Symbol:
Ccl20
Name:
C-C motif chemokine ligand 20
RGD ID:
3646
Description:
Enables chemokine activity. Involved in cellular response to molecule of bacterial origin; chemotaxis; and positive regulation of interleukin-1 alpha production. Located in extracellular space. Used to study transient cerebral ischemia. Biomarker of brain ischemia and ulcerative colitis. Orthologous to human CCL20 (C-C motif chemokine ligand 20); PARTICIPATES IN chemokine mediated signaling pathway; cytokine mediated signaling pathway; rheumatoid arthritis pathway; INTERACTS WITH 1,2,4-trimethylbenzene; 1-naphthyl isothiocyanate; 2,2',4,4'-Tetrabromodiphenyl ether.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
beta chemokine exodus-1; beta-chemokine exodus-1; C-C motif chemokine 20; CC chemokine LARC; CC chemokine ST38; chemokine (C-C motif) ligand 20; liver and activation-regulated chemokine; macrophage inflammatory protein 3 alpha; MIP-3-alpha; Scya20; small inducible cytokine subfamily A20; small-inducible cytokine A20; ST38
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CCL20 (C-C motif chemokine ligand 20) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Ccl20 (C-C motif chemokine ligand 20) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ccl20 (C-C motif chemokine ligand 20) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CCL20 (C-C motif chemokine ligand 20) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CCL20 (C-C motif chemokine ligand 20) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ccl20 (C-C motif chemokine ligand 20) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CCL20 (C-C motif chemokine ligand 20) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CCL20 (C-C motif chemokine ligand 20) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ccl20 (C-C motif chemokine ligand 20) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Ccl20 (C-C motif chemokine ligand 20)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
CCL20 (C-C motif chemokine ligand 20)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ccl20b (chemokine (C-C motif) ligand 20b)
Alliance
DIOPT (OMA|PANTHER)
Danio rerio (zebrafish):
ccl20a.3 (chemokine (C-C motif) ligand 20a, duplicate 3)
Alliance
DIOPT (Hieranoid|PANTHER)
Danio rerio (zebrafish):
ccl20l
Alliance
DIOPT (OrthoFinder|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 91,837,139 - 91,839,736 (+) NCBI GRCr8 mRatBN7.2 9 84,389,031 - 84,391,629 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 84,388,904 - 84,391,629 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 92,819,272 - 92,821,849 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 97,947,738 - 97,950,315 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 96,330,459 - 96,333,051 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 88,918,359 - 88,921,017 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 88,918,433 - 88,921,001 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 88,662,765 - 88,665,379 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 82,440,965 - 82,443,542 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 82,624,383 - 82,626,960 (+) NCBI Celera 9 81,830,990 - 81,833,567 (+) NCBI Celera Cytogenetic Map 9 q35 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ccl20 Rat (-)-demecolcine increases expression ISO CCL20 (Homo sapiens) 6480464 Demecolcine results in increased expression of CCL20 mRNA CTD PMID:23649840 Ccl20 Rat 1,2,4-trimethylbenzene increases expression EXP 6480464 pseudocumene results in increased expression of CCL20 protein CTD PMID:17337753 Ccl20 Rat 1,2-dichloroethane decreases expression ISO Ccl20 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of CCL20 mRNA CTD PMID:28960355 Ccl20 Rat 1,2-dimethylhydrazine decreases expression ISO Ccl20 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of CCL20 mRNA CTD PMID:22206623 Ccl20 Rat 1-chloro-2,4-dinitrobenzene affects expression ISO Ccl20 (Mus musculus) 6480464 Dinitrochlorobenzene affects the expression of CCL20 mRNA CTD PMID:28219650 Ccl20 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of CCL20 mRNA CTD PMID:30723492 Ccl20 Rat 1-nitropyrene increases expression ISO CCL20 (Homo sapiens) 6480464 1-nitropyrene results in increased expression of CCL20 mRNA CTD PMID:19428942 more ... Ccl20 Rat 17beta-estradiol decreases expression ISO CCL20 (Homo sapiens) 6480464 Estradiol results in decreased expression of CCL20 mRNA CTD PMID:16298037 Ccl20 Rat 17beta-estradiol multiple interactions ISO CCL20 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of CCL20 mRNA CTD PMID:30165855 Ccl20 Rat 17beta-estradiol increases expression ISO CCL20 (Homo sapiens) 6480464 Estradiol results in increased expression of CCL20 mRNA CTD PMID:20106945 and PMID:25878060 Ccl20 Rat 17beta-estradiol affects expression ISO CCL20 (Homo sapiens) 6480464 Estradiol affects the expression of CCL20 mRNA CTD PMID:25878060 Ccl20 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2 more ... CTD PMID:20566336 Ccl20 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO CCL20 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of CCL20 mRNA CTD PMID:22298810 Ccl20 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO CCL20 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of CCL20 mRNA CTD PMID:20106945 more ... Ccl20 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Ccl20 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of CCL20 mRNA CTD PMID:19933214 and PMID:26259605 Ccl20 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ccl20 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CCL20 mRNA CTD PMID:26377647 Ccl20 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Ccl20 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with IL1B protein] results in increased expression of CCL20 mRNA more ... CTD PMID:26259605 Ccl20 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO CCL20 (Homo sapiens) 6480464 [Endosulfan co-treated with Tetrachlorodibenzodioxin] results in increased expression of CCL20 mRNA CTD PMID:26159488 Ccl20 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Ccl20 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Ccl20 Rat 2-amino-2-deoxy-D-glucopyranose multiple interactions EXP 6480464 Glucosamine inhibits the reaction [IL1B results in increased expression of CCL20 mRNA] and IL1B promotes the reaction [Glucosamine results in increased expression of CCL20 mRNA] CTD PMID:17109745 Ccl20 Rat 2-amino-2-deoxy-D-glucopyranose increases expression EXP 6480464 Glucosamine results in increased expression of CCL20 mRNA CTD PMID:17109745 Ccl20 Rat 2-hydroxypropanoic acid increases expression ISO CCL20 (Homo sapiens) 6480464 Lactic Acid results in increased expression of CCL20 mRNA CTD PMID:30851411 Ccl20 Rat 2-tert-butylhydroquinone increases expression ISO CCL20 (Homo sapiens) 6480464 2-tert-butylhydroquinone results in increased expression of CCL20 mRNA CTD PMID:35724838 Ccl20 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:23196670 Ccl20 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression ISO CCL20 (Homo sapiens) 6480464 3 more ... CTD PMID:28351761 Ccl20 Rat 3-chlorophenol increases expression ISO CCL20 (Homo sapiens) 6480464 3-chlorophenol results in increased expression of CCL20 mRNA CTD PMID:18486366 Ccl20 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO Ccl20 (Mus musculus) 6480464 [Zinc co-treated with Nickel co-treated with Cobalt co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in decreased expression of CCL20 mRNA and TNF protein promotes the reaction [[Zinc co-treated with Nickel co-treated with Cobalt co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in decreased expression of CCL20 mRNA] CTD PMID:23503329 Ccl20 Rat 3-Nitrofluoranthene increases expression ISO CCL20 (Homo sapiens) 6480464 3-nitrofluoranthene results in increased expression of CCL20 mRNA CTD PMID:19879285 Ccl20 Rat 3-phenylprop-2-enal increases expression ISO CCL20 (Homo sapiens) 6480464 cinnamaldehyde results in increased expression of CCL20 mRNA CTD PMID:30806763 Ccl20 Rat 3-phenylprop-2-enal affects expression ISO Ccl20 (Mus musculus) 6480464 cinnamaldehyde affects the expression of CCL20 mRNA CTD PMID:28219650 Ccl20 Rat 4,4'-sulfonyldiphenol increases expression ISO CCL20 (Homo sapiens) 6480464 bisphenol S results in increased expression of CCL20 mRNA CTD PMID:38568856 Ccl20 Rat 4-hydroxyphenyl retinamide increases expression ISO CCL20 (Homo sapiens) 6480464 Fenretinide results in increased expression of CCL20 mRNA CTD PMID:15958647 Ccl20 Rat 5-aza-2'-deoxycytidine increases expression ISO CCL20 (Homo sapiens) 6480464 Decitabine results in increased expression of CCL20 mRNA CTD PMID:21856257 Ccl20 Rat 6alpha-methylprednisolone decreases expression ISO CCL20 (Homo sapiens) 6480464 Methylprednisolone results in decreased expression of CCL20 mRNA and Methylprednisolone results in decreased expression of CCL20 protein CTD PMID:19192274 Ccl20 Rat acrolein increases expression EXP 6480464 Acrolein results in increased expression of CCL20 mRNA CTD PMID:38090360 Ccl20 Rat aflatoxin B1 affects expression ISO CCL20 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of CCL20 protein CTD PMID:20106945 Ccl20 Rat aflatoxin B1 increases expression ISO CCL20 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of CCL20 mRNA CTD PMID:27153756 Ccl20 Rat aldehydo-D-glucosamine multiple interactions EXP 6480464 Glucosamine inhibits the reaction [IL1B results in increased expression of CCL20 mRNA] and IL1B promotes the reaction [Glucosamine results in increased expression of CCL20 mRNA] CTD PMID:17109745 Ccl20 Rat aldehydo-D-glucosamine increases expression EXP 6480464 Glucosamine results in increased expression of CCL20 mRNA CTD PMID:17109745 Ccl20 Rat all-trans-retinoic acid multiple interactions ISO CCL20 (Homo sapiens) 6480464 [arsenic trioxide co-treated with Tretinoin] results in increased expression of CCL20 mRNA CTD PMID:19828696 Ccl20 Rat all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of CCL20 mRNA CTD PMID:20488242 Ccl20 Rat all-trans-retinoic acid increases expression ISO CCL20 (Homo sapiens) 6480464 Tretinoin results in increased expression of CCL20 mRNA and Tretinoin results in increased expression of CCL20 protein CTD PMID:19828696 and PMID:33167477 Ccl20 Rat allopurinol increases expression EXP 6480464 Allopurinol results in increased expression of CCL20 mRNA CTD PMID:37876353 Ccl20 Rat alpha-Zearalanol increases expression EXP 6480464 Zeranol results in increased expression of CCL20 mRNA CTD PMID:35163327 Ccl20 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of CCL20 mRNA CTD PMID:16483693 Ccl20 Rat amphotericin B increases expression ISO CCL20 (Homo sapiens) 6480464 Amphotericin B analog results in increased expression of CCL20 mRNA and Amphotericin B results in increased expression of CCL20 mRNA CTD PMID:28534445 Ccl20 Rat andrographolide increases expression ISO CCL20 (Homo sapiens) 6480464 andrographolide results in increased expression of CCL20 mRNA CTD PMID:35724838 Ccl20 Rat antirheumatic drug decreases expression ISO CCL20 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of CCL20 mRNA CTD PMID:24449571 Ccl20 Rat aripiprazole multiple interactions ISO CCL20 (Homo sapiens) 6480464 [Aripiprazole co-treated with Ozone] results in increased expression of CCL20 mRNA CTD PMID:31476115 Ccl20 Rat aristolochic acid A decreases expression ISO CCL20 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of CCL20 mRNA CTD PMID:33212167 Ccl20 Rat arsane decreases expression ISO CCL20 (Homo sapiens) 6480464 Arsenic results in decreased expression of CCL20 mRNA CTD PMID:16835338 Ccl20 Rat arsane affects methylation ISO CCL20 (Homo sapiens) 6480464 Arsenic affects the methylation of CCL20 gene CTD PMID:25304211 Ccl20 Rat arsane multiple interactions ISO CCL20 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of CCL20 mRNA CTD PMID:32525701 Ccl20 Rat arsenic atom decreases expression ISO CCL20 (Homo sapiens) 6480464 Arsenic results in decreased expression of CCL20 mRNA CTD PMID:16835338 Ccl20 Rat arsenic atom affects methylation ISO CCL20 (Homo sapiens) 6480464 Arsenic affects the methylation of CCL20 gene CTD PMID:25304211 Ccl20 Rat arsenic atom multiple interactions ISO CCL20 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of CCL20 mRNA CTD PMID:32525701 Ccl20 Rat arsenous acid multiple interactions ISO CCL20 (Homo sapiens) 6480464 [Arsenic Trioxide co-treated with Tretinoin] results in increased expression of CCL20 mRNA CTD PMID:19828696 Ccl20 Rat asperentin increases expression ISO Ccl20 (Mus musculus) 6480464 cladosporin results in increased expression of CCL20 mRNA CTD PMID:21356202 Ccl20 Rat asperentin decreases expression ISO Ccl20 (Mus musculus) 6480464 cladosporin results in decreased expression of CCL20 mRNA CTD PMID:19818335 Ccl20 Rat azathioprine decreases expression ISO CCL20 (Homo sapiens) 6480464 Azathioprine results in decreased expression of CCL20 mRNA and Azathioprine results in decreased expression of CCL20 protein CTD PMID:19192274 Ccl20 Rat Bardoxolone methyl increases expression ISO CCL20 (Homo sapiens) 6480464 bardoxolone methyl results in increased expression of CCL20 mRNA CTD PMID:35724838 Ccl20 Rat barium sulfate affects expression EXP 6480464 Barium Sulfate affects the expression of CCL20 mRNA CTD PMID:29463257 Ccl20 Rat benzalkonium chloride increases expression ISO CCL20 (Homo sapiens) 6480464 Benzalkonium Compounds results in increased expression of CCL20 mRNA CTD PMID:30806763 Ccl20 Rat benzene affects expression ISO CCL20 (Homo sapiens) 6480464 Benzene affects the expression of CCL20 mRNA CTD PMID:21147609 Ccl20 Rat benzo[a]pyrene increases expression ISO CCL20 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of CCL20 mRNA CTD PMID:20106945 more ... Ccl20 Rat benzo[a]pyrene diol epoxide I increases expression ISO CCL20 (Homo sapiens) 6480464 7 more ... CTD PMID:26238291 Ccl20 Rat beta-D-glucosamine multiple interactions EXP 6480464 Glucosamine inhibits the reaction [IL1B results in increased expression of CCL20 mRNA] and IL1B promotes the reaction [Glucosamine results in increased expression of CCL20 mRNA] CTD PMID:17109745 Ccl20 Rat beta-D-glucosamine increases expression EXP 6480464 Glucosamine results in increased expression of CCL20 mRNA CTD PMID:17109745 Ccl20 Rat beta-lapachone increases expression ISO CCL20 (Homo sapiens) 6480464 beta-lapachone results in increased expression of CCL20 mRNA CTD PMID:38218311 Ccl20 Rat beta-naphthoflavone decreases expression ISO CCL20 (Homo sapiens) 6480464 beta-Naphthoflavone results in decreased expression of CCL20 mRNA CTD PMID:32858204 Ccl20 Rat bis(2-chloroethyl) sulfide increases expression ISO CCL20 (Homo sapiens) 6480464 Mustard Gas results in increased expression of CCL20 mRNA CTD PMID:25102026 Ccl20 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO CCL20 (Homo sapiens) 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated with Mercury] results in decreased expression of CCL20 mRNA CTD PMID:32949613 Ccl20 Rat bisphenol A multiple interactions ISO Ccl20 (Mus musculus) 6480464 [XRCC6 gene mutant form results in increased susceptibility to potassium bromate] affects the reaction [bisphenol A affects the expression of CCL20 mRNA] CTD PMID:27082013 Ccl20 Rat bisphenol A increases expression ISO Ccl20 (Mus musculus) 6480464 bisphenol A results in increased expression of CCL20 mRNA CTD PMID:37510359 Ccl20 Rat bisphenol A affects expression ISO CCL20 (Homo sapiens) 6480464 bisphenol A affects the expression of CCL20 mRNA CTD PMID:30903817 Ccl20 Rat bisphenol A decreases expression ISO Ccl20 (Mus musculus) 6480464 bisphenol A results in decreased expression of CCL20 mRNA CTD PMID:26911702 Ccl20 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CCL20 mRNA CTD PMID:25181051 Ccl20 Rat bisphenol A increases expression ISO CCL20 (Homo sapiens) 6480464 bisphenol A results in increased expression of CCL20 mRNA CTD PMID:25878060 Ccl20 Rat bisphenol A increases secretion ISO CCL20 (Homo sapiens) 6480464 bisphenol A results in increased secretion of CCL20 protein CTD PMID:25878060 Ccl20 Rat bisphenol A affects expression ISO Ccl20 (Mus musculus) 6480464 bisphenol A affects the expression of CCL20 mRNA CTD PMID:27082013 Ccl20 Rat Botulinum toxin type A increases expression ISO Ccl20 (Mus musculus) 6480464 Botulinum Toxins and Type A results in increased expression of CCL20 mRNA CTD PMID:33529366 Ccl20 Rat Brevianamide A decreases expression ISO Ccl20 (Mus musculus) 6480464 brevianamide A results in decreased expression of CCL20 mRNA CTD PMID:19818335 Ccl20 Rat Brevianamide A increases expression ISO Ccl20 (Mus musculus) 6480464 brevianamide A results in increased expression of CCL20 mRNA CTD PMID:19818335 Ccl20 Rat butan-1-ol multiple interactions ISO CCL20 (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of CCL20 mRNA CTD PMID:29432896 Ccl20 Rat butanal increases expression ISO CCL20 (Homo sapiens) 6480464 butyraldehyde results in increased expression of CCL20 mRNA CTD PMID:26079696 Ccl20 Rat Butylbenzyl phthalate multiple interactions ISO CCL20 (Homo sapiens) 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated with Mercury] results in decreased expression of CCL20 mRNA CTD PMID:32949613 Ccl20 Rat cadmium dichloride decreases expression ISO CCL20 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of CCL20 mRNA CTD PMID:26472689 Ccl20 Rat cadmium dichloride increases expression ISO CCL20 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of CCL20 mRNA CTD PMID:38568856 Ccl20 Rat calcitriol decreases expression ISO CCL20 (Homo sapiens) 6480464 Calcitriol results in decreased expression of CCL20 mRNA CTD PMID:16002434 Ccl20 Rat calcitriol increases expression ISO CCL20 (Homo sapiens) 6480464 Calcitriol results in increased expression of CCL20 mRNA CTD PMID:26485663 Ccl20 Rat cannabidiol increases expression ISO CCL20 (Homo sapiens) 6480464 Cannabidiol results in increased expression of CCL20 mRNA CTD PMID:33244087 and PMID:36519830 Ccl20 Rat cannabidiol multiple interactions ISO CCL20 (Homo sapiens) 6480464 Cannabidiol inhibits the reaction [TNF protein results in increased expression of CCL20 mRNA] CTD PMID:31250491 Ccl20 Rat capsaicin multiple interactions EXP 6480464 [Naproxen co-treated with Sumatriptan] inhibits the reaction [Capsaicin results in increased expression of CCL20 protein] more ... CTD PMID:22150557 Ccl20 Rat capsaicin increases expression EXP 6480464 Capsaicin results in increased expression of CCL20 protein CTD PMID:22150557 Ccl20 Rat carbon nanotube increases expression ISO CCL20 (Homo sapiens) 6480464 Nanotubes and Carbon results in increased expression of CCL20 mRNA CTD PMID:29348435 Ccl20 Rat cefaloridine increases expression EXP 6480464 Cephaloridine results in increased expression of CCL20 mRNA CTD PMID:18500788 Ccl20 Rat ceric oxide multiple interactions ISO Ccl20 (Mus musculus) 6480464 [Antigens and Dermatophagoides co-treated with ceric oxide] results in increased expression of CCL20 mRNA CTD PMID:29792201 Ccl20 Rat ceric oxide affects expression EXP 6480464 ceric oxide affects the expression of CCL20 mRNA CTD PMID:29463257 Ccl20 Rat chenodeoxycholic acid increases expression ISO Ccl20 (Mus musculus) 6480464 Chenodeoxycholic Acid results in increased expression of CCL20 mRNA CTD PMID:21224055 Ccl20 Rat chloroprene increases expression ISO Ccl20 (Mus musculus) 6480464 Chloroprene results in increased expression of CCL20 mRNA CTD PMID:23125180 Ccl20 Rat chromium(6+) affects expression ISO Ccl20 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of CCL20 mRNA CTD PMID:28472532 Ccl20 Rat ciglitazone multiple interactions ISO CCL20 (Homo sapiens) 6480464 [ciglitazone binds to PPARG protein alternative form] which results in increased expression of CCL20 mRNA and [ciglitazone binds to PPARG protein] which results in increased expression of CCL20 mRNA CTD PMID:16197558 Ccl20 Rat cisplatin increases expression ISO CCL20 (Homo sapiens) 6480464 Cisplatin results in increased expression of CCL20 mRNA CTD PMID:33545341 and PMID:38498338 Ccl20 Rat cobalt atom multiple interactions ISO CCL20 (Homo sapiens) 6480464 [tungsten carbide co-treated with Cobalt] results in increased expression of CCL20 mRNA CTD PMID:18078969 Ccl20 Rat cobalt atom multiple interactions ISO Ccl20 (Mus musculus) 6480464 [Zinc co-treated with Nickel co-treated with Cobalt co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in decreased expression of CCL20 mRNA and TNF protein promotes the reaction [[Zinc co-treated with Nickel co-treated with Cobalt co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in decreased expression of CCL20 mRNA] CTD PMID:23503329 Ccl20 Rat copper(II) chloride increases expression ISO CCL20 (Homo sapiens) 6480464 cupric chloride results in increased expression of CCL20 mRNA CTD PMID:38568856 Ccl20 Rat copper(II) sulfate increases expression ISO CCL20 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of CCL20 mRNA CTD PMID:19549813 Ccl20 Rat crocidolite asbestos increases expression ISO CCL20 (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of CCL20 mRNA CTD PMID:18687144 more ... Ccl20 Rat cyclosporin A increases expression ISO CCL20 (Homo sapiens) 6480464 Cyclosporine results in increased expression of CCL20 mRNA CTD PMID:20106945 more ... Ccl20 Rat cyclosporin A affects expression ISO CCL20 (Homo sapiens) 6480464 Cyclosporine affects the expression of CCL20 mRNA CTD PMID:25562108 Ccl20 Rat cyclosporin A increases expression ISO Ccl20 (Mus musculus) 6480464 Cyclosporine results in increased expression of CCL20 mRNA and Cyclosporine results in increased expression of CCL20 protein CTD PMID:21292993 and PMID:23958496 Ccl20 Rat deoxycholic acid increases expression ISO Ccl20 (Mus musculus) 6480464 Deoxycholic Acid results in increased expression of CCL20 mRNA CTD PMID:21224055 Ccl20 Rat deoxynivalenol increases expression ISO CCL20 (Homo sapiens) 6480464 deoxynivalenol results in increased expression of CCL20 mRNA CTD PMID:27757495 and PMID:35314294 Ccl20 Rat dexamethasone multiple interactions ISO Ccl20 (Mus musculus) 6480464 [Zinc co-treated with Nickel co-treated with Cobalt co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in decreased expression of CCL20 mRNA and TNF protein promotes the reaction [[Zinc co-treated with Nickel co-treated with Cobalt co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in decreased expression of CCL20 mRNA] CTD PMID:23503329 Ccl20 Rat dexamethasone multiple interactions EXP 6480464 Dexamethasone inhibits the reaction [IL1B protein results in increased expression of CCL20 mRNA] and Dexamethasone inhibits the reaction [IL1B protein results in increased secretion of CCL20 protein] CTD PMID:25851902 Ccl20 Rat diarsenic trioxide multiple interactions ISO CCL20 (Homo sapiens) 6480464 [Arsenic Trioxide co-treated with Tretinoin] results in increased expression of CCL20 mRNA CTD PMID:19828696 Ccl20 Rat dibenzofuran increases expression EXP 6480464 dibenzofuran analog results in increased expression of CCL20 mRNA CTD PMID:20566336 Ccl20 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of CCL20 mRNA CTD PMID:21266533 Ccl20 Rat dichlorine increases expression ISO Ccl20 (Mus musculus) 6480464 Chlorine results in increased expression of CCL20 mRNA CTD PMID:24582687 Ccl20 Rat diethyl malate affects expression ISO Ccl20 (Mus musculus) 6480464 diethyl malate affects the expression of CCL20 mRNA CTD PMID:24814887 Ccl20 Rat diethyl malate increases expression ISO CCL20 (Homo sapiens) 6480464 diethyl malate results in increased expression of CCL20 mRNA CTD PMID:38498338 Ccl20 Rat diisononyl phthalate multiple interactions ISO CCL20 (Homo sapiens) 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated with Mercury] results in decreased expression of CCL20 mRNA CTD PMID:32949613 Ccl20 Rat dioxygen multiple interactions ISO CCL20 (Homo sapiens) 6480464 Oxygen deficiency inhibits the reaction [darinaparsin results in decreased expression of CCL20 mRNA] CTD PMID:22535156 Ccl20 Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression of CCL20 mRNA CTD PMID:33729688 Ccl20 Rat dorsomorphin multiple interactions ISO CCL20 (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CCL20 mRNA CTD PMID:27188386 Ccl20 Rat doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of CCL20 mRNA CTD PMID:19915844 Ccl20 Rat doxorubicin increases expression ISO Ccl20 (Mus musculus) 6480464 Doxorubicin results in increased expression of CCL20 mRNA CTD PMID:28318631 Ccl20 Rat doxorubicin multiple interactions ISO Ccl20 (Mus musculus) 6480464 Niclosamide inhibits the reaction [Doxorubicin results in increased expression of CCL20 mRNA] CTD PMID:28318631 Ccl20 Rat doxorubicin multiple interactions EXP 6480464 Razoxane inhibits the reaction [Doxorubicin results in increased expression of CCL20 mRNA] CTD PMID:19915844 Ccl20 Rat endosulfan multiple interactions ISO CCL20 (Homo sapiens) 6480464 [Endosulfan co-treated with Tetrachlorodibenzodioxin] results in increased expression of CCL20 mRNA CTD PMID:26159488 Ccl20 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of CCL20 mRNA CTD PMID:29391264 Ccl20 Rat eugenol increases expression ISO CCL20 (Homo sapiens) 6480464 Eugenol results in increased expression of CCL20 mRNA CTD PMID:30806763 Ccl20 Rat fentanyl increases expression EXP 6480464 Fentanyl results in increased expression of CCL20 mRNA CTD PMID:36032789 Ccl20 Rat ferric oxide increases expression EXP 6480464 ferric oxide analog results in increased expression of CCL20 mRNA CTD PMID:38615722 Ccl20 Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of CCL20 mRNA CTD PMID:18035473 Ccl20 Rat formaldehyde increases expression ISO CCL20 (Homo sapiens) 6480464 Formaldehyde results in increased expression of CCL20 mRNA CTD PMID:23649840 Ccl20 Rat fragrance increases expression ISO CCL20 (Homo sapiens) 6480464 Perfume results in increased expression of CCL20 mRNA CTD PMID:24768652 Ccl20 Rat fulvestrant increases expression ISO CCL20 (Homo sapiens) 6480464 fulvestrant results in increased expression of CCL20 mRNA CTD PMID:16298037 Ccl20 Rat fulvestrant multiple interactions ISO Ccl20 (Mus musculus) 6480464 Fulvestrant inhibits the reaction [Raloxifene Hydrochloride inhibits the reaction [IL1B protein results in increased expression of CCL20 protein]] CTD PMID:24722370 Ccl20 Rat fumonisin B1 increases expression ISO CCL20 (Homo sapiens) 6480464 fumonisin B1 results in increased expression of CCL20 mRNA CTD PMID:27757495 Ccl20 Rat furan increases expression EXP 6480464 furan results in increased expression of CCL20 mRNA CTD PMID:27387713 Ccl20 Rat gemcitabine increases expression ISO CCL20 (Homo sapiens) 6480464 Gemcitabine results in increased expression of CCL20 mRNA CTD PMID:17039268 Ccl20 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of CCL20 mRNA CTD PMID:33387578 Ccl20 Rat glutathione decreases expression ISO CCL20 (Homo sapiens) 6480464 Glutathione results in decreased expression of CCL20 mRNA CTD PMID:22385246 Ccl20 Rat hexachlorobenzene increases expression EXP 6480464 Hexachlorobenzene results in increased expression of CCL20 mRNA CTD PMID:15159207 Ccl20 Rat hydrogen peroxide increases expression ISO CCL20 (Homo sapiens) 6480464 Hydrogen Peroxide results in increased expression of CCL20 mRNA and Hydrogen Peroxide results in increased expression of CCL20 protein CTD PMID:18441283 and PMID:32949572 Ccl20 Rat hydrogen peroxide multiple interactions ISO CCL20 (Homo sapiens) 6480464 PTPN6 protein inhibits the reaction [Hydrogen Peroxide results in increased expression of CCL20 protein] CTD PMID:18441283 Ccl20 Rat indoxyl sulfate multiple interactions ISO Ccl20 (Mus musculus) 6480464 Indican promotes the reaction [[AHR protein binds to ARNT protein] which binds to CCL20 promoter] CTD PMID:26259605 Ccl20 Rat iron(2+) sulfate (anhydrous) increases expression ISO CCL20 (Homo sapiens) 6480464 ferrous sulfate results in increased expression of CCL20 mRNA CTD PMID:19428942 and PMID:21540303 Ccl20 Rat lead diacetate increases expression ISO CCL20 (Homo sapiens) 6480464 lead acetate results in increased expression of CCL20 mRNA CTD PMID:38568856 Ccl20 Rat lead nitrate multiple interactions ISO CCL20 (Homo sapiens) 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated with Mercury] results in decreased expression of CCL20 mRNA CTD PMID:32949613 Ccl20 Rat leflunomide increases expression ISO CCL20 (Homo sapiens) 6480464 leflunomide results in increased expression of CCL20 mRNA CTD PMID:28988120 Ccl20 Rat lidocaine decreases expression EXP 6480464 Lidocaine results in decreased expression of CCL20 mRNA CTD PMID:35283115 Ccl20 Rat linuron increases expression ISO Ccl20 (Mus musculus) 6480464 Linuron results in increased expression of CCL20 mRNA CTD PMID:30661753 Ccl20 Rat linuron multiple interactions ISO Ccl20 (Mus musculus) 6480464 SIGMAR1 gene mutant form inhibits the reaction [Linuron results in increased expression of CCL20 mRNA] and XBP1 gene mutant form inhibits the reaction [Linuron results in increased expression of CCL20 mRNA] CTD PMID:30661753 Ccl20 Rat lipopolysaccharide multiple interactions ISO CCL20 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:21135123 and PMID:35811015 Ccl20 Rat lipopolysaccharide increases expression ISO Ccl20 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of CCL20 mRNA CTD PMID:21356202 more ... Ccl20 Rat lipopolysaccharide multiple interactions ISO Ccl20 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Lipopolysaccharides] results in increased expression of CCL20 mRNA more ... CTD PMID:26259605 and PMID:37510359 Ccl20 Rat lipopolysaccharide increases expression ISO CCL20 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of CCL20 mRNA CTD PMID:15860229 more ... Ccl20 Rat lipoteichoic acid increases secretion EXP 6480464 lipoteichoic acid results in increased secretion of CCL20 protein CTD PMID:15618187 Ccl20 Rat malathion increases expression ISO CCL20 (Homo sapiens) 6480464 Malathion results in increased expression of CCL20 mRNA CTD PMID:37047231 Ccl20 Rat melphalan increases expression ISO CCL20 (Homo sapiens) 6480464 Melphalan results in increased expression of CCL20 mRNA CTD PMID:22363485 Ccl20 Rat mercury atom multiple interactions ISO CCL20 (Homo sapiens) 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated with Mercury] results in decreased expression of CCL20 mRNA CTD PMID:32949613 Ccl20 Rat mercury dichloride increases expression EXP 6480464 Mercuric Chloride results in increased expression of CCL20 mRNA CTD PMID:16507785 Ccl20 Rat mercury(0) multiple interactions ISO CCL20 (Homo sapiens) 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated with Mercury] results in decreased expression of CCL20 mRNA CTD PMID:32949613 Ccl20 Rat mesalamine multiple interactions ISO CCL20 (Homo sapiens) 6480464 [Mesalamine co-treated with Glucocorticoids] results in decreased expression of CCL20 mRNA more ... CTD PMID:16306769 Ccl20 Rat methotrexate decreases expression ISO CCL20 (Homo sapiens) 6480464 Methotrexate results in decreased expression of CCL20 mRNA and Methotrexate results in decreased expression of CCL20 protein CTD PMID:19192274 Ccl20 Rat methylisothiazolinone increases expression ISO CCL20 (Homo sapiens) 6480464 2-methyl-4-isothiazolin-3-one results in increased expression of CCL20 mRNA CTD PMID:30806763 Ccl20 Rat methylmercury chloride increases expression EXP 6480464 methylmercuric chloride results in increased expression of CCL20 protein CTD PMID:28526320 Ccl20 Rat Muraglitazar decreases expression EXP 6480464 muraglitazar results in decreased expression of CCL20 mRNA CTD PMID:21515302 Ccl20 Rat mycophenolic acid decreases expression ISO Ccl20 (Mus musculus) 6480464 Mycophenolic Acid results in decreased expression of CCL20 mRNA CTD PMID:19818335 Ccl20 Rat mycophenolic acid increases expression ISO Ccl20 (Mus musculus) 6480464 Mycophenolic Acid results in increased expression of CCL20 mRNA CTD PMID:19818335 Ccl20 Rat mycotoxin increases expression ISO Ccl20 (Mus musculus) 6480464 Mycotoxins results in increased expression of CCL20 mRNA CTD PMID:19818335 and PMID:21356202 Ccl20 Rat mycotoxin decreases expression ISO Ccl20 (Mus musculus) 6480464 Mycotoxins results in decreased expression of CCL20 mRNA CTD PMID:19818335 Ccl20 Rat N-acetyl-L-cysteine decreases expression ISO CCL20 (Homo sapiens) 6480464 Acetylcysteine results in decreased expression of CCL20 mRNA CTD PMID:22385246 Ccl20 Rat N-methyl-N-nitrosourea increases expression ISO Ccl20 (Mus musculus) 6480464 Methylnitrosourea results in increased expression of CCL20 mRNA CTD PMID:25270620 Ccl20 Rat N-Nitrosopyrrolidine increases expression ISO CCL20 (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in increased expression of CCL20 mRNA CTD PMID:32234424 Ccl20 Rat naphthalenes increases expression EXP 6480464 Naphthalenes results in increased expression of CCL20 protein CTD PMID:17337753 Ccl20 Rat naproxen multiple interactions EXP 6480464 [Naproxen co-treated with Sumatriptan] inhibits the reaction [Capsaicin results in increased expression of CCL20 protein] and Naproxen inhibits the reaction [Capsaicin results in increased expression of CCL20 protein] CTD PMID:22150557 Ccl20 Rat neoechinulin A decreases expression ISO Ccl20 (Mus musculus) 6480464 neoechinulin A results in decreased expression of CCL20 mRNA CTD PMID:19818335 Ccl20 Rat neoechinulin A increases expression ISO Ccl20 (Mus musculus) 6480464 neoechinulin A results in increased expression of CCL20 mRNA CTD PMID:19818335 Ccl20 Rat nickel atom increases expression ISO CCL20 (Homo sapiens) 6480464 Nickel results in increased expression of CCL20 mRNA CTD PMID:23195993 and PMID:24768652 Ccl20 Rat nickel atom multiple interactions ISO Ccl20 (Mus musculus) 6480464 [Zinc co-treated with Nickel co-treated with Cobalt co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in decreased expression of CCL20 mRNA and TNF protein promotes the reaction [[Zinc co-treated with Nickel co-treated with Cobalt co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in decreased expression of CCL20 mRNA] CTD PMID:23503329 Ccl20 Rat nickel dichloride increases expression ISO CCL20 (Homo sapiens) 6480464 nickel chloride results in increased expression of CCL20 mRNA CTD PMID:17312168 Ccl20 Rat nickel sulfate multiple interactions ISO CCL20 (Homo sapiens) 6480464 IL1A protein affects the reaction [nickel sulfate results in increased secretion of CCL20 protein] and TNF protein affects the reaction [nickel sulfate results in increased secretion of CCL20 protein] CTD PMID:15679580 Ccl20 Rat nickel sulfate increases secretion ISO CCL20 (Homo sapiens) 6480464 nickel sulfate results in increased secretion of CCL20 protein CTD PMID:15679580 and PMID:16099135 Ccl20 Rat niclosamide multiple interactions ISO Ccl20 (Mus musculus) 6480464 Niclosamide inhibits the reaction [Doxorubicin results in increased expression of CCL20 mRNA] CTD PMID:28318631 Ccl20 Rat niclosamide multiple interactions EXP 6480464 Niclosamide inhibits the reaction [TGFB1 protein results in increased expression of CCL20 mRNA] CTD PMID:28318631 Ccl20 Rat nicotinamide increases expression ISO CCL20 (Homo sapiens) 6480464 Niacinamide results in increased expression of CCL20 mRNA CTD PMID:22385246 Ccl20 Rat o-anisidine affects expression ISO CCL20 (Homo sapiens) 6480464 2-anisidine affects the expression of CCL20 mRNA CTD PMID:28089782 Ccl20 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of CCL20 mRNA CTD PMID:25729387 Ccl20 Rat ozone increases expression ISO Ccl20 (Mus musculus) 6480464 Ozone results in increased expression of CCL20 mRNA and Ozone results in increased expression of CCL20 protein CTD PMID:17095637 more ... Ccl20 Rat ozone increases expression ISO CCL20 (Homo sapiens) 6480464 Ozone results in increased expression of CCL20 mRNA CTD PMID:31476115 Ccl20 Rat ozone multiple interactions ISO CCL20 (Homo sapiens) 6480464 [Aripiprazole co-treated with Ozone] results in increased expression of CCL20 mRNA CTD PMID:31476115 Ccl20 Rat ozone multiple interactions ISO Ccl20 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of CCL20 mRNA more ... CTD PMID:23434795 more ... Ccl20 Rat paracetamol increases expression ISO Ccl20 (Mus musculus) 6480464 Acetaminophen results in increased expression of CCL20 mRNA CTD PMID:22461450 Ccl20 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of CCL20 mRNA CTD PMID:33387578 Ccl20 Rat paracetamol increases expression ISO CCL20 (Homo sapiens) 6480464 Acetaminophen results in increased expression of CCL20 mRNA CTD PMID:29067470 Ccl20 Rat paracetamol multiple interactions ISO Ccl20 (Mus musculus) 6480464 LGALS3 protein affects the reaction [Acetaminophen results in increased expression of CCL20 mRNA] CTD PMID:22461450 Ccl20 Rat paraquat multiple interactions ISO Ccl20 (Mus musculus) 6480464 PTPN6 protein inhibits the reaction [Paraquat results in increased expression of CCL20 protein] CTD PMID:18441283 Ccl20 Rat paraquat multiple interactions ISO CCL20 (Homo sapiens) 6480464 [Paraquat co-treated with Antigens and Dermatophagoides] results in increased expression of CCL20 mRNA CTD PMID:34097952 Ccl20 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of CCL20 mRNA CTD PMID:32680482 Ccl20 Rat paraquat increases expression ISO Ccl20 (Mus musculus) 6480464 Paraquat results in increased expression of CCL20 protein CTD PMID:18441283 Ccl20 Rat PD 0325901 multiple interactions ISO CCL20 (Homo sapiens) 6480464 [mirdametinib co-treated with (+)-JQ1 compound] results in decreased expression of CCL20 mRNA CTD PMID:25119042 Ccl20 Rat PD 0325901 decreases expression ISO CCL20 (Homo sapiens) 6480464 mirdametinib results in decreased expression of CCL20 mRNA CTD PMID:25119042 Ccl20 Rat pentanal increases expression ISO CCL20 (Homo sapiens) 6480464 pentanal results in increased expression of CCL20 mRNA CTD PMID:26079696 Ccl20 Rat peptidoglycan increases expression ISO CCL20 (Homo sapiens) 6480464 Peptidoglycan results in increased expression of CCL20 mRNA and Peptidoglycan results in increased expression of CCL20 protein CTD PMID:15191912 and PMID:15860229 Ccl20 Rat perfluorononanoic acid decreases expression ISO CCL20 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of CCL20 mRNA CTD PMID:38568856 Ccl20 Rat perfluorononanoic acid increases expression ISO CCL20 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in increased expression of CCL20 mRNA CTD PMID:32588087 Ccl20 Rat perfluorooctane-1-sulfonic acid increases expression EXP 6480464 perfluorooctane sulfonic acid results in increased expression of CCL20 mRNA CTD PMID:22237054 Ccl20 Rat perfluorooctane-1-sulfonic acid decreases expression ISO CCL20 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in decreased expression of CCL20 mRNA CTD PMID:38568856 Ccl20 Rat perfluoroundecanoic acid decreases expression ISO CCL20 (Homo sapiens) 6480464 perfluoroundecanoic acid results in decreased expression of CCL20 protein CTD PMID:32916415 Ccl20 Rat phenobarbital affects expression ISO CCL20 (Homo sapiens) 6480464 Phenobarbital affects the expression of CCL20 mRNA CTD PMID:19159669 Ccl20 Rat PhIP increases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased expression of CCL20 mRNA CTD PMID:15059925 Ccl20 Rat phorbol 13-acetate 12-myristate increases expression ISO Ccl20 (Mus musculus) 6480464 Tetradecanoylphorbol Acetate results in increased expression of CCL20 mRNA CTD PMID:19945525 Ccl20 Rat pirinixic acid multiple interactions ISO Ccl20 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of CCL20 mRNA CTD PMID:19710929 Ccl20 Rat pirinixic acid multiple interactions ISO CCL20 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of CCL20 mRNA CTD PMID:19710929 Ccl20 Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of CCL20 mRNA CTD PMID:19162173 Ccl20 Rat piroxicam decreases expression ISO CCL20 (Homo sapiens) 6480464 Piroxicam results in decreased expression of CCL20 mRNA and Piroxicam results in decreased expression of CCL20 protein CTD PMID:19192274 Ccl20 Rat poly(I:C) multiple interactions ISO CCL20 (Homo sapiens) 6480464 [TL8-506 co-treated with Poly I-C] results in increased secretion of CCL20 protein CTD PMID:35688559 Ccl20 Rat potassium bromate increases expression EXP 6480464 potassium bromate results in increased expression of CCL20 mRNA CTD PMID:23588252 Ccl20 Rat potassium bromate multiple interactions ISO Ccl20 (Mus musculus) 6480464 [XRCC6 gene mutant form results in increased susceptibility to potassium bromate] affects the reaction [bisphenol A affects the expression of CCL20 mRNA] CTD PMID:27082013 Ccl20 Rat potassium dichromate increases secretion ISO CCL20 (Homo sapiens) 6480464 Potassium Dichromate results in increased secretion of CCL20 protein CTD PMID:15679580 Ccl20 Rat prednisolone decreases expression ISO CCL20 (Homo sapiens) 6480464 Prednisolone results in decreased expression of CCL20 mRNA and Prednisolone results in decreased expression of CCL20 protein CTD PMID:19192274 Ccl20 Rat propanal increases expression ISO CCL20 (Homo sapiens) 6480464 propionaldehyde results in increased expression of CCL20 mRNA CTD PMID:26079696 Ccl20 Rat prostaglandin E2 multiple interactions ISO CCL20 (Homo sapiens) 6480464 [Dinoprostone co-treated with IL1B] results in increased expression of CCL20 more ... CTD PMID:19273625 Ccl20 Rat prostaglandin E2 multiple interactions ISO Ccl20 (Mus musculus) 6480464 Dinoprostone inhibits the reaction [rofecoxib results in increased expression of CCL20 mRNA] and Dinoprostone inhibits the reaction [rofecoxib results in increased expression of CCL20 protein] CTD PMID:17667525 Ccl20 Rat pyrrolidine dithiocarbamate multiple interactions EXP 6480464 pyrrolidine dithiocarbamic acid inhibits the reaction [lipopolysaccharide and E coli O55-B5 results in increased expression of CCL20 mRNA] CTD PMID:11578593 Ccl20 Rat rac-lactic acid increases expression ISO CCL20 (Homo sapiens) 6480464 Lactic Acid results in increased expression of CCL20 mRNA CTD PMID:30851411 Ccl20 Rat raloxifene multiple interactions ISO Ccl20 (Mus musculus) 6480464 Fulvestrant inhibits the reaction [Raloxifene Hydrochloride inhibits the reaction [IL1B protein results in increased expression of CCL20 protein]] and Raloxifene Hydrochloride inhibits the reaction [IL1B protein results in increased expression of CCL20 protein] CTD PMID:24722370 Ccl20 Rat raloxifene multiple interactions ISO CCL20 (Homo sapiens) 6480464 [Raloxifene Hydrochloride co-treated with ESR2 protein] results in increased expression of CCL20 mRNA CTD PMID:19059307 Ccl20 Rat raloxifene affects expression ISO CCL20 (Homo sapiens) 6480464 Raloxifene Hydrochloride affects the expression of CCL20 mRNA CTD PMID:14699072 Ccl20 Rat razoxane multiple interactions EXP 6480464 Razoxane inhibits the reaction [Doxorubicin results in increased expression of CCL20 mRNA] CTD PMID:19915844 Ccl20 Rat resveratrol decreases response to substance ISO Ccl20 (Mus musculus) 6480464 resveratrol results in decreased susceptibility to CCL20 protein CTD PMID:21340626 Ccl20 Rat ritonavir decreases expression ISO CCL20 (Homo sapiens) 6480464 Ritonavir results in decreased expression of CCL20 CTD PMID:26626330 Ccl20 Rat rofecoxib multiple interactions ISO Ccl20 (Mus musculus) 6480464 Dinoprostone inhibits the reaction [rofecoxib results in increased expression of CCL20 mRNA] and Dinoprostone inhibits the reaction [rofecoxib results in increased expression of CCL20 protein] CTD PMID:17667525 Ccl20 Rat rofecoxib increases expression ISO Ccl20 (Mus musculus) 6480464 rofecoxib results in increased expression of CCL20 mRNA and rofecoxib results in increased expression of CCL20 protein CTD PMID:17667525 Ccl20 Rat Rutecarpine increases expression ISO CCL20 (Homo sapiens) 6480464 rutecarpine results in increased expression of CCL20 mRNA CTD PMID:34955744 Ccl20 Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO CCL20 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of CCL20 mRNA CTD PMID:35811015 Ccl20 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO CCL20 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Ccl20 Rat SB 431542 multiple interactions ISO CCL20 (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CCL20 mRNA CTD PMID:27188386 Ccl20 Rat serpentine asbestos increases expression ISO CCL20 (Homo sapiens) 6480464 Asbestos and Serpentine results in increased expression of CCL20 mRNA CTD PMID:24160326 Ccl20 Rat silicon dioxide increases expression ISO CCL20 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of CCL20 mRNA and Silicon Dioxide results in increased expression of CCL20 mRNA CTD PMID:19428942 more ... Ccl20 Rat silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of CCL20 mRNA CTD PMID:22431001 Ccl20 Rat silicon dioxide increases expression ISO Ccl20 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of CCL20 mRNA CTD PMID:23221170 and PMID:29341224 Ccl20 Rat simvastatin decreases expression EXP 6480464 Simvastatin results in decreased expression of CCL20 mRNA CTD PMID:22305382 Ccl20 Rat sirtinol increases expression ISO CCL20 (Homo sapiens) 6480464 sirtinol results in increased expression of CCL20 mRNA CTD PMID:22385246 Ccl20 Rat sodium arsenate multiple interactions ISO CCL20 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of CCL20 mRNA CTD PMID:32525701 Ccl20 Rat sodium arsenite increases expression ISO Ccl20 (Mus musculus) 6480464 sodium arsenite results in increased expression of CCL20 mRNA CTD PMID:21911445 Ccl20 Rat sodium arsenite increases expression ISO CCL20 (Homo sapiens) 6480464 sodium arsenite results in increased expression of CCL20 mRNA CTD PMID:28595984 more ... Ccl20 Rat sodium aurothiomalate decreases expression ISO CCL20 (Homo sapiens) 6480464 Gold Sodium Thiomalate results in decreased expression of CCL20 mRNA and Gold Sodium Thiomalate results in decreased expression of CCL20 protein CTD PMID:19192274 Ccl20 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of CCL20 mRNA CTD PMID:22561333 Ccl20 Rat sodium dichromate decreases expression EXP 6480464 sodium bichromate results in decreased expression of CCL20 mRNA CTD PMID:22561333 Ccl20 Rat sodium dodecyl sulfate multiple interactions ISO CCL20 (Homo sapiens) 6480464 IL1A protein affects the reaction [Sodium Dodecyl Sulfate results in increased secretion of CCL20 protein] and TNF protein affects the reaction [Sodium Dodecyl Sulfate results in increased secretion of CCL20 protein] CTD PMID:15679580 Ccl20 Rat sodium dodecyl sulfate increases expression ISO CCL20 (Homo sapiens) 6480464 Sodium Dodecyl Sulfate results in increased expression of CCL20 mRNA CTD PMID:30806763 and PMID:31734321 Ccl20 Rat sodium dodecyl sulfate increases secretion ISO CCL20 (Homo sapiens) 6480464 Sodium Dodecyl Sulfate results in increased secretion of CCL20 protein CTD PMID:15679580 Ccl20 Rat sterigmatocystin decreases expression ISO Ccl20 (Mus musculus) 6480464 Sterigmatocystin results in decreased expression of CCL20 mRNA CTD PMID:19818335 Ccl20 Rat sulforaphane increases expression ISO CCL20 (Homo sapiens) 6480464 sulforaphane results in increased expression of CCL20 mRNA CTD PMID:26833863 Ccl20 Rat sulforaphane multiple interactions ISO Ccl20 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to sulforaphane] which affects the expression of CCL20 mRNA CTD PMID:30529165 Ccl20 Rat sulfur dioxide decreases expression EXP 6480464 Sulfur Dioxide results in decreased expression of CCL20 protein CTD PMID:27565714 Ccl20 Rat sumatriptan multiple interactions EXP 6480464 [Naproxen co-treated with Sumatriptan] inhibits the reaction [Capsaicin results in increased expression of CCL20 protein] and Sumatriptan inhibits the reaction [Capsaicin results in increased expression of CCL20 protein] CTD PMID:22150557 Ccl20 Rat tacrolimus hydrate increases expression ISO Ccl20 (Mus musculus) 6480464 Tacrolimus results in increased expression of CCL20 mRNA CTD PMID:23958496 Ccl20 Rat tamoxifen multiple interactions ISO CCL20 (Homo sapiens) 6480464 [Tamoxifen co-treated with ESR2 protein] results in increased expression of CCL20 mRNA CTD PMID:19059307 Ccl20 Rat tamoxifen decreases expression ISO CCL20 (Homo sapiens) 6480464 Tamoxifen results in decreased expression of CCL20 mRNA CTD PMID:16298037 Ccl20 Rat taurocholic acid multiple interactions ISO Ccl20 (Mus musculus) 6480464 EGR1 promotes the reaction [Taurocholic Acid results in increased expression of CCL20 mRNA] CTD PMID:21224055 Ccl20 Rat taurocholic acid increases expression ISO Ccl20 (Mus musculus) 6480464 Taurocholic Acid results in increased expression of CCL20 mRNA CTD PMID:21224055 Ccl20 Rat tenofovir disoproxil fumarate increases expression ISO CCL20 (Homo sapiens) 6480464 Tenofovir results in increased expression of CCL20 mRNA CTD PMID:24205323 Ccl20 Rat tenofovir disoproxil fumarate multiple interactions ISO CCL20 (Homo sapiens) 6480464 Tenofovir results in increased expression of and results in increased secretion of CCL20 protein CTD PMID:24205323 Ccl20 Rat titanium dioxide increases expression ISO Ccl20 (Mus musculus) 6480464 titanium dioxide results in increased expression of CCL20 mRNA CTD PMID:21259345 more ... Ccl20 Rat titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of CCL20 mRNA CTD PMID:30012374 Ccl20 Rat TMC-120A increases expression ISO Ccl20 (Mus musculus) 6480464 TMC 120A results in increased expression of CCL20 mRNA CTD PMID:19818335 Ccl20 Rat TMC-120A decreases expression ISO Ccl20 (Mus musculus) 6480464 TMC 120A results in decreased expression of CCL20 mRNA CTD PMID:19818335 Ccl20 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of CCL20 mRNA CTD PMID:25729387 Ccl20 Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of CCL20 mRNA CTD PMID:25729387 Ccl20 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of CCL20 mRNA CTD PMID:33387578 Ccl20 Rat trimellitic anhydride increases expression ISO Ccl20 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of CCL20 mRNA CTD PMID:19042947 Ccl20 Rat troglitazone increases expression ISO CCL20 (Homo sapiens) 6480464 troglitazone results in increased expression of CCL20 mRNA CTD PMID:19140230 Ccl20 Rat troglitazone decreases expression EXP 6480464 troglitazone results in decreased expression of CCL20 mRNA CTD PMID:21515302 Ccl20 Rat Tryptanthrine multiple interactions ISO Ccl20 (Mus musculus) 6480464 tryptanthrine promotes the reaction [[AHR protein binds to ARNT protein] which binds to CCL20 promoter] CTD PMID:26259605 Ccl20 Rat Tryptanthrine multiple interactions ISO CCL20 (Homo sapiens) 6480464 tryptanthrine inhibits the reaction [[IL17A protein co-treated with TNF protein] results in increased expression of CCL20 mRNA] CTD PMID:32173427 Ccl20 Rat Tungsten carbide multiple interactions ISO CCL20 (Homo sapiens) 6480464 [tungsten carbide co-treated with Cobalt] results in increased expression of CCL20 mRNA CTD PMID:18078969 Ccl20 Rat tunicamycin increases expression ISO CCL20 (Homo sapiens) 6480464 Tunicamycin results in increased expression of CCL20 mRNA CTD PMID:33545341 Ccl20 Rat undecane increases expression EXP 6480464 undecane results in increased expression of CCL20 protein CTD PMID:17337753 Ccl20 Rat valproic acid increases expression ISO CCL20 (Homo sapiens) 6480464 Valproic Acid results in increased expression of CCL20 mRNA CTD PMID:28001369 and PMID:29154799 Ccl20 Rat vincristine increases expression ISO CCL20 (Homo sapiens) 6480464 Vincristine results in increased expression of CCL20 mRNA CTD PMID:23649840 Ccl20 Rat vorinostat decreases expression ISO CCL20 (Homo sapiens) 6480464 vorinostat results in decreased expression of CCL20 mRNA CTD PMID:18769122 Ccl20 Rat vorinostat increases expression ISO CCL20 (Homo sapiens) 6480464 vorinostat results in increased expression of CCL20 mRNA CTD PMID:18769122 Ccl20 Rat vorinostat multiple interactions ISO CCL20 (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CCL20 mRNA CTD PMID:27188386 Ccl20 Rat zinc atom increases expression EXP 6480464 Zinc deficiency results in increased expression of CCL20 mRNA CTD PMID:11717422 Ccl20 Rat zinc atom multiple interactions ISO Ccl20 (Mus musculus) 6480464 [Zinc co-treated with Nickel co-treated with Cobalt co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in decreased expression of CCL20 mRNA and TNF protein promotes the reaction [[Zinc co-treated with Nickel co-treated with Cobalt co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in decreased expression of CCL20 mRNA] CTD PMID:23503329 Ccl20 Rat zinc atom multiple interactions ISO CCL20 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of CCL20 mRNA CTD PMID:18593933 Ccl20 Rat zinc dichloride increases expression ISO CCL20 (Homo sapiens) 6480464 zinc chloride results in increased expression of CCL20 mRNA CTD PMID:19428942 more ... Ccl20 Rat zinc oxide decreases expression EXP 6480464 Zinc Oxide results in decreased expression of CCL20 protein CTD PMID:33205376 Ccl20 Rat zinc(0) increases expression EXP 6480464 Zinc deficiency results in increased expression of CCL20 mRNA CTD PMID:11717422 Ccl20 Rat zinc(0) multiple interactions ISO CCL20 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of CCL20 mRNA CTD PMID:18593933 Ccl20 Rat zinc(0) multiple interactions ISO Ccl20 (Mus musculus) 6480464 [Zinc co-treated with Nickel co-treated with Cobalt co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in decreased expression of CCL20 mRNA and TNF protein promotes the reaction [[Zinc co-treated with Nickel co-treated with Cobalt co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in decreased expression of CCL20 mRNA] CTD PMID:23503329 Ccl20 Rat zoledronic acid increases expression ISO CCL20 (Homo sapiens) 6480464 zoledronic acid results in increased expression of CCL20 mRNA CTD PMID:20977926 and PMID:24714768
Imported Annotations - KEGG (archival)
(-)-demecolcine (ISO) 1,2,4-trimethylbenzene (EXP) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 1-naphthyl isothiocyanate (EXP) 1-nitropyrene (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-amino-2-deoxy-D-glucopyranose (EXP) 2-hydroxypropanoic acid (ISO) 2-tert-butylhydroquinone (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP,ISO) 3-chlorophenol (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3-Nitrofluoranthene (ISO) 3-phenylprop-2-enal (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 6alpha-methylprednisolone (ISO) acrolein (EXP) aflatoxin B1 (ISO) aldehydo-D-glucosamine (EXP) all-trans-retinoic acid (EXP,ISO) allopurinol (EXP) alpha-Zearalanol (EXP) ammonium chloride (EXP) amphotericin B (ISO) andrographolide (ISO) antirheumatic drug (ISO) aripiprazole (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) asperentin (ISO) azathioprine (ISO) Bardoxolone methyl (ISO) barium sulfate (EXP) benzalkonium chloride (ISO) benzene (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) beta-D-glucosamine (EXP) beta-lapachone (ISO) beta-naphthoflavone (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) Botulinum toxin type A (ISO) Brevianamide A (ISO) butan-1-ol (ISO) butanal (ISO) Butylbenzyl phthalate (ISO) cadmium dichloride (ISO) calcitriol (ISO) cannabidiol (ISO) capsaicin (EXP) carbon nanotube (ISO) cefaloridine (EXP) ceric oxide (EXP,ISO) chenodeoxycholic acid (ISO) chloroprene (ISO) chromium(6+) (ISO) ciglitazone (ISO) cisplatin (ISO) cobalt atom (ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) deoxycholic acid (ISO) deoxynivalenol (ISO) dexamethasone (EXP,ISO) diarsenic trioxide (ISO) dibenzofuran (EXP) dibutyl phthalate (EXP) dichlorine (ISO) diethyl malate (ISO) diisononyl phthalate (ISO) dioxygen (EXP,ISO) dorsomorphin (ISO) doxorubicin (EXP,ISO) endosulfan (EXP,ISO) eugenol (ISO) fentanyl (EXP) ferric oxide (EXP) flavonoids (EXP) formaldehyde (ISO) fragrance (ISO) fulvestrant (ISO) fumonisin B1 (ISO) furan (EXP) gemcitabine (ISO) gentamycin (EXP) glutathione (ISO) hexachlorobenzene (EXP) hydrogen peroxide (ISO) indoxyl sulfate (ISO) iron(2+) sulfate (anhydrous) (ISO) lead diacetate (ISO) lead nitrate (ISO) leflunomide (ISO) lidocaine (EXP) linuron (ISO) lipopolysaccharide (ISO) lipoteichoic acid (EXP) malathion (ISO) melphalan (ISO) mercury atom (ISO) mercury dichloride (EXP) mercury(0) (ISO) mesalamine (ISO) methotrexate (ISO) methylisothiazolinone (ISO) methylmercury chloride (EXP) Muraglitazar (EXP) mycophenolic acid (ISO) mycotoxin (ISO) N-acetyl-L-cysteine (ISO) N-methyl-N-nitrosourea (ISO) N-Nitrosopyrrolidine (ISO) naphthalenes (EXP) naproxen (EXP) neoechinulin A (ISO) nickel atom (ISO) nickel dichloride (ISO) nickel sulfate (ISO) niclosamide (EXP,ISO) nicotinamide (ISO) o-anisidine (ISO) oxaliplatin (EXP) ozone (ISO) paracetamol (EXP,ISO) paraquat (EXP,ISO) PD 0325901 (ISO) pentanal (ISO) peptidoglycan (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (EXP,ISO) perfluoroundecanoic acid (ISO) phenobarbital (ISO) PhIP (EXP) phorbol 13-acetate 12-myristate (ISO) pirinixic acid (EXP,ISO) piroxicam (ISO) poly(I:C) (ISO) potassium bromate (EXP,ISO) potassium dichromate (ISO) prednisolone (ISO) propanal (ISO) prostaglandin E2 (ISO) pyrrolidine dithiocarbamate (EXP) rac-lactic acid (ISO) raloxifene (ISO) razoxane (EXP) resveratrol (ISO) ritonavir (ISO) rofecoxib (ISO) Rutecarpine (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) serpentine asbestos (ISO) silicon dioxide (EXP,ISO) simvastatin (EXP) sirtinol (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium aurothiomalate (ISO) sodium dichromate (EXP) sodium dodecyl sulfate (ISO) sterigmatocystin (ISO) sulforaphane (ISO) sulfur dioxide (EXP) sumatriptan (EXP) tacrolimus hydrate (ISO) tamoxifen (ISO) taurocholic acid (ISO) tenofovir disoproxil fumarate (ISO) titanium dioxide (EXP,ISO) TMC-120A (ISO) topotecan (EXP) trichloroethene (EXP) trimellitic anhydride (ISO) troglitazone (EXP,ISO) Tryptanthrine (ISO) Tungsten carbide (ISO) tunicamycin (ISO) undecane (EXP) valproic acid (ISO) vincristine (ISO) vorinostat (ISO) zinc atom (EXP,ISO) zinc dichloride (ISO) zinc oxide (EXP) zinc(0) (EXP,ISO) zoledronic acid (ISO)
1.
Increased presence of dendritic cells and dendritic cell chemokines in the sinus mucosa of chronic rhinosinusitis with nasal polyps and allergic fungal rhinosinusitis.
Ayers CM, etal., Int Forum Allergy Rhinol. 2011 Jul-Aug;1(4):296-302. doi: 10.1002/alr.20046. Epub 2011 Apr 11.
2.
Orchestration of inflammation and adaptive immunity in Borrelia burgdorferi-induced arthritis by neutrophil-activating protein A.
Codolo G, etal., Arthritis Rheum. 2013 May;65(5):1232-42. doi: 10.1002/art.37875.
3.
CCL20/macrophage inflammatory protein 3alpha and tumor necrosis factor alpha production by primary uterine epithelial cells in response to treatment with lipopolysaccharide or Pam3Cys.
Crane-Godreau MA and Wira CR, Infect Immun. 2005 Jan;73(1):476-84.
4.
Expression of inflammatory chemokines combined with local tumor destruction enhances tumor regression and long-term immunity.
Crittenden M, etal., Cancer Res. 2003 Sep 1;63(17):5505-12.
5.
Baicalin down-regulates the expression of macrophage migration inhibitory factor (MIF) effectively for rats with ulcerative colitis.
Dai SX, etal., Phytother Res. 2012 Apr;26(4):498-504. doi: 10.1002/ptr.3581. Epub 2011 Sep 2.
6.
Lateral fluid percussion injury of the brain induces CCL20 inflammatory chemokine expression in rats.
Das M, etal., J Neuroinflammation. 2011 Oct 31;8:148. doi: 10.1186/1742-2094-8-148.
7.
Age-related T-cell cytokine profile parallels corneal disease severity in Sjogren's syndrome-like keratoconjunctivitis sicca in CD25KO mice.
De Paiva CS, etal., Rheumatology (Oxford). 2010 Feb;49(2):246-58. doi: 10.1093/rheumatology/kep357. Epub 2009 Dec 9.
8.
The CCR6/CCL20 axis mediates Th17 cell migration to the ocular surface in dry eye disease.
Dohlman TH, etal., Invest Ophthalmol Vis Sci. 2013 Jun 12;54(6):4081-91. doi: 10.1167/iovs.12-11216.
9.
[Expression of CCL20 and CXCR4 in epidermal condyloma acuminatum lesions].
Feng JY, etal., Nan Fang Yi Ke Da Xue Xue Bao. 2007 Apr;27(4):418-20.
10.
Cytokine and chemokine expression in the skin from patients with maculopapular exanthema to drugs.
Fernandez TD, etal., Allergy. 2008 Jun;63(6):712-9. doi: 10.1111/j.1398-9995.2007.01607.x. Epub 2008 Mar 29.
11.
Elevated CCR6+ CD4+ T lymphocytes in tissue compared with blood and induction of CCL20 during the asthmatic late response.
Francis JN, etal., Clin Exp Immunol. 2008 Jun;152(3):440-7. doi: 10.1111/j.1365-2249.2008.03657.x. Epub 2008 Apr 16.
12.
Hypothermia-enhanced splenic cytokine gene expression is independent of the sympathetic nervous system.
Ganta CK, etal., Am J Physiol Regul Integr Comp Physiol. 2006 Sep;291(3):R558-65.
13.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
14.
TNF inhibition rapidly down-regulates multiple proinflammatory pathways in psoriasis plaques.
Gottlieb AB, etal., J Immunol. 2005 Aug 15;175(4):2721-9.
15.
Up-regulation of macrophage inflammatory protein-3 alpha/CCL20 and CC chemokine receptor 6 in psoriasis.
Homey B, etal., J Immunol. 2000 Jun 15;164(12):6621-32.
16.
Expression profile of chemokines and chemokine receptors in epithelial cell layers of oral lichen planus.
Ichimura M, etal., J Oral Pathol Med. 2006 Mar;35(3):167-74.
17.
Detection and localization of Mip-3alpha/LARC/Exodus, a macrophage proinflammatory chemokine, and its CCR6 receptor in human pancreatic cancer.
Kleeff J, etal., Int J Cancer. 1999 May 17;81(4):650-7.
18.
Up-regulation of chemokine ligand 20 in chronic rhinosinusitis.
Lee JH, etal., Arch Otolaryngol Head Neck Surg. 2006 May;132(5):537-41.
19.
Sensitization to Per a 2 of the American cockroach correlates with more clinical severity among airway allergic patients in Taiwan.
Lee MF, etal., Ann Allergy Asthma Immunol. 2012 Apr;108(4):243-8. doi: 10.1016/j.anai.2012.01.014. Epub 2012 Feb 14.
20.
CCR6 is required for epidermal trafficking of gammadelta-T cells in an IL-23-induced model of psoriasiform dermatitis.
Mabuchi T, etal., J Invest Dermatol. 2013 Jan;133(1):164-71. doi: 10.1038/jid.2012.260. Epub 2012 Aug 16.
21.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
22.
IL-22, but not IL-17, dominant environment in cutaneous T-cell lymphoma.
Miyagaki T, etal., Clin Cancer Res. 2011 Dec 15;17(24):7529-38. doi: 10.1158/1078-0432.CCR-11-1192. Epub 2011 Nov 2.
23.
Chemokine signatures in the skin disorders of Lyme borreliosis in Europe: predominance of CXCL9 and CXCL10 in erythema migrans and acrodermatitis and CXCL13 in lymphocytoma.
Mullegger RR, etal., Infect Immun. 2007 Sep;75(9):4621-8. Epub 2007 Jul 2.
24.
Inducible expression of a CC chemokine liver- and activation-regulated chemokine (LARC)/macrophage inflammatory protein (MIP)-3 alpha/CCL20 by epidermal keratinocytes and its role in atopic dermatitis.
Nakayama T, etal., Int Immunol. 2001 Jan;13(1):95-103.
25.
Dendritic cell subsets and immunological milieu in inflammatory human papilloma virus-related skin lesions.
Nakayama Y, etal., J Dermatol Sci. 2011 Sep;63(3):173-83. doi: 10.1016/j.jdermsci.2011.05.006. Epub 2011 Jun 6.
26.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
27.
Dermatophagoides farinae extract induces severe atopic dermatitis in NC/Nga mice, which is effectively suppressed by the administration of tacrolimus ointment.
Oshio T, etal., Int Immunopharmacol. 2009 Apr;9(4):403-11. doi: 10.1016/j.intimp.2008.12.013. Epub 2009 Jan 20.
28.
Neutropenia enhances lung dendritic cell recruitment in response to Aspergillus via a cytokine-to-chemokine amplification loop.
Park SJ, etal., J Immunol. 2010 Nov 15;185(10):6190-7. doi: 10.4049/jimmunol.1002064. Epub 2010 Oct 6.
29.
Deletion of interferon-gamma delays onset and severity of dacryoadenitis in CD25KO mice.
Pelegrino FS, etal., Arthritis Res Ther. 2012 Nov 1;14(6):R234.
30.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
31.
High glucose induces macrophage inflammatory protein-3 alpha in renal proximal tubule cells via a transforming growth factor-beta 1 dependent mechanism.
Qi W, etal., Nephrol Dial Transplant. 2007 Nov;22(11):3147-53. Epub 2007 Jul 29.
32.
GOA pipeline
RGD automated data pipeline
33.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
34.
Protein expression changes during human triple negative breast cancer cell line progression to lymph node metastasis in a xenografted model in nude mice.
Roberti MP, etal., Cancer Biol Ther. 2012 Sep;13(11):1123-40. doi: 10.4161/cbt.21187. Epub 2012 Jul 24.
35.
Oral administration of oleic or linoleic acid accelerates the inflammatory phase of wound healing.
Rodrigues HG, etal., J Invest Dermatol. 2012 Jan;132(1):208-15. doi: 10.1038/jid.2011.265. Epub 2011 Sep 1.
36.
MCP-1 and MIP3-alpha serum levels in acute liver failure and molecular adsorbent recirculating system (MARS) treatment: a pilot study.
Roth GA, etal., Scand J Gastroenterol. 2009;44(6):745-51. doi: 10.1080/00365520902770086.
37.
Corneal epithelial cells and stromal keratocytes efficently produce CC chemokine-ligand 20 (CCL20) and attract cells expressing its receptor CCR6 in mouse herpetic stromal keratitis.
Shirane J, etal., Curr Eye Res. 2004 May;28(5):297-306.
38.
Up-regulation of CC chemokine ligand 20 and its receptor CCR6 in the lesional skin of early systemic sclerosis.
Tao J, etal., Eur J Dermatol. 2011 Sep-Oct;21(5):731-6. doi: 10.1684/ejd.2011.1469.
39.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
40.
Macrophage inflammatory protein-3alpha plays a key role in the inflammatory cascade in rat focal cerebral ischemia.
Terao Y, etal., Neurosci Res. 2009 May;64(1):75-82. doi: 10.1016/j.neures.2009.01.017. Epub 2009 Feb 13.
41.
A novel rat CC chemokine, identified by targeted differential display, is upregulated in brain inflammation.
Utans-Schneitz U, etal., J Neuroimmunol 1998 Dec 1;92(1-2):179-90.
42.
Transcriptional regulation of inflammatory and extracellular matrix-regulating genes in cerebral arteries following experimental subarachnoid hemorrhage in rats. Laboratory investigation.
Vikman P, etal., J Neurosurg. 2007 Nov;107(5):1015-22.
43.
Late angiotensin II receptor blockade in progressive rat mesangioproliferative glomerulonephritis: new insights into mechanisms.
Villa L, etal., J Pathol. 2013 Apr;229(5):672-84. doi: 10.1002/path.4151. Epub 2013 Mar 5.
44.
Gene expression profiles of nasal polyps associated with allergic rhinitis.
Wu J, etal., Am J Otolaryngol. 2009 Jan-Feb;30(1):24-32. doi: 10.1016/j.amjoto.2008.01.003. Epub 2008 Jul 9.
Ccl20 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 91,837,139 - 91,839,736 (+) NCBI GRCr8 mRatBN7.2 9 84,389,031 - 84,391,629 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 84,388,904 - 84,391,629 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 92,819,272 - 92,821,849 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 97,947,738 - 97,950,315 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 96,330,459 - 96,333,051 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 88,918,359 - 88,921,017 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 88,918,433 - 88,921,001 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 88,662,765 - 88,665,379 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 82,440,965 - 82,443,542 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 82,624,383 - 82,626,960 (+) NCBI Celera 9 81,830,990 - 81,833,567 (+) NCBI Celera Cytogenetic Map 9 q35 NCBI
CCL20 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 227,813,842 - 227,817,556 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 227,805,739 - 227,817,564 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 228,678,558 - 228,682,272 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 228,386,814 - 228,390,494 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 228,504,074 - 228,507,755 NCBI Celera 2 222,448,001 - 222,451,723 (+) NCBI Celera Cytogenetic Map 2 q36.3 NCBI HuRef 2 220,520,976 - 220,524,697 (+) NCBI HuRef CHM1_1 2 228,684,755 - 228,688,476 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 228,296,236 - 228,299,949 (+) NCBI T2T-CHM13v2.0
Ccl20 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 83,094,487 - 83,096,888 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 83,094,487 - 83,096,888 (+) Ensembl GRCm39 Ensembl GRCm38 1 83,116,766 - 83,119,167 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 83,116,766 - 83,119,167 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 83,113,341 - 83,115,742 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 82,995,806 - 82,998,190 (+) NCBI MGSCv36 mm8 Celera 1 83,181,441 - 83,183,842 (+) NCBI Celera Cytogenetic Map 1 C5 NCBI cM Map 1 42.69 NCBI
Ccl20 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955453 6,846,549 - 6,850,031 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955453 6,846,625 - 6,850,007 (-) NCBI ChiLan1.0 ChiLan1.0
CCL20 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 13 130,426,843 - 130,430,630 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2B 130,441,887 - 130,445,600 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2B 115,052,768 - 115,056,479 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2B 233,862,505 - 233,866,225 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2B 233,862,505 - 233,866,225 (+) Ensembl panpan1.1 panPan2
CCL20 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 25 40,506,385 - 40,509,903 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 25 40,506,753 - 40,509,709 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 25 41,124,207 - 41,127,161 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 25 40,753,667 - 40,756,954 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 25 40,753,401 - 40,756,953 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 25 40,689,847 - 40,692,573 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 25 40,531,942 - 40,534,671 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 25 40,704,782 - 40,707,510 (+) NCBI UU_Cfam_GSD_1.0
Ccl20 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 182,698,770 - 182,701,593 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936525 8,237,831 - 8,240,974 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936525 8,238,128 - 8,240,974 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CCL20
CCL20 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 10 113,815,099 - 113,836,562 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 10 113,832,573 - 113,835,736 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 85,618,590 - 85,622,439 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ccl20
.
Predicted Target Of
Count of predictions: 40 Count of miRNA genes: 39 Interacting mature miRNAs: 39 Transcripts: ENSRNOT00000021730 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
11353957 Bmd92 Bone mineral density QTL 92 0.01 tibia mineral mass (VT:1000283) volumetric bone mineral density (CMO:0001553) 9 46114199 91114199 Rat 724547 Cm21 Cardiac mass QTL 21 2.7 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 9 79271511 102910209 Rat 61385 Edpm9 Estrogen-dependent pituitary mass QTL 9 3.43 0.05 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 9 63869687 108869687 Rat 724544 Uae9 Urinary albumin excretion QTL 9 4.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 9 25268044 114175309 Rat 1578760 Cm53 Cardiac mass QTL 53 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 9 56771635 101771635 Rat 1581580 Uae34 Urinary albumin excretion QTL 34 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 9 62072275 96470995 Rat 12879506 Pur33 Proteinuria QTL 33 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 9 44649921 89649921 Rat 1354626 Bvd1 Brain ventricular dilatation QTL 1 3.73 0.001 brain ventricle morphology trait (VT:0000822) hydrocephalus severity score (CMO:0001881) 9 75712843 111552878 Rat 7794784 Mcs31 Mammary carcinoma susceptibility QTL 31 2.98 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 9 77813894 111552878 Rat 731164 Uae25 Urinary albumin excretion QTL 25 3.5 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 9 25661188 100929786 Rat 10058949 Gmadr5 Adrenal mass QTL 5 2 0.014 adrenal gland mass (VT:0010420) both adrenal glands wet weight to body weight ratio (CMO:0002411) 9 42791513 87976209 Rat 1578757 Pur6 Proteinuria QTL 6 3.3 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 9 62072275 96470995 Rat 631656 Bp108 Blood pressure QTL 108 5.97 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 48598251 93598251 Rat 8662828 Vetf6 Vascular elastic tissue fragility QTL 6 3.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 9 36962359 92058970 Rat 724515 Uae16 Urinary albumin excretion QTL 16 8 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 9 58163035 100929646 Rat 731171 Glom6 Glomerulus QTL 6 2.8 0.0003 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 9 64573531 109573531 Rat 2303178 Bp334 Blood pressure QTL 334 3.7 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 79271511 91616855 Rat 70186 Niddm26 Non-insulin dependent diabetes mellitus QTL 26 3.87 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 9 22071169 86369743 Rat 6903941 Pur31 Proteinuria QTL 31 0.036 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 9 40194188 85194188 Rat 2290450 Scl57 Serum cholesterol level QTL 57 4.15 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 9 36962359 95410867 Rat 11353949 Bp393 Blood pressure QTL 393 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 40194188 85194188 Rat 11353951 Bp394 Blood pressure QTL 394 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 44649921 89649921 Rat 10054125 Srcrt7 Stress Responsive Cort QTL 7 3.33 0.0011 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 9 1 87073594 Rat 1300134 Bp185 Blood pressure QTL 185 3.73 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 9 61381434 104821652 Rat 4889852 Pur26 Proteinuria QTL 26 15 0.001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 9 77813894 101597663 Rat
AB015136
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 9 84,391,211 - 84,391,296 (+) MAPPER mRatBN7.2 Rnor_6.0 9 88,920,586 - 88,920,670 NCBI Rnor6.0 Rnor_5.0 9 88,664,962 - 88,665,046 UniSTS Rnor5.0 RGSC_v3.4 9 82,443,125 - 82,443,209 UniSTS RGSC3.4 Celera 9 81,833,150 - 81,833,234 UniSTS Cytogenetic Map 9 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
1
49
47
52
64
35
18
35
6
160
71
39
44
40
29
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000021730 ⟹ ENSRNOP00000021730
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 84,388,904 - 84,391,629 (+) Ensembl Rnor_6.0 Ensembl 9 88,918,433 - 88,921,001 (+) Ensembl
RefSeq Acc Id:
NM_019233 ⟹ NP_062106
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 91,837,159 - 91,839,736 (+) NCBI mRatBN7.2 9 84,389,052 - 84,391,629 (+) NCBI Rnor_6.0 9 88,918,426 - 88,921,003 (+) NCBI Rnor_5.0 9 88,662,765 - 88,665,379 (+) NCBI RGSC_v3.4 9 82,440,965 - 82,443,542 (+) RGD Celera 9 81,830,990 - 81,833,567 (+) RGD
Sequence:
AGCAGGGCACTGGGTACCCAGCACTGAGCAGATCAATTCCTGGAGCTGAGAATGGCCTGCAAGCATCTGCCCTTCCTGGCTTTGGCGGGGGTACTGCTGGCTTACCTCTGCAGCCAGTCAGAAGCAGC
hide sequence
RefSeq Acc Id:
XM_006245164 ⟹ XP_006245226
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 91,837,139 - 91,839,736 (+) NCBI mRatBN7.2 9 84,389,031 - 84,391,629 (+) NCBI Rnor_6.0 9 88,918,359 - 88,921,017 (+) NCBI Rnor_5.0 9 88,662,765 - 88,665,379 (+) NCBI
Sequence:
GCCTCCTTGTGTACATTCCCAATCTTTTGCTATAAGTAGGGCTGCCTCTGGAGCCCGAGGAGCA
hide sequence
RefSeq Acc Id:
NP_062106 ⟸ NM_019233
- Peptide Label:
precursor
- UniProtKB:
P97884 (UniProtKB/Swiss-Prot), A6JWB9 (UniProtKB/TrEMBL)
- Sequence:
MACKHLPFLALAGVLLAYLCSQSEAASNFDCCLTYTKNVYHHARNFVGFTTQMADEACDINAIIFHLKSKRSVCADPKQIWVKRILHLLSLRTKKM
hide sequence
RefSeq Acc Id:
XP_006245226 ⟸ XM_006245164
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2QAZ9 (UniProtKB/TrEMBL)
- Sequence:
MACKHLPFLALAGVLLAYLCSQSEASNFDCCLTYTKNVYHHARNFVGFTTQMADEACDINAIIFHLKSKRSVCADPKQIWVKRILHLLSLRTKKM
hide sequence
Ensembl Acc Id:
ENSRNOP00000021730 ⟸ ENSRNOT00000021730
RGD ID: 13696804 Promoter ID: EPDNEW_R7328 Type: single initiation site Name: Ccl20_1 Description: C-C motif chemokine ligand 20 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 9 88,918,422 - 88,918,482 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-08
Ccl20
C-C motif chemokine ligand 20
Ccl20
chemokine (C-C motif) ligand 20
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Ccl20
chemokine (C-C motif) ligand 20
Scya20
small inducible cytokine subfamily A20
Symbol and Name updated
1299863 APPROVED
2002-06-10
Scya20
small inducible cytokine subfamily A20
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_regulation
expression is induced by TNF in the brain
69987
