Symbol:
Slc6a4
Name:
solute carrier family 6 member 4
RGD ID:
3714
Description:
Enables several functions, including cocaine binding activity; monoatomic cation transmembrane transporter activity; and syntaxin-1 binding activity. Involved in several processes, including behavioral response to cocaine; cellular response to cGMP; and learning or memory. Located in endomembrane system and plasma membrane. Is active in postsynaptic membrane; presynaptic membrane; and serotonergic synapse. Used to study anxiety disorder; depressive disorder; and pulmonary hypertension. Biomarker of Parkinsonism; borna disease; congenital diaphragmatic hernia; and fetal alcohol spectrum disorder. Human ortholog(s) of this gene implicated in several diseases, including alcohol dependence; anxiety disorder (multiple); depressive disorder (multiple); heart disease (multiple); and substance abuse (multiple). Orthologous to human SLC6A4 (solute carrier family 6 member 4); PARTICIPATES IN alfentanil pharmacodynamics pathway; bupivacaine pharmacodynamics pathway; buprenorphine pharmacodynamics pathway; INTERACTS WITH (S)-amphetamine; 1,2-dimethylhydrazine; 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
5HT transporter; 5HTT; serotonin transporter; SERT; sodium-dependent serotonin transporter; solute carrier family 6 (neurotransmitter transporter serotonin) member 4; solute carrier family 6 (neurotransmitter transporter serotonin) member 4 (5-hydroxytryptamine (serotonin) transporter); solute carrier family 6 (neurotransmitter transporter serotonin) member 4 (5-hydroxytryptamine (serotonin) transporter); solute carrier family 6 (neurotransmitter transporter), member 4; solute carrier family 6 (neurotransmitter transporter, serotonin), member 4; solute carrier family 6, member 4
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SLC6A4 (solute carrier family 6 member 4) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Slc6a4 (solute carrier family 6 (neurotransmitter transporter, serotonin), member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Slc6a4 (solute carrier family 6 member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SLC6A4 (solute carrier family 6 member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SLC6A4 (solute carrier family 6 member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Slc6a4 (solute carrier family 6 member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SLC6A4 (solute carrier family 6 member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SLC6A4 (solute carrier family 6 member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Slc6a4 (solute carrier family 6 member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
ZDHHC23 (zinc finger DHHC-type palmitoyltransferase 23) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Slc6a4 (solute carrier family 6 (neurotransmitter transporter, serotonin), member 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
SLC6A4 (solute carrier family 6 member 4)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
slc6a4a (solute carrier family 6 member 4a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
mod-5
Alliance
DIOPT (InParanoid|OMA|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
SerT
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Allele / Splice:
Slc6a4m1Hubr
Genetic Models:
WI-Slc6a4m1Hubr+/-
WI-Slc6a4m1Hubr-/-
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 62,322,688 - 62,357,060 (+) NCBI GRCr8 mRatBN7.2 10 61,824,208 - 61,858,924 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 61,826,123 - 61,858,384 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 66,483,857 - 66,505,046 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 65,989,335 - 66,010,524 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 61,459,175 - 61,480,332 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 63,153,656 - 63,188,377 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 63,153,651 - 63,176,463 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 62,851,326 - 62,872,481 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 67,134,790 - 67,155,891 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 67,148,412 - 67,197,988 (-) NCBI Celera 10 60,845,942 - 60,866,725 (+) NCBI Celera Cytogenetic Map 10 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Slc6a4 Rat (R)-noradrenaline multiple interactions ISO SLC6A4 (Homo sapiens) 6480464 SLC6A4 protein promotes the reaction [Norepinephrine results in increased activity of TAAR1 protein] CTD PMID:17234900 Slc6a4 Rat (R)-octopamine multiple interactions ISO SLC6A4 (Homo sapiens) 6480464 Citalopram inhibits the reaction [SLC6A4 protein promotes the reaction [Octopamine results in increased activity of TAAR1 protein]] more ... CTD PMID:17234900 Slc6a4 Rat (S)-amphetamine affects response to substance ISO SLC6A4 (Homo sapiens) 6480464 SLC6A4 gene polymorphism affects the susceptibility to Dextroamphetamine CTD PMID:16966188 Slc6a4 Rat (S)-amphetamine multiple interactions EXP 6480464 Dextroamphetamine inhibits the reaction [SLC6A4 protein results in increased uptake of Serotonin] CTD PMID:24841869 Slc6a4 Rat (S)-colchicine decreases expression ISO SLC6A4 (Homo sapiens) 6480464 Colchicine results in decreased expression of SLC6A4 mRNA CTD PMID:34748853 Slc6a4 Rat (S)-fenfluramine affects activity ISO Slc6a4 (Mus musculus) 6480464 Dexfenfluramine affects the activity of SLC6A4 protein CTD PMID:18506000 Slc6a4 Rat 1,2-dimethylhydrazine increases expression EXP 6480464 1 and 2-Dimethylhydrazine results in increased expression of SLC6A4 mRNA CTD PMID:22750881 Slc6a4 Rat 1,2-dimethylhydrazine decreases expression ISO Slc6a4 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of SLC6A4 mRNA CTD PMID:22206623 Slc6a4 Rat 1,2-dimethylhydrazine multiple interactions EXP 6480464 Dietary Fats inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of SLC6A4 mRNA] CTD PMID:22750881 Slc6a4 Rat 1-(3-chlorophenyl)piperazine affects response to substance ISO Slc6a4 (Mus musculus) 6480464 SLC6A4 protein affects the susceptibility to 1-(3-chlorophenyl)piperazine CTD PMID:25522398 Slc6a4 Rat 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine increases expression EXP 6480464 chlorcyclizine results in increased expression of SLC6A4 mRNA CTD PMID:21058326 Slc6a4 Rat 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile multiple interactions ISO SLC6A4 (Homo sapiens) 6480464 Citalopram binds to and results in decreased activity of SLC6A4 protein more ... CTD PMID:16272152 more ... Slc6a4 Rat 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile affects response to substance ISO SLC6A4 (Homo sapiens) 6480464 SLC6A4 promoter polymorphism affects the susceptibility to Citalopram CTD PMID:14624186 Slc6a4 Rat 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of SLC6A4 mRNA CTD PMID:16079270 Slc6a4 Rat 17beta-estradiol multiple interactions EXP 6480464 [Estradiol co-treated with Fluoxetine] results in increased expression of SLC6A4 mRNA more ... CTD PMID:18650020 and PMID:21382399 Slc6a4 Rat 17beta-estradiol decreases expression ISO SLC6A4 (Homo sapiens) 6480464 Estradiol results in decreased expression of SLC6A4 mRNA CTD PMID:34748853 Slc6a4 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of SLC6A4 mRNA CTD PMID:18650020 and PMID:21382399 Slc6a4 Rat 17beta-estradiol 3-benzoate increases expression EXP 6480464 estradiol 3-benzoate results in increased expression of SLC6A4 protein CTD PMID:17398000 Slc6a4 Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 Raloxifene Hydrochloride inhibits the reaction [estradiol 3-benzoate results in increased expression of SLC6A4 protein] CTD PMID:17398000 Slc6a4 Rat 2,2',4,4',5,5'-hexachlorobiphenyl increases expression ISO SLC6A4 (Homo sapiens) 6480464 2 more ... CTD PMID:23146750 Slc6a4 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of SLC6A4 mRNA CTD PMID:32109520 Slc6a4 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Slc6a4 Rat 2,5-dimethoxy-4-bromophenethylamine multiple interactions ISO SLC6A4 (Homo sapiens) 6480464 2-(4-bromo-2 more ... CTD PMID:28506818 Slc6a4 Rat 2-phenylethylamine multiple interactions ISO SLC6A4 (Homo sapiens) 6480464 SLC6A4 protein promotes the reaction [phenethylamine results in increased activity of TAAR1 protein] CTD PMID:17234900 Slc6a4 Rat 3,4-methylenedioxymethamphetamine affects expression ISO SLC6A4 (Homo sapiens) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine affects the expression of SLC6A4 protein CTD PMID:20483717 Slc6a4 Rat 3,4-methylenedioxymethamphetamine decreases activity ISO SLC6A4 (Homo sapiens) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased activity of SLC6A4 protein CTD PMID:30776375 Slc6a4 Rat 3,4-methylenedioxymethamphetamine multiple interactions EXP 6480464 2H-Benzo(a)quinolizin-2-ol more ... CTD PMID:25370842 Slc6a4 Rat 3,4-methylenedioxymethamphetamine decreases response to substance EXP 6480464 SLC6A4 gene mutant form results in decreased susceptibility to N-Methyl-3 and 4-methylenedioxyamphetamine CTD PMID:24595820 Slc6a4 Rat 3,4-methylenedioxymethamphetamine affects binding ISO SLC6A4 (Homo sapiens) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine binds to SLC6A4 protein CTD PMID:16272152 Slc6a4 Rat 3,4-methylenedioxymethamphetamine decreases expression EXP 6480464 N-Methyl-3 more ... CTD PMID:16054768 more ... Slc6a4 Rat 3,4-methylenedioxymethamphetamine multiple interactions ISO SLC6A4 (Homo sapiens) 6480464 N-Methyl-3 more ... CTD PMID:20483717 more ... Slc6a4 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO SLC6A4 (Homo sapiens) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of SLC6A4 protein CTD PMID:18661256 Slc6a4 Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of SLC6A4 protein CTD PMID:26116029 Slc6a4 Rat 4,4'-sulfonyldiphenol decreases expression EXP 6480464 bisphenol S results in decreased expression of SLC6A4 mRNA CTD PMID:26186136 Slc6a4 Rat 4,4'-sulfonyldiphenol decreases expression ISO SLC6A4 (Homo sapiens) 6480464 bisphenol S results in decreased expression of SLC6A4 mRNA CTD PMID:34748853 Slc6a4 Rat 4,4'-sulfonyldiphenol increases expression ISO Slc6a4 (Mus musculus) 6480464 bisphenol S results in increased expression of SLC6A4 mRNA CTD PMID:30951980 Slc6a4 Rat 4-hydroxyphenyl retinamide decreases expression ISO Slc6a4 (Mus musculus) 6480464 Fenretinide results in decreased expression of SLC6A4 mRNA CTD PMID:28973697 Slc6a4 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of SLC6A4 mRNA CTD PMID:33150595 Slc6a4 Rat 6-propyl-2-thiouracil increases methylation EXP 6480464 Propylthiouracil results in increased methylation of SLC6A4 promoter CTD PMID:33150595 Slc6a4 Rat 8-OH-DPAT increases response to substance EXP 6480464 SLC6A4 results in increased susceptibility to 8-Hydroxy-2-(di-n-propylamino)tetralin CTD PMID:18581099 Slc6a4 Rat aflatoxin B1 decreases expression ISO SLC6A4 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of SLC6A4 mRNA CTD PMID:34748853 Slc6a4 Rat alendronic acid affects expression EXP 6480464 Alendronate affects the expression of SLC6A4 mRNA CTD PMID:16079270 Slc6a4 Rat all-trans-retinoic acid multiple interactions ISO Slc6a4 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of SLC6A4 mRNA CTD PMID:36189433 Slc6a4 Rat aminorex multiple interactions EXP 6480464 Aminorex inhibits the reaction [SLC6A4 protein results in increased uptake of Serotonin] CTD PMID:24841869 Slc6a4 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of SLC6A4 mRNA CTD PMID:16483693 Slc6a4 Rat amphetamine multiple interactions ISO SLC6A4 (Homo sapiens) 6480464 Amphetamine inhibits the reaction [SLC6A4 protein results in increased import of Biogenic Monoamines analog] and Amphetamine inhibits the reaction [SLC6A4 protein results in increased import of Fluorescent Dyes] CTD PMID:28506818 Slc6a4 Rat antirheumatic drug increases expression ISO SLC6A4 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of SLC6A4 mRNA CTD PMID:24449571 Slc6a4 Rat aripiprazole affects binding ISO SLC6A4 (Homo sapiens) 6480464 Aripiprazole binds to SLC6A4 protein CTD PMID:21823597 Slc6a4 Rat aristolochic acid A increases expression ISO SLC6A4 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of SLC6A4 mRNA CTD PMID:33212167 Slc6a4 Rat Aroclor 1254 multiple interactions EXP 6480464 [Chlorodiphenyl (54% Chlorine) co-treated with aroclor 1242 co-treated with aroclor 1248] results in decreased expression of SLC6A4 mRNA CTD PMID:29879404 Slc6a4 Rat arsane increases expression EXP 6480464 Arsenic results in increased expression of SLC6A4 mRNA CTD PMID:18315880 Slc6a4 Rat arsenic atom increases expression EXP 6480464 Arsenic results in increased expression of SLC6A4 mRNA CTD PMID:18315880 Slc6a4 Rat atorvastatin calcium multiple interactions EXP 6480464 Atorvastatin inhibits the reaction [Monocrotaline results in increased expression of SLC6A4 protein] CTD PMID:17575010 Slc6a4 Rat benzo[a]pyrene decreases expression ISO SLC6A4 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of SLC6A4 mRNA CTD PMID:26238291 and PMID:32234424 Slc6a4 Rat benzo[a]pyrene decreases methylation ISO SLC6A4 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of SLC6A4 promoter CTD PMID:27901495 Slc6a4 Rat benzo[a]pyrene increases methylation ISO SLC6A4 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of SLC6A4 5' UTR and Benzo(a)pyrene results in increased methylation of SLC6A4 exon CTD PMID:27901495 Slc6a4 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Slc6a4 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of SLC6A4 mRNA CTD PMID:32303808 Slc6a4 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Slc6a4 (Mus musculus) 6480464 Diethylhexyl Phthalate promotes the reaction [[Streptozocin co-treated with Dietary Fats co-treated with Dietary Sugars] results in decreased activity of SLC6A4 protein] and Diethylhexyl Phthalate promotes the reaction [[Streptozocin co-treated with Dietary Fats co-treated with Dietary Sugars] results in decreased expression of SLC6A4 mRNA] CTD PMID:32303808 Slc6a4 Rat bisphenol A increases expression ISO SLC6A4 (Homo sapiens) 6480464 bisphenol A results in increased expression of SLC6A4 mRNA CTD PMID:23146750 Slc6a4 Rat bisphenol A multiple interactions ISO SLC6A4 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of SLC6A4 gene CTD PMID:31601247 Slc6a4 Rat bisphenol A decreases expression ISO SLC6A4 (Homo sapiens) 6480464 bisphenol A results in decreased expression of SLC6A4 mRNA CTD PMID:34748853 Slc6a4 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of SLC6A4 mRNA CTD PMID:25181051 Slc6a4 Rat bisphenol A increases expression ISO Slc6a4 (Mus musculus) 6480464 bisphenol A results in increased expression of SLC6A4 mRNA CTD PMID:23567477 more ... Slc6a4 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SLC6A4 mRNA CTD PMID:26141625 Slc6a4 Rat bisphenol AF decreases expression ISO SLC6A4 (Homo sapiens) 6480464 bisphenol AF results in decreased expression of SLC6A4 mRNA CTD PMID:34748853 Slc6a4 Rat bisphenol F decreases expression EXP 6480464 4 and 4'-bisphenol F results in decreased expression of SLC6A4 mRNA CTD PMID:26186136 Slc6a4 Rat bisphenol F increases expression ISO Slc6a4 (Mus musculus) 6480464 bisphenol F results in increased expression of SLC6A4 mRNA CTD PMID:30951980 Slc6a4 Rat bupropion affects response to substance ISO SLC6A4 (Homo sapiens) 6480464 SLC6A4 polymorphism affects the susceptibility to Bupropion CTD PMID:21658141 Slc6a4 Rat cadmium atom affects binding ISO SLC6A4 (Homo sapiens) 6480464 Cadmium binds to SLC6A4 protein mutant form CTD PMID:16272152 Slc6a4 Rat cannabidiol decreases expression ISO SLC6A4 (Homo sapiens) 6480464 Cannabidiol results in decreased expression of SLC6A4 mRNA CTD PMID:38663822 Slc6a4 Rat cannabidiol multiple interactions ISO Slc6a4 (Mus musculus) 6480464 [Cannabidiol co-treated with Sertraline] results in increased expression of SLC6A4 mRNA CTD PMID:34262461 Slc6a4 Rat cannabidiol increases expression ISO Slc6a4 (Mus musculus) 6480464 Cannabidiol results in increased expression of SLC6A4 mRNA CTD PMID:34262461 Slc6a4 Rat cantharidin increases expression ISO Slc6a4 (Mus musculus) 6480464 Cantharidin results in increased expression of SLC6A4 mRNA CTD PMID:36907384 Slc6a4 Rat carbon nanotube decreases expression ISO Slc6a4 (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of SLC6A4 mRNA CTD PMID:25554681 Slc6a4 Rat carbonyl sulfide decreases expression EXP 6480464 carbonyl sulfide results in decreased expression of SLC6A4 mRNA CTD PMID:19395590 Slc6a4 Rat CGP 52608 multiple interactions ISO SLC6A4 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to SLC6A4 gene] CTD PMID:28238834 Slc6a4 Rat chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of SLC6A4 and Chlorpyrifos results in decreased expression of SLC6A4 mRNA CTD PMID:17035140 and PMID:18835401 Slc6a4 Rat chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of SLC6A4 CTD PMID:17035140 Slc6a4 Rat citalopram multiple interactions ISO SLC6A4 (Homo sapiens) 6480464 Citalopram binds to and results in decreased activity of SLC6A4 protein more ... CTD PMID:16272152 more ... Slc6a4 Rat citalopram affects response to substance ISO SLC6A4 (Homo sapiens) 6480464 SLC6A4 promoter polymorphism affects the susceptibility to Citalopram CTD PMID:14624186 Slc6a4 Rat clomipramine multiple interactions ISO SLC6A4 (Homo sapiens) 6480464 Clomipramine binds to and results in decreased activity of SLC6A4 protein and SLC6A4 polymorphism inhibits the reaction [Clomipramine affects the secretion of PRL protein] CTD PMID:16272152 and PMID:17000009 Slc6a4 Rat clozapine multiple interactions ISO SLC6A4 (Homo sapiens) 6480464 [SLC6A4 gene polymorphism results in decreased uptake of Serotonin] which results in decreased susceptibility to Clozapine CTD PMID:20452607 Slc6a4 Rat clozapine increases expression EXP 6480464 Clozapine results in increased expression of SLC6A4 CTD PMID:12007678 Slc6a4 Rat clozapine affects response to substance ISO SLC6A4 (Homo sapiens) 6480464 SLC6A4 protein affects the susceptibility to Clozapine CTD PMID:20452607 Slc6a4 Rat cocaine increases expression ISO SLC6A4 (Homo sapiens) 6480464 Cocaine results in increased expression of SLC6A4 protein CTD PMID:11207425 Slc6a4 Rat cocaine multiple interactions ISO SLC6A4 (Homo sapiens) 6480464 Cocaine binds to and results in decreased activity of SLC6A4 protein more ... CTD PMID:16272152 more ... Slc6a4 Rat cocaine decreases response to substance EXP 6480464 SLC6A4 results in decreased susceptibility to Cocaine CTD PMID:18581099 Slc6a4 Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of SLC6A4 mRNA CTD PMID:11072100 Slc6a4 Rat cocaine increases response to substance EXP 6480464 SLC6A4 gene mutant form results in increased susceptibility to Cocaine CTD PMID:20459657 Slc6a4 Rat cocaine affects response to substance ISO Slc6a4 (Mus musculus) 6480464 SLC6A4 mutant form affects the susceptibility to Cocaine CTD PMID:11320258 Slc6a4 Rat cocaine decreases activity ISO SLC6A4 (Homo sapiens) 6480464 Cocaine results in decreased activity of SLC6A4 protein CTD PMID:18321529 Slc6a4 Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of SLC6A4 mRNA CTD PMID:26033743 Slc6a4 Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of SLC6A4 mRNA CTD PMID:26033743 Slc6a4 Rat copper(II) sulfate decreases expression ISO SLC6A4 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of SLC6A4 mRNA CTD PMID:19549813 Slc6a4 Rat cyclosporin A decreases expression ISO SLC6A4 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of SLC6A4 mRNA CTD PMID:25562108 Slc6a4 Rat cyhalothrin decreases expression EXP 6480464 cyhalothrin results in decreased expression of SLC6A4 mRNA CTD PMID:36126889 Slc6a4 Rat dexamethasone increases expression EXP 6480464 Dexamethasone results in increased expression of SLC6A4 protein CTD PMID:16160705 Slc6a4 Rat dextromethorphan multiple interactions EXP 6480464 Dextromethorphan inhibits the reaction [Excitatory Amino Acid Agonists results in decreased expression of SLC6A4 protein] CTD PMID:31153898 Slc6a4 Rat diazinon decreases expression EXP 6480464 Diazinon results in decreased expression of SLC6A4 mRNA and Diazinon results in decreased expression of SLC6A4 protein CTD PMID:17035140 more ... Slc6a4 Rat diazinon increases expression EXP 6480464 Diazinon results in increased expression of SLC6A4 protein CTD PMID:17035140 Slc6a4 Rat Dibutyl phosphate affects expression ISO SLC6A4 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of SLC6A4 mRNA CTD PMID:37042841 Slc6a4 Rat dieldrin decreases expression EXP 6480464 Dieldrin results in decreased expression of SLC6A4 mRNA CTD PMID:18835401 Slc6a4 Rat diisononyl phthalate decreases expression ISO Slc6a4 (Mus musculus) 6480464 diisononyl phthalate results in decreased expression of SLC6A4 mRNA CTD PMID:37482143 Slc6a4 Rat diquat increases expression ISO Slc6a4 (Mus musculus) 6480464 Diquat results in increased expression of SLC6A4 mRNA CTD PMID:36851058 Slc6a4 Rat dopamine multiple interactions ISO SLC6A4 (Homo sapiens) 6480464 Citalopram inhibits the reaction [SLC6A4 protein promotes the reaction [Dopamine results in increased activity of TAAR1 protein]] more ... CTD PMID:17234900 Slc6a4 Rat ethanol multiple interactions ISO Slc6a4 (Mus musculus) 6480464 Ethanol promotes the reaction [mephedrone results in decreased expression of SLC6A4 protein] CTD PMID:26747301 Slc6a4 Rat ethanol decreases expression ISO Slc6a4 (Mus musculus) 6480464 Ethanol results in decreased expression of SLC6A4 protein CTD PMID:26747301 Slc6a4 Rat ethylparaben increases expression ISO SLC6A4 (Homo sapiens) 6480464 ethyl-p-hydroxybenzoate results in increased expression of SLC6A4 mRNA CTD PMID:37690743 Slc6a4 Rat excitatory amino acid agonist multiple interactions EXP 6480464 Dextromethorphan inhibits the reaction [Excitatory Amino Acid Agonists results in decreased expression of SLC6A4 protein] CTD PMID:31153898 Slc6a4 Rat excitatory amino acid agonist decreases expression EXP 6480464 Excitatory Amino Acid Agonists results in decreased expression of SLC6A4 protein CTD PMID:31153898 Slc6a4 Rat fluoxetine affects response to substance ISO SLC6A4 (Homo sapiens) 6480464 SLC6A4 affects the susceptibility to Fluoxetine and SLC6A4 protein affects the susceptibility to Fluoxetine CTD PMID:14573314 and PMID:20010449 Slc6a4 Rat fluoxetine decreases activity EXP 6480464 Fluoxetine results in decreased activity of SLC6A4 protein CTD PMID:18561912 Slc6a4 Rat fluoxetine decreases activity ISO Slc6a4 (Mus musculus) 6480464 Fluoxetine results in decreased activity of SLC6A4 protein CTD PMID:19616025 Slc6a4 Rat fluoxetine decreases response to substance ISO SLC6A4 (Homo sapiens) 6480464 SLC6A4 gene polymorphism results in decreased susceptibility to Fluoxetine CTD PMID:14604448 Slc6a4 Rat fluoxetine affects expression ISO SLC6A4 (Homo sapiens) 6480464 Fluoxetine affects the expression of SLC6A4 protein CTD PMID:16951736 Slc6a4 Rat fluoxetine multiple interactions ISO SLC6A4 (Homo sapiens) 6480464 Fluoxetine binds to and results in decreased activity of SLC6A4 protein more ... CTD PMID:16272152 and PMID:28506818 Slc6a4 Rat fluoxetine decreases expression EXP 6480464 Fluoxetine results in decreased expression of SLC6A4 mRNA and Fluoxetine results in decreased expression of SLC6A4 protein CTD PMID:15936043 more ... Slc6a4 Rat fluoxetine increases response to substance ISO SLC6A4 (Homo sapiens) 6480464 SLC6A4 gene polymorphism results in increased susceptibility to Fluoxetine and SLC6A4 protein results in increased susceptibility to Fluoxetine CTD PMID:14604448 and PMID:20010449 Slc6a4 Rat fluoxetine decreases localization ISO SLC6A4 (Homo sapiens) 6480464 Fluoxetine results in decreased localization of SLC6A4 protein CTD PMID:17289086 Slc6a4 Rat fluoxetine multiple interactions EXP 6480464 [Estradiol co-treated with Fluoxetine] results in increased expression of SLC6A4 mRNA more ... CTD PMID:16982082 more ... Slc6a4 Rat fluoxetine increases expression ISO Slc6a4 (Mus musculus) 6480464 Fluoxetine results in increased expression of SLC6A4 mRNA CTD PMID:21083617 Slc6a4 Rat fluoxetine hydrochloride decreases expression EXP 38549581 fluoxetine decreases expression of Slc6a4 mRNA in the dorsal raphe nucleus RGD Slc6a4 Rat folic acid decreases expression ISO Slc6a4 (Mus musculus) 6480464 Folic Acid results in decreased expression of SLC6A4 mRNA CTD PMID:25006883 and PMID:25629700 Slc6a4 Rat formaldehyde decreases expression ISO SLC6A4 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of SLC6A4 mRNA CTD PMID:27905399 Slc6a4 Rat forskolin increases activity ISO SLC6A4 (Homo sapiens) 36947876 forskolin increases activity of SLC6A4 protein in placental choriocarcinoma cells RGD Slc6a4 Rat fulvestrant multiple interactions ISO SLC6A4 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of SLC6A4 gene CTD PMID:31601247 Slc6a4 Rat fumonisin B1 decreases expression ISO SLC6A4 (Homo sapiens) 6480464 fumonisin B1 results in decreased expression of SLC6A4 mRNA CTD PMID:34748853 Slc6a4 Rat gabapentin decreases expression ISO SLC6A4 (Homo sapiens) 6480464 Gabapentin results in decreased expression of SLC6A4 mRNA CTD PMID:34748853 Slc6a4 Rat genistein decreases activity EXP 38549585 genistein decreases activity of Slc6a4 protein in synaptosomes RGD Slc6a4 Rat genistein increases expression ISO Slc6a4 (Mus musculus) 6480464 Genistein results in increased expression of SLC6A4 mRNA CTD PMID:32186404 Slc6a4 Rat genistein decreases activity EXP 38549589 genistein decreases activity of Slc6a4 protein in cultured neurons RGD Slc6a4 Rat glyphosate decreases expression ISO SLC6A4 (Homo sapiens) 6480464 Glyphosate results in decreased expression of SLC6A4 mRNA CTD PMID:34748853 Slc6a4 Rat haloperidol increases expression EXP 6480464 Haloperidol results in increased expression of SLC6A4 CTD PMID:12007678 Slc6a4 Rat hydrogen peroxide affects expression ISO SLC6A4 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of SLC6A4 mRNA CTD PMID:20044591 Slc6a4 Rat hydroxyurea decreases expression ISO SLC6A4 (Homo sapiens) 6480464 Hydroxyurea results in decreased expression of SLC6A4 mRNA CTD PMID:34748853 Slc6a4 Rat imipramine decreases activity EXP 6480464 Imipramine results in decreased activity of SLC6A4 protein CTD PMID:18561912 Slc6a4 Rat ketanserin affects binding ISO Slc6a4 (Mus musculus) 6480464 Ketanserin binds to SLC6A4 protein CTD PMID:21871486 Slc6a4 Rat ketanserin multiple interactions ISO Slc6a4 (Mus musculus) 6480464 methamidophos inhibits the reaction [Ketanserin binds to SLC6A4 protein] CTD PMID:21871486 Slc6a4 Rat lamivudine multiple interactions ISO SLC6A4 (Homo sapiens) 6480464 [Lamivudine co-treated with IFNA2 protein] results in increased expression of SLC6A4 mRNA more ... CTD PMID:16476009 Slc6a4 Rat lamivudine increases expression ISO SLC6A4 (Homo sapiens) 6480464 Lamivudine results in increased expression of SLC6A4 mRNA CTD PMID:16476009 Slc6a4 Rat lithium chloride decreases expression ISO SLC6A4 (Homo sapiens) 6480464 Lithium Chloride results in decreased expression of SLC6A4 mRNA CTD PMID:34748853 Slc6a4 Rat Mazindol multiple interactions ISO SLC6A4 (Homo sapiens) 6480464 Mazindol binds to and results in decreased activity of SLC6A4 protein CTD PMID:16272152 Slc6a4 Rat mephedrone multiple interactions ISO Slc6a4 (Mus musculus) 6480464 Ethanol promotes the reaction [mephedrone results in decreased expression of SLC6A4 protein] CTD PMID:26747301 Slc6a4 Rat mephedrone decreases expression ISO Slc6a4 (Mus musculus) 6480464 mephedrone results in decreased expression of SLC6A4 protein CTD PMID:26747301 Slc6a4 Rat mephedrone decreases expression EXP 6480464 mephedrone results in decreased expression of SLC6A4 protein CTD PMID:25817894 Slc6a4 Rat mepyramine affects binding ISO SLC6A4 (Homo sapiens) 6480464 Pyrilamine analog binds to SLC6A4 protein CTD PMID:11931612 Slc6a4 Rat mercury atom affects response to substance ISO SLC6A4 (Homo sapiens) 6480464 SLC6A4 promoter polymorphism affects the susceptibility to Mercury CTD PMID:20526950 Slc6a4 Rat mercury dichloride decreases expression EXP 6480464 Mercuric Chloride results in decreased expression of SLC6A4 mRNA CTD PMID:16507785 Slc6a4 Rat mercury(0) affects response to substance ISO SLC6A4 (Homo sapiens) 6480464 SLC6A4 promoter polymorphism affects the susceptibility to Mercury CTD PMID:20526950 Slc6a4 Rat methamidophos multiple interactions ISO Slc6a4 (Mus musculus) 6480464 methamidophos inhibits the reaction [Ketanserin binds to SLC6A4 protein] CTD PMID:21871486 Slc6a4 Rat methamphetamine multiple interactions ISO SLC6A4 (Homo sapiens) 6480464 Citalopram inhibits the reaction [SLC6A4 protein promotes the reaction [Methamphetamine results in increased activity of TAAR1 protein]] more ... CTD PMID:17234900 Slc6a4 Rat methamphetamine increases response to substance EXP 6480464 SLC6A4 protein results in increased susceptibility to Methamphetamine CTD PMID:10684896 Slc6a4 Rat methamphetamine decreases expression EXP 6480464 Methamphetamine results in decreased expression of SLC6A4 protein CTD PMID:15900317 Slc6a4 Rat methamphetamine affects response to substance ISO Slc6a4 (Mus musculus) 6480464 SLC6A4 mRNA affects the susceptibility to Methamphetamine CTD PMID:19689456 Slc6a4 Rat methamphetamine affects expression ISO Slc6a4 (Mus musculus) 6480464 Methamphetamine affects the expression of SLC6A4 protein CTD PMID:11093760 and PMID:9369336 Slc6a4 Rat methamphetamine multiple interactions ISO Slc6a4 (Mus musculus) 6480464 IL6 protein affects the reaction [Methamphetamine affects the expression of SLC6A4 protein] and TRP53 protein affects the reaction [Methamphetamine affects the expression of SLC6A4 protein] CTD PMID:11093760 and PMID:9369336 Slc6a4 Rat methamphetamine decreases expression ISO SLC6A4 (Homo sapiens) 6480464 Methamphetamine results in decreased expression of SLC6A4 protein CTD PMID:16389202 and PMID:18841348 Slc6a4 Rat monensin A multiple interactions ISO SLC6A4 (Homo sapiens) 6480464 Monensin promotes the reaction [para-methyl-4-methylaminorex inhibits the reaction [SLC6A4 protein results in increased uptake of Serotonin]] CTD PMID:29908239 Slc6a4 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Slc6a4 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of SLC6A4 mRNA CTD PMID:36189433 Slc6a4 Rat monocrotaline multiple interactions ISO SLC6A4 (Homo sapiens) 6480464 Sertraline inhibits the reaction [Monocrotaline results in increased expression of SLC6A4 mRNA] CTD PMID:17042913 Slc6a4 Rat monocrotaline increases expression EXP 6480464 Monocrotaline results in increased expression of SLC6A4 protein CTD PMID:17575010 Slc6a4 Rat monocrotaline multiple interactions EXP 6480464 Atorvastatin inhibits the reaction [Monocrotaline results in increased expression of SLC6A4 protein] CTD PMID:17575010 Slc6a4 Rat monocrotaline increases expression ISO SLC6A4 (Homo sapiens) 6480464 Monocrotaline results in increased expression of SLC6A4 mRNA CTD PMID:17042913 Slc6a4 Rat N-ethyl-N-nitrosourea increases mutagenesis EXP 6480464 Ethylnitrosourea results in increased mutagenesis of SLC6A4 gene CTD PMID:16495775 Slc6a4 Rat N-Nitrosopyrrolidine decreases expression ISO SLC6A4 (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in decreased expression of SLC6A4 mRNA CTD PMID:32234424 Slc6a4 Rat nickel atom decreases expression EXP 6480464 Nickel results in decreased expression of SLC6A4 mRNA CTD PMID:18835401 Slc6a4 Rat nisoxetine multiple interactions ISO SLC6A4 (Homo sapiens) 6480464 nisoxetine binds to and results in decreased activity of SLC6A4 protein CTD PMID:16272152 Slc6a4 Rat nitrates multiple interactions ISO Slc6a4 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of SLC6A4 mRNA CTD PMID:35964746 Slc6a4 Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of SLC6A4 protein CTD PMID:24888825 and PMID:25078423 Slc6a4 Rat nomifensine multiple interactions ISO SLC6A4 (Homo sapiens) 6480464 Nomifensine binds to and results in decreased activity of SLC6A4 protein CTD PMID:16272152 Slc6a4 Rat nortriptyline affects response to substance ISO SLC6A4 (Homo sapiens) 6480464 SLC6A4 polymorphism affects the susceptibility to Nortriptyline and SLC6A4 promoter polymorphism affects the susceptibility to Nortriptyline CTD PMID:17018806 and PMID:21658141 Slc6a4 Rat nortriptyline increases response to substance ISO SLC6A4 (Homo sapiens) 6480464 SLC6A4 protein results in increased susceptibility to Nortriptyline CTD PMID:14604448 Slc6a4 Rat nortriptyline decreases response to substance ISO SLC6A4 (Homo sapiens) 6480464 SLC6A4 gene polymorphism results in decreased susceptibility to Nortriptyline CTD PMID:14604448 Slc6a4 Rat O-methyleugenol decreases expression ISO SLC6A4 (Homo sapiens) 6480464 methyleugenol results in decreased expression of SLC6A4 mRNA CTD PMID:32234424 Slc6a4 Rat ochratoxin A decreases expression ISO SLC6A4 (Homo sapiens) 6480464 ochratoxin A results in decreased expression of SLC6A4 mRNA CTD PMID:34748853 Slc6a4 Rat octopamine multiple interactions ISO SLC6A4 (Homo sapiens) 6480464 Citalopram inhibits the reaction [SLC6A4 protein promotes the reaction [Octopamine results in increased activity of TAAR1 protein]] more ... CTD PMID:17234900 Slc6a4 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of SLC6A4 mRNA CTD PMID:25729387 Slc6a4 Rat oxidopamine multiple interactions EXP 6480464 [Oxidopamine co-treated with Levodopa] results in increased expression of SLC6A4 protein CTD PMID:20882603 Slc6a4 Rat paracetamol increases activity EXP 6480464 Acetaminophen results in increased activity of SLC6A4 protein CTD PMID:10849027 Slc6a4 Rat parathion increases expression EXP 6480464 Parathion results in increased expression of SLC6A4 protein CTD PMID:19616088 and PMID:20015457 Slc6a4 Rat parathion decreases expression EXP 6480464 Parathion results in decreased expression of SLC6A4 protein CTD PMID:19616088 Slc6a4 Rat parathion affects expression EXP 6480464 Parathion affects the expression of SLC6A4 protein CTD PMID:18773955 Slc6a4 Rat paroxetine decreases expression ISO SLC6A4 (Homo sapiens) 6480464 Paroxetine results in decreased expression of SLC6A4 mRNA CTD PMID:16055263 Slc6a4 Rat paroxetine multiple interactions ISO SLC6A4 (Homo sapiens) 6480464 Paroxetine binds to and results in decreased activity of SLC6A4 protein CTD PMID:16272152 Slc6a4 Rat paroxetine decreases expression EXP 6480464 Paroxetine results in decreased expression of SLC6A4 mRNA CTD PMID:10575045 Slc6a4 Rat paroxetine affects expression EXP 6480464 Paroxetine affects the expression of SLC6A4 mRNA CTD PMID:10575045 Slc6a4 Rat perfluorooctane-1-sulfonic acid decreases expression ISO SLC6A4 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in decreased expression of SLC6A4 mRNA CTD PMID:32790152 Slc6a4 Rat perfluorooctanoic acid decreases expression ISO SLC6A4 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of SLC6A4 mRNA CTD PMID:32790152 Slc6a4 Rat phorbol 13-acetate 12-myristate multiple interactions EXP 38456013 TPA decreases activity of Slc6a4 protein in synaptosomes and TPA increases phosphorylation of Slc6a4 protein in synaptosomes RGD Slc6a4 Rat phorbol 13-acetate 12-myristate decreases activity EXP 38549589 TPA decreases activity of Slc6a4 protein in cultured neurons RGD Slc6a4 Rat phorbol 13-acetate 12-myristate increases phosphorylation EXP 38549585 TPA increases phosphorylation of Slc6a4 protein in synaptosomes RGD Slc6a4 Rat piperazines affects binding ISO SLC6A4 (Homo sapiens) 6480464 Piperazines analog binds to SLC6A4 protein CTD PMID:11931612 Slc6a4 Rat pirinixic acid decreases expression ISO Slc6a4 (Mus musculus) 6480464 pirinixic acid results in decreased expression of SLC6A4 mRNA CTD PMID:17426115 Slc6a4 Rat pirinixic acid increases expression ISO Slc6a4 (Mus musculus) 6480464 pirinixic acid results in increased expression of SLC6A4 mRNA CTD PMID:18301758 Slc6a4 Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of SLC6A4 mRNA CTD PMID:19162173 Slc6a4 Rat quercetin decreases expression ISO SLC6A4 (Homo sapiens) 6480464 Quercetin results in decreased expression of SLC6A4 mRNA CTD PMID:21632981 Slc6a4 Rat raloxifene multiple interactions EXP 6480464 Raloxifene Hydrochloride inhibits the reaction [estradiol 3-benzoate results in increased expression of SLC6A4 protein] CTD PMID:17398000 Slc6a4 Rat raloxifene affects expression EXP 6480464 Raloxifene Hydrochloride affects the expression of SLC6A4 mRNA CTD PMID:16079270 Slc6a4 Rat reserpine decreases expression EXP 6480464 Reserpine results in decreased expression of SLC6A4 mRNA CTD PMID:10027743 Slc6a4 Rat ribavirin multiple interactions ISO SLC6A4 (Homo sapiens) 6480464 Ribavirin promotes the reaction [SLC6A4 protein results in increased uptake of Serotonin] and Ribavirin results in increased expression of and results in increased activity of SLC6A4 protein CTD PMID:16476009 Slc6a4 Rat ribavirin increases expression ISO SLC6A4 (Homo sapiens) 6480464 Ribavirin results in increased expression of SLC6A4 mRNA CTD PMID:16476009 Slc6a4 Rat serotonin multiple interactions ISO SLC6A4 (Homo sapiens) 6480464 4-methylaminorex inhibits the reaction [SLC6A4 protein results in increased uptake of Serotonin] more ... CTD PMID:16476009 more ... Slc6a4 Rat serotonin increases activity ISO SLC6A4 (Homo sapiens) 6480464 Serotonin results in increased activity of SLC6A4 protein CTD PMID:33785354 Slc6a4 Rat serotonin decreases activity ISO SLC6A4 (Homo sapiens) 36947380 serotonin decreases activity of Slc6a4 protein in epithelial colorectal adenocarcinoma cells RGD Slc6a4 Rat serotonin increases uptake EXP 6480464 SLC6A4 protein results in increased uptake of Serotonin CTD PMID:24841869 Slc6a4 Rat serotonin affects binding ISO SLC6A4 (Homo sapiens) 6480464 Serotonin binds to SLC6A4 protein CTD PMID:16272152 Slc6a4 Rat serotonin multiple interactions EXP 6480464 4-methylaminorex inhibits the reaction [SLC6A4 protein results in increased uptake of Serotonin] more ... CTD PMID:16982082 and PMID:24841869 Slc6a4 Rat serotonin increases expression ISO Slc6a4 (Mus musculus) 6480464 Serotonin results in increased expression of SLC6A4 mRNA CTD PMID:21083617 Slc6a4 Rat serotonin increases uptake ISO Slc6a4 (Mus musculus) 6480464 SLC6A4 protein results in increased uptake of Serotonin CTD PMID:15972295 Slc6a4 Rat serotonin increases uptake ISO SLC6A4 (Homo sapiens) 6480464 SLC6A4 protein results in increased uptake of Serotonin CTD PMID:16476009 more ... Slc6a4 Rat serotonin affects abundance ISO SLC6A4 (Homo sapiens) 6480464 SLC6A4 gene polymorphism affects the abundance of Serotonin CTD PMID:17203304 Slc6a4 Rat sertraline multiple interactions ISO SLC6A4 (Homo sapiens) 6480464 Sertraline inhibits the reaction [Monocrotaline results in increased expression of SLC6A4 mRNA] CTD PMID:17042913 Slc6a4 Rat sertraline affects binding ISO SLC6A4 (Homo sapiens) 6480464 Sertraline binds to SLC6A4 protein CTD PMID:33124469 Slc6a4 Rat sertraline increases expression ISO Slc6a4 (Mus musculus) 6480464 Sertraline results in increased expression of SLC6A4 mRNA CTD PMID:34262461 Slc6a4 Rat sertraline multiple interactions ISO Slc6a4 (Mus musculus) 6480464 [Cannabidiol co-treated with Sertraline] results in increased expression of SLC6A4 mRNA CTD PMID:34262461 Slc6a4 Rat sertraline increases expression EXP 6480464 Sertraline results in increased expression of SLC6A4 mRNA CTD PMID:18650020 Slc6a4 Rat sertraline decreases expression EXP 6480464 Sertraline results in decreased expression of SLC6A4 protein CTD PMID:12151556 Slc6a4 Rat sertraline affects response to substance ISO SLC6A4 (Homo sapiens) 6480464 SLC6A4 protein affects the susceptibility to Sertraline CTD PMID:12955294 Slc6a4 Rat sertraline decreases expression ISO Slc6a4 (Mus musculus) 6480464 Sertraline results in decreased expression of SLC6A4 protein CTD PMID:18923402 Slc6a4 Rat sertraline multiple interactions EXP 6480464 [Estradiol co-treated with Sertraline] affects the expression of SLC6A4 mRNA more ... CTD PMID:12151556 and PMID:18650020 Slc6a4 Rat sertraline increases response to substance ISO SLC6A4 (Homo sapiens) 6480464 SLC6A4 promoter polymorphism results in increased susceptibility to Sertraline CTD PMID:12955294 Slc6a4 Rat simvastatin increases activity ISO SLC6A4 (Homo sapiens) 6480464 Simvastatin results in increased activity of SLC6A4 protein CTD PMID:15740995 Slc6a4 Rat sodium arsenite increases expression ISO SLC6A4 (Homo sapiens) 6480464 sodium arsenite results in increased expression of SLC6A4 mRNA CTD PMID:38568856 Slc6a4 Rat staurosporine increases activity ISO SLC6A4 (Homo sapiens) 38500207 staurosporine increases activity of SLC6A4 protein in placental choriocarcinoma cells RGD Slc6a4 Rat streptozocin multiple interactions ISO Slc6a4 (Mus musculus) 6480464 [Streptozocin co-treated with Dietary Fats co-treated with Dietary Sugars] results in decreased activity of SLC6A4 protein more ... CTD PMID:32303808 Slc6a4 Rat sulfadiazine decreases expression ISO SLC6A4 (Homo sapiens) 6480464 Sulfadiazine results in decreased expression of SLC6A4 mRNA CTD PMID:34748853 Slc6a4 Rat Sunset Yellow FCF decreases expression ISO SLC6A4 (Homo sapiens) 6480464 6-hydroxy-5-((p- sulfophenyl)azo)-2-naphthalenesulfonic acid disodium salt results in decreased expression of SLC6A4 mRNA CTD PMID:34748853 Slc6a4 Rat tetrachloroethene increases expression ISO Slc6a4 (Mus musculus) 6480464 Tetrachloroethylene results in increased expression of SLC6A4 mRNA CTD PMID:28973375 Slc6a4 Rat tetrahydropalmatine decreases expression ISO Slc6a4 (Mus musculus) 6480464 tetrahydropalmatine results in decreased expression of SLC6A4 mRNA CTD PMID:37606869 Slc6a4 Rat Theaflavin 3,3'-digallate affects expression ISO SLC6A4 (Homo sapiens) 6480464 theaflavin-3 and 3'-digallate affects the expression of SLC6A4 mRNA CTD PMID:34925699 Slc6a4 Rat tianeptine multiple interactions ISO SLC6A4 (Homo sapiens) 6480464 tianeptine binds to and results in decreased activity of SLC6A4 protein CTD PMID:16272152 Slc6a4 Rat titanium dioxide decreases expression ISO Slc6a4 (Mus musculus) 6480464 titanium dioxide results in decreased expression of SLC6A4 mRNA CTD PMID:23557971 Slc6a4 Rat titanium dioxide increases methylation ISO Slc6a4 (Mus musculus) 6480464 titanium dioxide results in increased methylation of SLC6A4 promoter CTD PMID:35295148 Slc6a4 Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of SLC6A4 mRNA CTD PMID:25729387 Slc6a4 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of SLC6A4 mRNA CTD PMID:25729387 Slc6a4 Rat triclosan decreases expression ISO SLC6A4 (Homo sapiens) 6480464 Triclosan results in decreased expression of SLC6A4 mRNA CTD PMID:30510588 Slc6a4 Rat triphenyl phosphate affects expression ISO SLC6A4 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of SLC6A4 mRNA CTD PMID:37042841 Slc6a4 Rat triphenyl phosphate multiple interactions EXP 6480464 [triphenyl phosphate co-treated with Flame Retardants] results in decreased expression of SLC6A4 mRNA CTD PMID:32243540 Slc6a4 Rat triptonide increases expression ISO Slc6a4 (Mus musculus) 6480464 triptonide results in increased expression of SLC6A4 mRNA CTD PMID:33045310 Slc6a4 Rat trisodium vanadate increases activity EXP 38549585 sodium vanadate increases activity of Slc6a4 protein in synaptosomes RGD Slc6a4 Rat trisodium vanadate increases activity EXP 38549589 trisodium vanadate increases activity of Slc6a4 protein in cultured neurons RGD Slc6a4 Rat trovafloxacin increases expression ISO Slc6a4 (Mus musculus) 6480464 trovafloxacin results in increased expression of SLC6A4 mRNA CTD PMID:35537566 Slc6a4 Rat tryptamine multiple interactions ISO SLC6A4 (Homo sapiens) 6480464 Citalopram inhibits the reaction [SLC6A4 protein promotes the reaction [tryptamine results in increased activity of TAAR1 protein]] more ... CTD PMID:17234900 Slc6a4 Rat tyramine multiple interactions ISO SLC6A4 (Homo sapiens) 6480464 Citalopram inhibits the reaction [SLC6A4 protein promotes the reaction [Tyramine results in increased activity of TAAR1 protein]] more ... CTD PMID:17234900 Slc6a4 Rat urethane decreases expression ISO SLC6A4 (Homo sapiens) 6480464 Urethane results in decreased expression of SLC6A4 mRNA CTD PMID:28818685 Slc6a4 Rat valproic acid decreases expression ISO SLC6A4 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of SLC6A4 mRNA CTD PMID:34748853 Slc6a4 Rat valproic acid affects expression ISO SLC6A4 (Homo sapiens) 6480464 Valproic Acid affects the expression of SLC6A4 mRNA CTD PMID:34742744 Slc6a4 Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of SLC6A4 mRNA CTD PMID:33150595 Slc6a4 Rat valproic acid increases methylation EXP 6480464 Valproic Acid results in increased methylation of SLC6A4 promoter CTD PMID:33150595 Slc6a4 Rat vancomycin increases expression ISO Slc6a4 (Mus musculus) 6480464 Vancomycin results in increased expression of SLC6A4 mRNA CTD PMID:18930951 Slc6a4 Rat venlafaxine hydrochloride affects response to substance ISO SLC6A4 (Homo sapiens) 6480464 SLC6A4 gene polymorphism affects the susceptibility to Venlafaxine Hydrochloride CTD PMID:17503984 Slc6a4 Rat vortioxetine multiple interactions ISO SLC6A4 (Homo sapiens) 6480464 vortioxetine binds to and results in decreased activity of SLC6A4 protein CTD PMID:21486038 Slc6a4 Rat vortioxetine decreases expression ISO SLC6A4 (Homo sapiens) 6480464 Vortioxetine results in decreased expression of SLC6A4 protein CTD PMID:38043629 Slc6a4 Rat vortioxetine multiple interactions EXP 6480464 vortioxetine binds to and results in decreased activity of SLC6A4 protein CTD PMID:21486038 Slc6a4 Rat zinc atom increases expression EXP 6480464 Zinc deficiency results in increased expression of SLC6A4 mRNA CTD PMID:16413754 Slc6a4 Rat zinc atom multiple interactions EXP 6480464 Zinc inhibits the reaction [Zinc deficiency results in decreased expression of SLC6A4 mRNA] CTD PMID:16140947 Slc6a4 Rat zinc atom decreases expression EXP 6480464 Zinc deficiency results in decreased expression of SLC6A4 mRNA CTD PMID:16140947 Slc6a4 Rat zinc(0) increases expression EXP 6480464 Zinc deficiency results in increased expression of SLC6A4 mRNA CTD PMID:16413754 Slc6a4 Rat zinc(0) decreases expression EXP 6480464 Zinc deficiency results in decreased expression of SLC6A4 mRNA CTD PMID:16140947 Slc6a4 Rat zinc(0) multiple interactions EXP 6480464 Zinc inhibits the reaction [Zinc deficiency results in decreased expression of SLC6A4 mRNA] CTD PMID:16140947
Imported Annotations - SMPDB
(R)-noradrenaline (ISO) (R)-octopamine (ISO) (S)-amphetamine (EXP,ISO) (S)-colchicine (ISO) (S)-fenfluramine (ISO) 1,2-dimethylhydrazine (EXP,ISO) 1-(3-chlorophenyl)piperazine (ISO) 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine (EXP) 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,5-dimethoxy-4-bromophenethylamine (ISO) 2-phenylethylamine (ISO) 3,4-methylenedioxymethamphetamine (EXP,ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) 8-OH-DPAT (EXP) aflatoxin B1 (ISO) alendronic acid (EXP) all-trans-retinoic acid (ISO) aminorex (EXP) ammonium chloride (EXP) amphetamine (ISO) antirheumatic drug (ISO) aripiprazole (ISO) aristolochic acid A (ISO) Aroclor 1254 (EXP) arsane (EXP) arsenic atom (EXP) atorvastatin calcium (EXP) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (EXP,ISO) bupropion (ISO) cadmium atom (ISO) cannabidiol (ISO) cantharidin (ISO) carbon nanotube (ISO) carbonyl sulfide (EXP) CGP 52608 (ISO) chlorpyrifos (EXP) citalopram (ISO) clomipramine (ISO) clozapine (EXP,ISO) cocaine (EXP,ISO) copper atom (EXP) copper(0) (EXP) copper(II) sulfate (ISO) cyclosporin A (ISO) cyhalothrin (EXP) dexamethasone (EXP) dextromethorphan (EXP) diazinon (EXP) Dibutyl phosphate (ISO) dieldrin (EXP) diisononyl phthalate (ISO) diquat (ISO) dopamine (ISO) ethanol (ISO) ethylparaben (ISO) excitatory amino acid agonist (EXP) fluoxetine (EXP,ISO) fluoxetine hydrochloride (EXP) folic acid (ISO) formaldehyde (ISO) forskolin (ISO) fulvestrant (ISO) fumonisin B1 (ISO) gabapentin (ISO) genistein (EXP,ISO) glyphosate (ISO) haloperidol (EXP) hydrogen peroxide (ISO) hydroxyurea (ISO) imipramine (EXP) ketanserin (ISO) lamivudine (ISO) lithium chloride (ISO) Mazindol (ISO) mephedrone (EXP,ISO) mepyramine (ISO) mercury atom (ISO) mercury dichloride (EXP) mercury(0) (ISO) methamidophos (ISO) methamphetamine (EXP,ISO) monensin A (ISO) mono(2-ethylhexyl) phthalate (ISO) monocrotaline (EXP,ISO) N-ethyl-N-nitrosourea (EXP) N-Nitrosopyrrolidine (ISO) nickel atom (EXP) nisoxetine (ISO) nitrates (ISO) nitrofen (EXP) nomifensine (ISO) nortriptyline (ISO) O-methyleugenol (ISO) ochratoxin A (ISO) octopamine (ISO) oxaliplatin (EXP) oxidopamine (EXP) paracetamol (EXP) parathion (EXP) paroxetine (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phorbol 13-acetate 12-myristate (EXP) piperazines (ISO) pirinixic acid (EXP,ISO) quercetin (ISO) raloxifene (EXP) reserpine (EXP) ribavirin (ISO) serotonin (EXP,ISO) sertraline (EXP,ISO) simvastatin (ISO) sodium arsenite (ISO) staurosporine (ISO) streptozocin (ISO) sulfadiazine (ISO) Sunset Yellow FCF (ISO) tetrachloroethene (ISO) tetrahydropalmatine (ISO) Theaflavin 3,3'-digallate (ISO) tianeptine (ISO) titanium dioxide (ISO) topotecan (EXP) triclosan (ISO) triphenyl phosphate (EXP,ISO) triptonide (ISO) trisodium vanadate (EXP) trovafloxacin (ISO) tryptamine (ISO) tyramine (ISO) urethane (ISO) valproic acid (EXP,ISO) vancomycin (ISO) venlafaxine hydrochloride (ISO) vortioxetine (EXP,ISO) zinc atom (EXP) zinc(0) (EXP)
Biological Process
amino acid transport (IBA) behavioral response to cocaine (IMP) brain morphogenesis (IEA,ISO) cellular response to cGMP (IDA) cellular response to retinoic acid (IEP) circadian rhythm (IMP) conditioned place preference (IMP) enteric nervous system development (IEA,ISO) locomotory behavior (NAS) male mating behavior (IMP) membrane depolarization (IDA) memory (IMP) monoamine transport (IEA,ISO) negative regulation of cerebellar granule cell precursor proliferation (IMP) negative regulation of neuron differentiation (IMP) negative regulation of organ growth (IEA,ISO) negative regulation of synaptic transmission, dopaminergic (IMP) neurotransmitter reuptake (IEA,ISO) neurotransmitter transport (IEA,ISO) platelet aggregation (IEA,ISO,ISS) positive regulation of cell cycle (IEA,ISO) positive regulation of gene expression (IEA,ISO) positive regulation of serotonin secretion (IMP) regulation of thalamus size (IEA,ISO,ISS) response to estradiol (IEP) response to hypoxia (IEP) response to nutrient (IEP) response to toxic substance (IEA,ISO) response to xenobiotic stimulus (IEP) serotonin transport (IDA,IEA,IMP,ISO,TAS) serotonin uptake (IBA,IDA,IEA,IMP,ISO) sodium ion transmembrane transport (IBA) vasoconstriction (IMP)
Cellular Component
anchoring junction (IEA) cell projection (IEA) endomembrane system (IDA,IEA,ISO,NAS) endosome (IEA) endosome membrane (IEA) focal adhesion (IEA,ISO,ISS) membrane (IEA) membrane raft (IEA,ISO) neuron projection (IBA,IEA) plasma membrane (IBA,IDA,IEA,ISO) postsynaptic membrane (IDA) presynaptic membrane (IDA) serotonergic synapse (IDA) synapse (IBA,IEA,ISO,ISS)
Molecular Function
actin filament binding (IDA) antiporter activity (IEA,ISO) cocaine binding (IMP) identical protein binding (IMP,IPI) integrin binding (IEA,ISO,ISS) metal ion binding (IEA) monoamine transmembrane transporter activity (IEA,ISO) monoatomic cation channel activity (IDA) neurotransmitter transmembrane transporter activity (IEA,ISO) nitric-oxide synthase binding (IEA,ISO) protein binding (IPI,ISO) serotonin binding (IBA,IEA,ISO,ISS) serotonin:sodium:chloride symporter activity (IBA,IDA,IEA,IMP,ISO,TAS) sodium ion binding (IEA,ISO,ISS) syntaxin-1 binding (IPI)
1.
No Influence of a functional polymorphism within the serotonin transporter gene on partial sleep deprivation in major depression.
Baghai TC, etal., World J Biol Psychiatry. 2003 Jul;4(3):111-4. doi: 10.1080/15622970310029903.
2.
Serotonin transporter polymorphism moderates the effects of caregiver intrusiveness on ADHD symptoms among institutionalized preschoolers.
Baptista J, etal., Eur Child Adolesc Psychiatry. 2017 Mar;26(3):303-313. doi: 10.1007/s00787-016-0890-x. Epub 2016 Jul 18.
3.
Three autism candidate genes: a synthesis of human genetic analysis with other disciplines.
Bartlett CW, etal., Int J Dev Neurosci 2005 Apr-May;23(2-3):221-34.
4.
Influence of a functional polymorphism within the promoter of the serotonin transporter gene on the effects of total sleep deprivation in bipolar depression.
Benedetti F, etal., Am J Psychiatry. 1999 Sep;156(9):1450-2. doi: 10.1176/ajp.156.9.1450.
5.
A Western Diet Increases Serotonin Availability in Rat Small Intestine.
Bertrand RL, etal., Endocrinology. 2010 Nov 10.
6.
Effects of 3,4-methylenedioxymethamphetamine (MDMA) on serotonin transporter and vesicular monoamine transporter 2 protein and gene expression in rats: implications for MDMA neurotoxicity.
Biezonski DK and Meyer JS, J Neurochem. 2010 Feb;112(4):951-62. Epub 2009 Nov 30.
7.
Cloning and expression of a functional serotonin transporter from rat brain.
Blakely RD, etal., Nature. 1991 Nov 7;354(6348):66-70. doi: 10.1038/354066a0.
8.
Increased cocaine self-administration in rats lacking the serotonin transporter: a role for glutamatergic signaling in the habenula.
Caffino L, etal., Addict Biol. 2019 Nov;24(6):1167-1178. doi: 10.1111/adb.12673. Epub 2018 Aug 24.
9.
Association study of serotonin transporter gene polymorphisms and ventricular septal defects related possible pulmonary arterial hypertension in Chinese population.
Cao H, etal., Clin Exp Hypertens. 2009 Oct;31(7):605-14.
10.
The Serotonin Transporter Plays an Important Role in Male Sexual Behavior: A Study in Serotonin Transporter Knockout Rats.
Chan JS, etal., J Sex Med. 2010 Aug 5.
11.
Association of the serotonin transporter gene with serum cholesterol levels and heart disease.
Comings DE, etal., Mol Genet Metab. 1999 Jul;67(3):248-53.
12.
Serotonin signaling in diverticular disease.
Costedio MM, etal., J Gastrointest Surg. 2008 Aug;12(8):1439-45. doi: 10.1007/s11605-008-0536-5. Epub 2008 May 20.
13.
The serotonin transporter and 5HT2A receptor in rat brain after localized lesions.
Dam H, etal., Neurol Res. 2007 Oct;29(7):717-22.
14.
Prenatal exposure to maternal depressed mood and the MTHFR C677T variant affect SLC6A4 methylation in infants at birth.
Devlin AM, etal., PLoS One. 2010 Aug 16;5(8):e12201. doi: 10.1371/journal.pone.0012201.
15.
Serotonin transporter gene hypomethylation predicts impaired antidepressant treatment response.
Domschke K, etal., Int J Neuropsychopharmacol. 2014 Aug;17(8):1167-76. doi: 10.1017/S146114571400039X. Epub 2014 Mar 28.
16.
Sequence variations of ABCB1, SLC6A2, SLC6A3, SLC6A4, CREB1, CRHR1 and NTRK2: association with major depression and antidepressant response in Mexican-Americans.
Dong C, etal., Mol Psychiatry. 2009 Dec;14(12):1105-18. Epub 2009 Oct 20.
17.
Association of polymorphisms in serotonin and nitric oxide genes with clinical outcome of dengue in Brazilian northeast population.
Dos Santos ACM, etal., Acta Trop. 2019 Feb;190:144-148. doi: 10.1016/j.actatropica.2018.11.015. Epub 2018 Nov 16.
18.
The serotonin transporter polymorphism, 5HTTLPR, is associated with a faster response time to sertraline in an elderly population with major depressive disorder.
Durham LK, etal., Psychopharmacology (Berl). 2004 Aug;174(4):525-9. doi: 10.1007/s00213-003-1562-3. Epub 2003 Sep 4.
19.
Dexfenfluramine-associated changes in 5-hydroxytryptamine transporter expression and development of hypoxic pulmonary hypertension in rats.
Eddahibi S, etal., J Pharmacol Exp Ther. 2001 Apr;297(1):148-54.
20.
Functional genetic variants that increase synaptic serotonin and 5-HT3 receptor sensitivity predict alcohol and drug dependence.
Enoch MA, etal., Mol Psychiatry. 2011 Nov;16(11):1139-46. doi: 10.1038/mp.2010.94. Epub 2010 Sep 14.
21.
Enteropathogenic Escherichia coli infection inhibits intestinal serotonin transporter function and expression.
Esmaili A, etal., Gastroenterology. 2009 Dec;137(6):2074-83. doi: 10.1053/j.gastro.2009.09.002. Epub 2009 Sep 10.
22.
Association between the Stin2 VNTR polymorphism of the serotonin transporter gene and treatment outcome in alcohol-dependent patients.
Florez G, etal., Alcohol Alcohol. 2008 Sep-Oct;43(5):516-22. doi: 10.1093/alcalc/agn048. Epub 2008 Jun 14.
23.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
24.
Serotonin transport is modulated differently by tetanus toxin and growth factors.
Gil C, etal., Neurochem Int. 2003 Jun;42(7):535-42. doi: 10.1016/s0197-0186(02)00187-0.
25.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
26.
[The role of the 5-HTTLPR polymorphism of the serotonin transporter gene in the development of depression in patients with coronary heart disease].
Golimbet VE, etal., Zh Nevrol Psikhiatr Im S S Korsakova. 2012;112(8):63-9.
27.
The pulmonary hypertensive fawn-hooded rat has a normal serotonin transporter coding sequence.
Gonzalez AM, etal., Am J Respir Cell Mol Biol 1998 Aug;19(2):245-9.
28.
Regulation of the serotonin transporter by interacting proteins.
Haase J, etal., Biochem Soc Trans. 2001 Nov;29(Pt 6):722-8.
29.
Cerebral glucose utilisation in hepatitis C virus infection-associated encephalopathy.
Heeren M, etal., J Cereb Blood Flow Metab. 2011 Nov;31(11):2199-208. doi: 10.1038/jcbfm.2011.82. Epub 2011 Jun 1.
30.
Cloning of a serotonin transporter affected by antidepressants.
Hoffman BJ, etal., Science 1991 Oct 25;254(5031):579-80.
31.
Upregulation of serotonin-receptor-2a and serotonin transporter expression in the pulmonary vasculature of nitrofen-induced congenital diaphragmatic hernia.
Hofmann AD, etal., J Pediatr Surg. 2014 Jun;49(6):871-4; discussion 874-5. doi: 10.1016/j.jpedsurg.2014.01.015. Epub 2014 Jan 31.
32.
Adaptations in pre- and postsynaptic 5-HT1A receptor function and cocaine supersensitivity in serotonin transporter knockout rats.
Homberg JR, etal., Psychopharmacology (Berl). 2008 Oct;200(3):367-80. Epub 2008 Jun 27.
33.
Association of SLC6A4 5-HTTLPR and TRPV1 945G>C with functional dyspepsia in Korea.
Hwang SW, etal., J Gastroenterol Hepatol. 2014 Oct;29(10):1770-7. doi: 10.1111/jgh.12596.
34.
Association of serotonin transporter gene variation with smoking, chronic obstructive pulmonary disease, and its depressive symptoms.
Ishii T, etal., J Hum Genet. 2010 Oct 28.
35.
The CC genotype in HTR2A T102C polymorphism is associated with behavioral impulsivity in alcohol-dependent patients.
Jakubczyk A, etal., J Psychiatr Res. 2012 Jan;46(1):44-9. doi: 10.1016/j.jpsychires.2011.09.001. Epub 2011 Sep 17.
36.
Controlled clinical comparison of paroxetine and fluvoxamine considering the serotonin transporter promoter polymorphism.
Kato M, etal., Int Clin Psychopharmacol. 2005 May;20(3):151-6. doi: 10.1097/00004850-200505000-00005.
37.
Oligomerization of serotonin transporter and its functional consequences.
Kilic F and Rudnick G, Proc Natl Acad Sci U S A. 2000 Mar 28;97(7):3106-11.
38.
Body image, sexual function and depression in Korean patients with breast cancer: modification by 5-HTT polymorphism.
Kim KR, etal., Support Care Cancer. 2012 Sep;20(9):2177-82. doi: 10.1007/s00520-011-1329-z. Epub 2011 Dec 2.
39.
Transmission disequilibrium mapping at the serotonin transporter gene (SLC6A4) region in autistic disorder.
Kim SJ, etal., Mol Psychiatry. 2002;7(3):278-88.
40.
[Chronic administration of serotonin transporter inhibitor (fluoxetine) decreases monocrotaline-induced pulmonary hypertension in rats]
Kozhevnikova VV and Medvedeva NA, Eksp Klin Farmakol. 2007 Sep-Oct;70(5):15-8.
41.
Serotonin transporter gene polymorphism associated with short-term treatment response to venlafaxine.
Lee SH, etal., Neuropsychobiology. 2010 Aug;62(3):198-206. doi: 10.1159/000319362. Epub 2010 Jul 22.
42.
Single-channel currents produced by the serotonin transporter and analysis of a mutation affecting ion permeation.
Lin F, etal., Biophys J. 1996 Dec;71(6):3126-35. doi: 10.1016/S0006-3495(96)79506-1.
43.
Vascular reactivity, 5-HT uptake, and blood pressure in the serotonin transporter knockout rat.
Linder AE, etal., Am J Physiol Heart Circ Physiol. 2008 Apr;294(4):H1745-52. Epub 2008 Feb 8.
44.
Postnatal changes in tryptophan hydroxylase and serotonin transporter immunoreactivity in multiple brainstem nuclei of the rat: implications for a sensitive period.
Liu Q and Wong-Riley MT, J Comp Neurol. 2010 Apr 1;518(7):1082-97.
45.
NEUROPSYCHOBIOLOGICAL MECHANISMS OF AFFECTIVE AND COGNITIVE DISORDERS IN THE CHORNOBYL CLEAN-UP WORKERS TAKING INTO ACCOUNT THE SPECIFIC GENE POLYMORPHISMS.
Loganovsky KN, etal., Probl Radiac Med Radiobiol. 2018 Dec;23:373-409. doi: 10.33145/2304-8336-2018-23-373-409.
46.
Interaction between polymorphisms in serotonin transporter (SLC6A4) and serotonin receptor 2A (HTR2A) genes predict treatment response to venlafaxine XR in generalized anxiety disorder.
Lohoff FW, etal., Pharmacogenomics J. 2013 Oct;13(5):464-9. doi: 10.1038/tpj.2012.33. Epub 2012 Aug 21.
47.
Genetic association of the serotonin transporter in pulmonary arterial hypertension.
Machado RD, etal., Am J Respir Crit Care Med. 2006 Apr 1;173(7):793-7. Epub 2006 Jan 6.
48.
Partitioning of the serotonin transporter into lipid microdomains modulates transport of serotonin.
Magnani F, etal., J Biol Chem. 2004 Sep 10;279(37):38770-8. Epub 2004 Jun 29.
49.
Serotonin transporter gene (SLC6A4) polymorphisms are associated with response to fluoxetine in south Indian major depressive disorder patients.
Manoharan A, etal., Eur J Clin Pharmacol. 2016 Oct;72(10):1215-1220. doi: 10.1007/s00228-016-2099-9. Epub 2016 Jul 20.
50.
Serotonin transporter protein overexpression and association to Th17 and T regulatory cells in lupoid leishmaniasis.
Mashayekhi Goyonlo V, etal., Arch Dermatol Res. 2014 Mar;306(2):181-8. doi: 10.1007/s00403-013-1395-9. Epub 2013 Aug 29.
51.
Deletion of the serotonin transporter in rats disturbs serotonin homeostasis without impairing liver regeneration.
Matondo RB, etal., Am J Physiol Gastrointest Liver Physiol. 2009 Apr;296(4):G963-8. Epub 2009 Feb 26.
52.
Isolation of cDNAs encoding a novel member of the neurotransmitter transporter gene family.
Mayser W, etal., FEBS Lett 1991 Dec 16;295(1-3):203-6.
53.
Deficiency of the 5-hydroxytryptamine transporter gene leads to cardiac fibrosis and valvulopathy in mice.
Mekontso-Dessap A, etal., Circulation. 2006 Jan 3;113(1):81-9. Epub 2005 Dec 27.
54.
Maintenance of Chronic Fatigue Syndrome (CFS) in Young CFS Patients Is Associated with the 5-HTTLPR and SNP rs25531 A > G Genotype.
Meyer B, etal., PLoS One. 2015 Oct 16;10(10):e0140883. doi: 10.1371/journal.pone.0140883. eCollection 2015.
55.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
56.
Role of C-terminal region in the functional regulation of rat serotonin transporter (SERT).
Mochizuki H, etal., Neurochem Int. 2005 Jan;46(2):93-105. Epub 2004 Nov 26.
57.
In vivo effects of a combined 5-HT1B receptor/SERT antagonist in experimental pulmonary hypertension.
Morecroft I, etal., Cardiovasc Res. 2010 Feb 1;85(3):593-603. Epub 2009 Sep 7.
58.
Molecular cloning, expression and characterization of a bovine serotonin transporter.
Mortensen OV, etal., Brain Res Mol Brain Res. 1999 Jul 23;71(1):120-6. doi: 10.1016/s0169-328x(99)00178-3.
59.
Serotonin receptor 3A polymorphism c.-42C > T is associated with severe dyspepsia.
Mujakovic S, etal., BMC Med Genet. 2011 Oct 20;12:140. doi: 10.1186/1471-2350-12-140.
60.
Subcellular redistribution of the serotonin transporter by secretory carrier membrane protein 2.
Muller HK, etal., J Biol Chem. 2006 Sep 29;281(39):28901-9. Epub 2006 Jul 26.
61.
Unaltered susceptibility to scrapie in serotonin transporter deficient mice.
Mössner R, etal., Neurochem Int. 2006 Oct;49(5):454-8. doi: 10.1016/j.neuint.2006.03.008. Epub 2006 May 30.
62.
Serotonin transporter phosphorylation modulated by tetanus toxin.
Najib A, etal., FEBS Lett. 2000 Dec 8;486(2):136-42. doi: 10.1016/s0014-5793(00)02294-8.
63.
Association between serotonin transporter gene polymorphism and chronic fatigue syndrome.
Narita M, etal., Biochem Biophys Res Commun. 2003 Nov 14;311(2):264-6. doi: 10.1016/j.bbrc.2003.09.207.
64.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
65.
Prenatal alcohol exposure alters methyl metabolism and programs serotonin transporter and glucocorticoid receptor expression in brain.
Ngai YF, etal., Am J Physiol Regul Integr Comp Physiol. 2015 Sep;309(5):R613-22. doi: 10.1152/ajpregu.00075.2015. Epub 2015 Jul 15.
66.
Selective serotonin reuptake inhibitors and raft inhibitors shorten the period of Period1-driven circadian bioluminescence rhythms in rat-1 fibroblasts.
Nomura K, etal., Life Sci. 2008 Jun 6;82(23-24):1169-74. Epub 2008 Apr 16.
67.
Consequences of Citrobacter rodentium infection on enteroendocrine cells and the enteric nervous system in the mouse colon.
O'Hara JR, etal., Cell Microbiol. 2006 Apr;8(4):646-60. doi: 10.1111/j.1462-5822.2005.00657.x.
68.
13-cis-Retinoic acid alters intracellular serotonin, increases 5-HT1A receptor, and serotonin reuptake transporter levels in vitro.
O'Reilly KC, etal., Exp Biol Med (Maywood). 2007 Oct;232(9):1195-203.
69.
Time course of opioid and cannabinoid gene transcription alterations induced by repeated administration with fluoxetine in the rat brain.
Oliva JM, etal., Neuropharmacology. 2005 Oct;49(5):618-26. doi: 10.1016/j.neuropharm.2005.04.014.
70.
A study in male and female 5-HT transporter knockout rats: an animal model for anxiety and depression disorders.
Olivier JD, etal., Neuroscience. 2008 Mar 27;152(3):573-84. Epub 2008 Jan 1.
71.
Repeat length polymorphism of the serotonin transporter gene influences pulmonary artery pressure in heart failure.
Olson TP, etal., Am Heart J. 2007 Mar;153(3):426-32.
72.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
73.
Serotonin transporter missense mutation associated with a complex neuropsychiatric phenotype.
Ozaki N, etal., Mol Psychiatry. 2003 Nov;8(11):933-6.
74.
Glycosyl modification facilitates homo- and hetero-oligomerization of the serotonin transporter. A specific role for sialic acid residues.
Ozaslan D, etal., J Biol Chem. 2003 Nov 7;278(45):43991-4000. Epub 2003 Aug 27.
75.
Genetic determinants of alcohol addiction and metabolism: a survey in Italy.
Pastorelli R, etal., Alcohol Clin Exp Res. 2001 Feb;25(2):221-7.
76.
Tetanus toxin modulates serotonin transport in rat-brain neuronal cultures.
Pelliccioni P, etal., J Mol Neurosci. 2001 Dec;17(3):303-10. doi: 10.1385/JMN:17:3:303.
77.
Ultrastructural localization of the serotonin transporter in limbic and motor compartments of the nucleus accumbens.
Pickel VM and Chan J, J Neurosci. 1999 Sep 1;19(17):7356-66.
78.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
79.
Effects of genetic background on neonatal Borna disease virus infection-induced neurodevelopmental damage. II. Neurochemical alterations and responses to pharmacological treatments.
Pletnikov MV, etal., Brain Res. 2002 Jul 19;944(1-2):108-23. doi: 10.1016/s0006-8993(02)02724-5.
80.
Genetic Associations of Alexithymia in Predicting Interferon-Induced Depression in Chronic Hepatitis C.
Porcelli P, etal., Psychopathology. 2015;48(6):417-20. doi: 10.1159/000441682. Epub 2015 Nov 27.
81.
Regulating the conducting states of a mammalian serotonin transporter.
Quick MW Neuron. 2003 Oct 30;40(3):537-49.
82.
Cyclic AMP-independent up-regulation of the human serotonin transporter by staurosporine in choriocarcinoma cells.
Ramamoorthy JD, etal., J Biol Chem. 1995 Jul 21;270(29):17189-95. doi: 10.1074/jbc.270.29.17189.
83.
Regulation of the human serotonin transporter. Cholera toxin-induced stimulation of serotonin uptake in human placental choriocarcinoma cells is accompanied by increased serotonin transporter mRNA levels and serotonin transporter-specific ligand binding.
Ramamoorthy S, etal., J Biol Chem. 1993 Oct 15;268(29):21626-31.
84.
Phosphorylation of threonine residue 276 is required for acute regulation of serotonin transporter by cyclic GMP.
Ramamoorthy S, etal., J Biol Chem. 2007 Apr 20;282(16):11639-47. Epub 2007 Feb 19.
85.
GOA pipeline
RGD automated data pipeline
86.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
87.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
88.
Estradiol increases Pet-1 and serotonin transporter mRNA in the midbrain raphe nuclei of ovariectomized rats.
Rivera HM, etal., Brain Res. 2009 Mar 9;1259:51-8. Epub 2009 Jan 10.
89.
Chronic buspirone treatment decreases 5-HT1B receptor densities and the serotonin transporter but increases the density of 5-HT2A receptors in the bulbectomized rat model of depression: an autoradiographic study.
Sato H, etal., Brain Res. 2010 Jul 23;1345:28-44. Epub 2010 May 23.
90.
Effects of S-citalopram, citalopram, and R-citalopram on the firing patterns of dopamine neurons in the ventral tegmental area, N-methyl-D-aspartate receptor-mediated transmission in the medial prefrontal cortex and cognitive function in the rat.
Schilstrom B, etal., Synapse. 2010 Aug 20.
91.
Interaction of paroxetine with mitochondrial proteins mediates neuroprotection.
Steiner JP, etal., Neurotherapeutics. 2015 Jan;12(1):200-16. doi: 10.1007/s13311-014-0315-9.
92.
Pentylenetetrazol-kindling of seizures selectively decreases -citalopram binding in the CA-3 area of rat hippocampus.
Szyndler J, etal., Neurosci Lett 2002 Dec 19;335(1):49-53.
93.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
94.
Serotonin and interleukin-6: the role of genetic polymorphisms in IFN-induced neuropsychiatric symptoms.
Udina M, etal., Psychoneuroendocrinology. 2013 Sep;38(9):1803-13. doi: 10.1016/j.psyneuen.2013.03.007. Epub 2013 Apr 6.
95.
Genetic polymorphisms of the serotonin transporter, but not the 2a receptor or nitric oxide synthetase, are associated with pulmonary hypertension in chronic obstructive pulmonary disease.
Ulrich S, etal., Respiration. 2010;79(4):288-95. Epub 2009 Jun 24.
96.
Reduced cocaine-induced serotonin, but not dopamine and noradrenaline, release in rats with a genetic deletion of serotonin transporters.
Verheij MM, etal., Eur Neuropsychopharmacol. 2014 Nov;24(11):1850-4. doi: 10.1016/j.euroneuro.2014.09.004. Epub 2014 Sep 16.
97.
Localization and function of a 5-HT transporter in crypt epithelia of the gastrointestinal tract.
Wade PR, etal., J Neurosci. 1996 Apr 1;16(7):2352-64. doi: 10.1523/JNEUROSCI.16-07-02352.1996.
98.
In vivo studies of the SERT-selective FPBM and VMAT2-selective [18F]AV-133 radiotracers in a rat model of Parkinson's disease.
Wang JL, etal., Nucl Med Biol. 2010 May;37(4):479-86.
99.
[Association of 5-hydroxytryptamine transporter gene polymorphism with asthma and comorbid depression]
Wang L, etal., Zhonghua Yi Xue Yi Chuan Xue Za Zhi. 2009 Oct;26(5):575-9.
100.
Potentiation of 5-hydroxytryptamine (5-HT) responses by a 5-HT uptake inhibitor in pulmonary and systemic vessels: effects of exposing rats to hypoxia.
Wanstall JC, etal., Naunyn Schmiedebergs Arch Pharmacol. 2003 Dec;368(6):520-7. Epub 2003 Nov 6.
101.
Enterochromaffin cell hyperplasia and decreased serotonin transporter in a mouse model of postinfectious bowel dysfunction.
Wheatcroft J, etal., Neurogastroenterol Motil. 2005 Dec;17(6):863-70. doi: 10.1111/j.1365-2982.2005.00719.x.
102.
Serotonin transporter polymorphisms in familial and idiopathic pulmonary arterial hypertension.
Willers ED, etal., Am J Respir Crit Care Med. 2006 Apr 1;173(7):798-802. Epub 2005 Dec 9.
103.
Reduction of serotonin transporters of patients with chronic fatigue syndrome.
Yamamoto S, etal., Neuroreport. 2004 Dec 3;15(17):2571-4. doi: 10.1097/00001756-200412030-00002.
104.
Association of serotonin transporter gene polymorphism with obstructive sleep apnea syndrome.
Ylmaz M, etal., Laryngoscope. 2005 May;115(5):832-6.
105.
Association study of serotonin transporter gene polymorphisms with obstructive sleep apnea syndrome in Chinese Han population.
Yue W, etal., Sleep. 2008 Nov 1;31(11):1535-41.
106.
Zhonghua yi xue yi chuan xue za zhi = Zhonghua yixue yichuanxue zazhi = Chinese journal of medical genetics
Yue WH, etal., Zhonghua Yi Xue Yi Chuan Xue Za Zhi. 2005 Oct;22(5):533-6.
107.
Serotonin transporter binding increases in caudate-putamen and nucleus accumbens after neonatal 6-hydroxydopamine lesions in rats: implications for motor hyperactivity.
Zhang K, etal., Brain Res Dev Brain Res 2002 Aug 30;137(2):135-8.
108.
Cysteine-scanning mutagenesis of serotonin transporter intracellular loop 2 suggests an alpha-helical conformation.
Zhang YW and Rudnick G, J Biol Chem. 2005 Sep 2;280(35):30807-13. Epub 2005 Jul 1.
109.
Continuous fluoxetine administration prevents recurrence of pulmonary arterial hypertension and prolongs survival in rats.
Zhu SP, etal., Clin Exp Pharmacol Physiol. 2009 Aug;36(8):e1-5. Epub 2009 Mar 26.
110.
Fluoxetine-induced proliferation and differentiation of neural progenitor cells isolated from rat postnatal cerebellum.
Zusso M, etal., Biochem Pharmacol. 2008 Aug 1;76(3):391-403. Epub 2008 May 23.
Slc6a4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 62,322,688 - 62,357,060 (+) NCBI GRCr8 mRatBN7.2 10 61,824,208 - 61,858,924 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 61,826,123 - 61,858,384 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 66,483,857 - 66,505,046 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 65,989,335 - 66,010,524 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 61,459,175 - 61,480,332 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 63,153,656 - 63,188,377 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 63,153,651 - 63,176,463 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 62,851,326 - 62,872,481 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 67,134,790 - 67,155,891 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 67,148,412 - 67,197,988 (-) NCBI Celera 10 60,845,942 - 60,866,725 (+) NCBI Celera Cytogenetic Map 10 q24 NCBI
SLC6A4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 30,194,319 - 30,235,697 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 30,194,319 - 30,236,002 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 28,521,337 - 28,562,715 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 25,549,032 - 25,586,841 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 25,549,031 - 25,586,831 NCBI Celera 17 25,385,103 - 25,424,627 (-) NCBI Celera Cytogenetic Map 17 q11.2 NCBI HuRef 17 24,731,684 - 24,773,327 (-) NCBI HuRef CHM1_1 17 28,583,810 - 28,625,471 (-) NCBI CHM1_1 T2T-CHM13v2.0 17 31,138,872 - 31,180,231 (-) NCBI T2T-CHM13v2.0
Slc6a4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 76,889,423 - 76,923,169 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 76,889,429 - 76,923,166 (+) Ensembl GRCm39 Ensembl GRCm38 11 76,998,597 - 77,032,343 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 76,998,603 - 77,032,340 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 76,812,099 - 76,845,845 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 76,814,792 - 76,848,536 (+) NCBI MGSCv36 mm8 Celera 11 84,497,023 - 84,530,633 (+) NCBI Celera Cytogenetic Map 11 B5 NCBI cM Map 11 46.18 NCBI
Slc6a4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955481 3,088,416 - 3,125,711 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955481 3,088,440 - 3,122,421 (+) NCBI ChiLan1.0 ChiLan1.0
SLC6A4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 34,227,536 - 34,255,470 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 36,108,094 - 36,136,018 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 26,546,177 - 26,572,301 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 27,050,900 - 27,089,444 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 27,050,900 - 27,092,882 (+) Ensembl panpan1.1 panPan2
SLC6A4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 44,224,026 - 44,259,655 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 44,224,229 - 44,259,736 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 43,375,681 - 43,398,433 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 45,040,878 - 45,077,650 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 45,042,211 - 45,077,764 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 43,823,112 - 43,845,857 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 44,109,908 - 44,132,663 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 44,194,421 - 44,217,174 (-) NCBI UU_Cfam_GSD_1.0
Slc6a4 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 43,327,307 - 43,361,581 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936538 6,205,251 - 6,239,083 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936538 6,205,268 - 6,239,062 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SLC6A4 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 46,285,997 - 46,314,378 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 46,285,995 - 46,328,377 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 48,106,444 - 48,135,338 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SLC6A4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 23,929,196 - 23,969,665 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 23,927,311 - 23,955,616 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666075 6,110,560 - 6,136,546 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Slc6a4
.
Predicted Target Of
Count of predictions: 99 Count of miRNA genes: 76 Interacting mature miRNAs: 90 Transcripts: ENSRNOT00000004717 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61441 Btemp1 Thermal response to stress QTL 1 4 body temperature trait (VT:0005535) core body temperature (CMO:0001036) 10 35392457 63642539 Rat 1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 152025229 Scl83 Serum cholesterol level QTL 83 4.33 blood cholesterol amount (VT:0000180) 10 35710580 68663659 Rat 1578779 Tcas10 Tongue tumor susceptibility QTL 10 3.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 10 31297439 76297439 Rat 152025227 Bw195 Body weight QTL 195 5.73 body mass (VT:0001259) 10 46989699 68663659 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 2293669 Bmd33 Bone mineral density QTL 33 4.5 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 10 49444551 81709989 Rat 152025224 Bw193 Body weight QTL 193 6.47 body mass (VT:0001259) 10 51663405 75085664 Rat 631552 Vetf2 Vascular elastic tissue fragility QTL 2 4.5 0.0002 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 10 41142633 86142633 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 2293679 Bmd30 Bone mineral density QTL 30 3.5 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 1549831 Bss6 Bone structure and strength QTL 6 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 10 57576521 102576521 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 70164 Bw21 Body weight QTL 21 4.36 0.00005 body mass (VT:0001259) body weight (CMO:0000012) 10 53797494 98952626 Rat 61463 Bp12 Blood pressure QTL 12 6.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 41333258 86333258 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 1598852 Anxrr19 Anxiety related response QTL 19 5.07 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 10 18167841 63167841 Rat 724527 Bp148 Blood pressure QTL 148 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 28453136 73453136 Rat 1358897 Stresp6 Stress response QTL 6 4.17 0.022 blood norepinephrine amount (VT:0005663) plasma norepinephrine level (CMO:0001010) 10 35392267 64155584 Rat 1331762 Rf40 Renal function QTL 40 3.873 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 10 29299504 64155584 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2293652 Bmd22 Bone mineral density QTL 22 4.9 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 2306970 Anxrr22 Anxiety related response QTL 22 5.95 fear/anxiety-related behavior trait (VT:1000241) number of periods of voluntary immobility (CMO:0001045) 10 61345276 98211570 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 2306787 Ean3 Experimental allergic neuritis QTL 3 3.1 nervous system integrity trait (VT:0010566) body weight loss (CMO:0001399) 10 53797385 66979128 Rat 2312672 Insul15 Insulin level QTL 15 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 10 57134272 102134272 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 2317043 Aia7 Adjuvant induced arthritis QTL 7 3.82 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 37565079 82565079 Rat 2317042 Aia20 Adjuvant induced arthritis QTL 20 3.38 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 37565079 82565079 Rat 70363 Bp71 Blood pressure QTL 71 0.04 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 61345276 81714865 Rat 61402 Niddm3 Non-insulin dependent diabetes mellitus QTL 3 4.58 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 61345413 82564856 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 2313087 Bmd80 Bone mineral density QTL 80 3.2 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 10 19606483 64606483 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 2293698 Bss43 Bone structure and strength QTL 43 5.33 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 10 59209888 104209888 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 1354608 Cm33 Cardiac mass QTL 33 2.8 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 10 54809292 99809292 Rat 1558643 Cm44 Cardiac mass QTL 44 4.8 0.0000368 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 61345276 99703528 Rat 631535 Cm51 Cardiac mass QTL 51 3 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 51786282 91669536 Rat 1576319 Cia29 Collagen induced arthritis QTL 29 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 33973921 78973921 Rat 8552805 Bw145 Body weight QTL 145 2.2 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 10 41944526 78307017 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2293705 Bmd25 Bone mineral density QTL 25 7.1 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 10 49444551 81709989 Rat 1331839 Eae18b Experimental allergic encephalomyelitis QTL 18b 5.8 0.03 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 10 61248303 67785171 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 7207811 Bmd90 Bone mineral density QTL 90 5.2 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 10 49444551 81709989 Rat 1576311 Pia26 Pristane induced arthritis QTL 26 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 31224026 75632053 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 631526 Bp76 Blood pressure QTL 76 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 61345413 66743655 Rat 6893336 Cm75 Cardiac mass QTL 75 0.1 0.87 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 61345276 99703528 Rat 631547 Bp87 Blood pressure QTL 87 4.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 47369470 92369470 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 2312662 Slep8 Serum leptin concentration QTL 8 0.05 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 10 57134272 102134272 Rat 6893342 Cm78 Cardiac mass QTL 78 0.1 0.88 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 42876766 79813922 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2313055 Bw96 Body weight QTL 96 3.6 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 10 19606483 64606483 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat 2312668 Scl65 Serum cholesterol level QTL 65 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 57134272 102134272 Rat
D10Rat242
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 61,852,309 - 61,852,455 (-) MAPPER mRatBN7.2 Rnor_6.0 10 63,160,125 - 63,160,270 NCBI Rnor6.0 Rnor_5.0 10 62,857,786 - 62,857,931 UniSTS Rnor5.0 RGSC_v3.4 10 67,141,195 - 67,141,341 RGD RGSC3.4 RGSC_v3.4 10 67,141,196 - 67,141,341 UniSTS RGSC3.4 RGSC_v3.1 10 67,154,818 - 67,154,964 RGD Celera 10 60,860,505 - 60,860,642 UniSTS SHRSP x BN Map 10 46.5699 RGD SHRSP x BN Map 10 46.5699 UniSTS Cytogenetic Map 10 q26 UniSTS
RH142224
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 61,858,283 - 61,858,390 (-) MAPPER mRatBN7.2 Rnor_6.0 10 63,154,190 - 63,154,296 NCBI Rnor6.0 Rnor_5.0 10 62,851,851 - 62,851,957 UniSTS Rnor5.0 RGSC_v3.4 10 67,135,261 - 67,135,367 UniSTS RGSC3.4 Celera 10 60,866,471 - 60,866,577 UniSTS Cytogenetic Map 10 q26 UniSTS
BE097677
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 61,839,006 - 61,839,145 (-) MAPPER mRatBN7.2 Rnor_6.0 10 63,173,435 - 63,173,573 NCBI Rnor6.0 Rnor_5.0 10 62,871,096 - 62,871,234 UniSTS Rnor5.0 RGSC_v3.4 10 67,154,506 - 67,154,644 UniSTS RGSC3.4 Celera 10 60,847,189 - 60,847,327 UniSTS Cytogenetic Map 10 q26 UniSTS
This gene Slc6a4 is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
88
87
56
25
56
6
215
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000004717 ⟹ ENSRNOP00000004717
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 61,826,123 - 61,858,384 (+) Ensembl Rnor_6.0 Ensembl 10 63,153,651 - 63,176,463 (-) Ensembl
RefSeq Acc Id:
NM_013034 ⟹ NP_037166
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 62,335,896 - 62,357,060 (+) NCBI mRatBN7.2 10 61,837,760 - 61,858,924 (+) NCBI Rnor_6.0 10 63,153,656 - 63,174,820 (-) NCBI Rnor_5.0 10 62,851,326 - 62,872,481 (-) NCBI RGSC_v3.4 10 67,134,790 - 67,155,891 (-) RGD Celera 10 60,845,942 - 60,866,725 (+) RGD
Sequence:
AGCTTTCCGTCTTGTCCCCATAACCCGAGAGGAGATTCAAACCAAGAACCAAGAGCTAGCCTGGGTCCTCGGCAGATGGGAATCCGCATCACTTACTGACCAGCAGCATGGAGACCACACCCTTGAAT
hide sequence
RefSeq Acc Id:
XM_008767950 ⟹ XP_008766172
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 62,323,867 - 62,357,060 (+) NCBI mRatBN7.2 10 61,826,048 - 61,858,924 (+) NCBI Rnor_6.0 10 63,153,656 - 63,186,502 (-) NCBI
Sequence:
GGGCCGCGAGTACAAATAGCGCGGCGGGCGGCGCCACTCCAGCGGCCGCGCCGGTGCCTCGAGGGCGCGAGGGTCGCGCCGCCTCCGCAGCCCGGGACCCGCCGCCGCGCCGCCCGCAGAGCTTTCCG
hide sequence
RefSeq Acc Id:
XM_017597041 ⟹ XP_017452530
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 62,324,224 - 62,357,060 (+) NCBI mRatBN7.2 10 61,826,097 - 61,858,924 (+) NCBI Rnor_6.0 10 63,153,656 - 63,186,502 (-) NCBI
Sequence:
GGGCCGCGAGTACAAATAGCGCGGCGGGCGGCGCCACTCCAGCGGCCGCGCCGGTGCCTCGAGGGCGCGAGGGTCGCGCCGCCTCCGCAGCCCGGGACCCGCCGCCGCGCCGCCCGCAGAAGCTGGCA
hide sequence
RefSeq Acc Id:
XM_017597042 ⟹ XP_017452531
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 62,322,688 - 62,357,060 (+) NCBI mRatBN7.2 10 61,824,208 - 61,858,924 (+) NCBI Rnor_6.0 10 63,153,656 - 63,188,377 (-) NCBI
Sequence:
GACAGACTGGGCTAAGTTGCTCCTGCAGAGTTGCCTCCAGGGTAAGAGGAAAGAAAACACTTGG
hide sequence
RefSeq Acc Id:
XM_039085288 ⟹ XP_038941216
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 62,324,228 - 62,357,060 (+) NCBI mRatBN7.2 10 61,826,146 - 61,858,924 (+) NCBI
RefSeq Acc Id:
NP_037166 ⟸ NM_013034
- UniProtKB:
P23976 (UniProtKB/Swiss-Prot), P31652 (UniProtKB/Swiss-Prot), A6HGX0 (UniProtKB/TrEMBL)
- Sequence:
METTPLNSQKVLSECKDREDCQENGVLQKGVPTTADRAEPSQISNGYSAVPSTSAGDEASHSIPAATTTLVAEIRQGERETWGKKMDFLLSVIGYAVDLGNIWRFPYICYQNGGGAFLLPYTIMAIFG
hide sequence
RefSeq Acc Id:
XP_008766172 ⟸ XM_008767950
- Peptide Label:
isoform X1
- UniProtKB:
P23976 (UniProtKB/Swiss-Prot), P31652 (UniProtKB/Swiss-Prot), A6HGX0 (UniProtKB/TrEMBL)
- Sequence:
METTPLNSQKVLSECKDREDCQENGVLQKGVPTTADRAEPSQISNGYSAVPSTSAGDEASHSIPAATTTLVAEIRQGERETWGKKMDFLLSVIGYAVDLGNIWRFPYICYQNGGGAFLLPYTIMAIFG
hide sequence
RefSeq Acc Id:
XP_017452531 ⟸ XM_017597042
- Peptide Label:
isoform X1
- UniProtKB:
P23976 (UniProtKB/Swiss-Prot), P31652 (UniProtKB/Swiss-Prot), A6HGX0 (UniProtKB/TrEMBL)
- Sequence:
METTPLNSQKVLSECKDREDCQENGVLQKGVPTTADRAEPSQISNGYSAVPSTSAGDEASHSIPAATTTLVAEIRQGERETWGKKMDFLLSVIGYAVDLGNIWRFPYICYQNGGGAFLLPYTIMAIFG
hide sequence
RefSeq Acc Id:
XP_017452530 ⟸ XM_017597041
- Peptide Label:
isoform X1
- UniProtKB:
P23976 (UniProtKB/Swiss-Prot), P31652 (UniProtKB/Swiss-Prot), A6HGX0 (UniProtKB/TrEMBL)
- Sequence:
METTPLNSQKVLSECKDREDCQENGVLQKGVPTTADRAEPSQISNGYSAVPSTSAGDEASHSIPAATTTLVAEIRQGERETWGKKMDFLLSVIGYAVDLGNIWRFPYICYQNGGGAFLLPYTIMAIFG
hide sequence
Ensembl Acc Id:
ENSRNOP00000004717 ⟸ ENSRNOT00000004717
RefSeq Acc Id:
XP_038941216 ⟸ XM_039085288
- Peptide Label:
isoform X1
- UniProtKB:
P31652 (UniProtKB/Swiss-Prot), P23976 (UniProtKB/Swiss-Prot), A6HGX0 (UniProtKB/TrEMBL)
RGD ID: 13697431 Promoter ID: EPDNEW_R7956 Type: multiple initiation site Name: Slc6a4_1 Description: solute carrier family 6 member 4 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 63,175,883 - 63,175,943 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-09
Slc6a4
solute carrier family 6 member 4
Slc6a4
solute carrier family 6 (neurotransmitter transporter), member 4
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Slc6a4
solute carrier family 6 (neurotransmitter transporter, serotonin), member 4
solute carrier family 6, member 4
Name updated
1299863 APPROVED
2003-04-09
Slc6a4
solute carrier family 6, member 4
Solute carrier family 6 (neurotransmitter transporter, serotonin), member 4
Name updated
629478 APPROVED
2001-11-02
Slc6a4
Solute carrier family 6 (neurotransmitter transporter, serotonin), member 4
Symbol and Name updated
68913 APPROVED
