Acc Id:
XP_038963047 ⟸ XM_039107119
- Peptide Label:
isoform X1
- UniProtKB:
A6IMV7 (UniProtKB/TrEMBL), Q9JJ67 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038963048 ⟸ XM_039107120
- Peptide Label:
isoform X1
- UniProtKB:
A6IMV7 (UniProtKB/TrEMBL), Q9JJ67 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038963051 ⟸ XM_039107123
- Peptide Label:
isoform X5
- UniProtKB:
Q9JJ67 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038963045 ⟸ XM_039107117
- Peptide Label:
isoform X2
- UniProtKB:
Q63563 (UniProtKB/Swiss-Prot), O89115 (UniProtKB/Swiss-Prot), A6IMW1 (UniProtKB/TrEMBL), Q9JJ67 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038963050 ⟸ XM_039107122
- Peptide Label:
isoform X3
- UniProtKB:
Q9JJ67 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038963052 ⟸ XM_039107124
- Peptide Label:
isoform X4
- UniProtKB:
Q9JJ67 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063141686 ⟸ XM_063285616
- Peptide Label:
isoform X6
- UniProtKB:
A6IMV8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063141688 ⟸ XM_063285618
- Peptide Label:
isoform X8
- UniProtKB:
Q9JJ67 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063141687 ⟸ XM_063285617
- Peptide Label:
isoform X7
- UniProtKB:
Q9JJ67 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-12-09
Abcc9
ATP binding cassette subfamily C member 9
Abcc9
ATP-binding cassette, subfamily C (CFTR/MRP), member 9
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2015-07-29
Abcc9
ATP-binding cassette, subfamily C (CFTR/MRP), member 9
LOC100360403
ATP-binding cassette, sub-family C, member 9-like
Data merged from RGD:2322153
737654 PROVISIONAL
2010-11-16
Abcc9
ATP-binding cassette, subfamily C (CFTR/MRP), member 9
Abcc9
ATP-binding cassette, sub-family C (CFTR/MRP), member 9
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2010-05-06
LOC100360403
ATP-binding cassette, sub-family C, member 9-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2002-02-27
Abcc9
ATP-binding cassette, sub-family C (CFTR/MRP), member 9
Symbol and Name updated to reflect Human and Mouse nomenclature
70292 APPROVED
Note Type
Note
Reference
gene_function
can form cardiac and smooth muscle-type K(ATP) channels with Kir6.2. Kir6.2 forms the channel pore while Sur2 is required for activation and regulation
724707
gene_function
subunit of ATP-sensitve potassium channels (KATP).
724707
