Symbol:
Rbp2
Name:
retinol binding protein 2
RGD ID:
3544
Description:
Enables retinol binding activity. Predicted to be involved in fatty acid transport and retinoid metabolic process. Predicted to be active in cytosol and nucleus. Orthologous to human RBP2 (retinol binding protein 2); PARTICIPATES IN retinol metabolic pathway; INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,2',4,4'-Tetrabromodiphenyl ether.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
cellular retinol-binding protein II; CRBP-II; retinol binding protein 2, cellular; retinol-binding protein 2; Retinol-binding protein 2 cellular; Retinol-binding protein 2, cellular
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
RBP2 (retinol binding protein 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Rbp2 (retinol binding protein 2, cellular) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Rbp2 (retinol binding protein 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
RBP2 (retinol binding protein 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
RBP2 (retinol binding protein 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Rbp2 (retinol binding protein 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
RBP2 (retinol binding protein 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
RBP2 (retinol binding protein 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Rbp2 (retinol binding protein 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
RBP1 (retinol binding protein 1) HGNC
OrthoDB
Homo sapiens (human):
RBP7 (retinol binding protein 7) HGNC
OrthoDB
Alliance orthologs 3
Mus musculus (house mouse):
Rbp2 (retinol binding protein 2, cellular)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
RBP2 (retinol binding protein 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
rbp2b (retinol binding protein 2b, cellular)
Alliance
DIOPT (OMA|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
rbp2a (retinol binding protein 2a, cellular)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
rbp2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 107,958,670 - 107,983,850 (+) NCBI GRCr8 mRatBN7.2 8 99,079,293 - 99,104,489 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 99,079,104 - 99,104,473 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 104,752,605 - 104,772,947 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 102,951,869 - 102,972,216 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 100,794,370 - 100,814,714 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 106,479,253 - 106,527,726 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 106,503,504 - 106,527,711 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 105,945,338 - 105,969,565 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 103,665,461 - 103,685,771 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 103,684,970 - 103,705,027 (+) NCBI Celera 8 98,493,627 - 98,513,957 (+) NCBI Celera RH 3.4 Map 8 1052.2 RGD Cytogenetic Map 8 q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Rbp2 Rat 1,2-dimethylhydrazine decreases expression ISO Rbp2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of RBP2 mRNA CTD PMID:22206623 Rbp2 Rat 17alpha-ethynylestradiol multiple interactions ISO Rbp2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of RBP2 mRNA CTD PMID:17942748 Rbp2 Rat 17alpha-ethynylestradiol decreases expression ISO RBP2 (Homo sapiens) 6480464 Ethinyl Estradiol results in decreased expression of RBP2 mRNA CTD PMID:18936297 Rbp2 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of RBP2 mRNA CTD PMID:17557909 Rbp2 Rat 17beta-estradiol multiple interactions EXP 6480464 [Estradiol co-treated with Plant Preparations] results in increased expression of RBP2 mRNA CTD PMID:26945725 Rbp2 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of RBP2 mRNA and Estradiol results in decreased expression of RBP2 protein CTD PMID:32145629 Rbp2 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of RBP2 mRNA CTD PMID:26945725 Rbp2 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Rbp2 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Rbp2 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2 more ... CTD PMID:31826744 Rbp2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Rbp2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of RBP2 mRNA CTD PMID:17942748 Rbp2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of RBP2 mRNA CTD PMID:33387578 Rbp2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Rbp2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of RBP2 mRNA CTD PMID:21570461 Rbp2 Rat 2-hydroxypropanoic acid increases expression ISO RBP2 (Homo sapiens) 6480464 Lactic Acid results in increased expression of RBP2 mRNA CTD PMID:30851411 Rbp2 Rat 6-propyl-2-thiouracil multiple interactions ISO Rbp2 (Mus musculus) 6480464 [Propylthiouracil co-treated with Iodine deficiency] results in decreased expression of RBP2 mRNA CTD PMID:36706583 Rbp2 Rat 9-cis-retinoic acid increases expression EXP 6480464 Alitretinoin results in increased expression of RBP2 mRNA CTD PMID:19409899 Rbp2 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of RBP2 mRNA CTD PMID:31881176 Rbp2 Rat all-trans-retinoic acid increases expression ISO RBP2 (Homo sapiens) 6480464 Tretinoin results in increased expression of RBP2 mRNA CTD PMID:17023940 Rbp2 Rat all-trans-retinoic acid affects expression ISO RBP2 (Homo sapiens) 6480464 Tretinoin affects the expression of RBP2 mRNA CTD PMID:31600526 Rbp2 Rat all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of RBP2 mRNA CTD PMID:19409899 Rbp2 Rat all-trans-retinol multiple interactions ISO Rbp2 (Mus musculus) 6480464 [RBP1 gene mutant form results in increased abundance of Vitamin A] which results in increased expression of RBP2 mRNA CTD PMID:21670153 Rbp2 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of RBP2 mRNA CTD PMID:30047161 Rbp2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of RBP2 mRNA CTD PMID:16483693 Rbp2 Rat arsenous acid multiple interactions ISO RBP2 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to RBP2 protein] CTD PMID:26598702 Rbp2 Rat benzo[a]pyrene decreases expression ISO RBP2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of RBP2 mRNA CTD PMID:21871943 Rbp2 Rat benzo[a]pyrene increases methylation ISO RBP2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of RBP2 exon CTD PMID:27901495 Rbp2 Rat benzo[a]pyrene affects methylation ISO RBP2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of RBP2 promoter CTD PMID:27901495 Rbp2 Rat bis(2-ethylhexyl) phthalate increases expression ISO Rbp2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of RBP2 mRNA CTD PMID:28085963 Rbp2 Rat bisphenol A decreases expression ISO Rbp2 (Mus musculus) 6480464 bisphenol A results in decreased expression of RBP2 mRNA CTD PMID:29161229 Rbp2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of RBP2 protein CTD PMID:32145629 Rbp2 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of RBP2 mRNA CTD PMID:32145629 Rbp2 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of RBP2 gene CTD PMID:28505145 Rbp2 Rat cadmium atom decreases expression ISO RBP2 (Homo sapiens) 6480464 Cadmium results in decreased expression of RBP2 mRNA CTD PMID:24376830 Rbp2 Rat cadmium atom multiple interactions ISO Rbp2 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of RBP2 mRNA CTD PMID:37325564 Rbp2 Rat cadmium dichloride multiple interactions ISO Rbp2 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of RBP2 mRNA CTD PMID:37325564 Rbp2 Rat cefaloridine increases expression EXP 6480464 Cephaloridine results in increased expression of RBP2 mRNA CTD PMID:18500788 Rbp2 Rat chlorpyrifos increases expression ISO Rbp2 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of RBP2 mRNA CTD PMID:32715474 Rbp2 Rat clofibrate increases expression EXP 6480464 Clofibrate results in increased expression of RBP2 mRNA CTD PMID:32741897 Rbp2 Rat clotrimazole increases expression EXP 6480464 Clotrimazole results in increased expression of RBP2 mRNA CTD PMID:30047161 Rbp2 Rat copper(II) sulfate decreases expression ISO RBP2 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of RBP2 mRNA CTD PMID:19549813 Rbp2 Rat D-mannitol decreases expression ISO Rbp2 (Mus musculus) 6480464 Mannitol results in decreased expression of RBP2 mRNA CTD PMID:25270620 Rbp2 Rat diarsenic trioxide multiple interactions ISO RBP2 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to RBP2 protein] CTD PMID:26598702 Rbp2 Rat dicrotophos decreases expression ISO RBP2 (Homo sapiens) 6480464 dicrotophos results in decreased expression of RBP2 mRNA CTD PMID:28302478 Rbp2 Rat diethylstilbestrol increases expression ISO Rbp2 (Mus musculus) 6480464 Diethylstilbestrol results in increased expression of RBP2 mRNA CTD PMID:14963765 and PMID:15171707 Rbp2 Rat diiodine multiple interactions ISO Rbp2 (Mus musculus) 6480464 [Propylthiouracil co-treated with Iodine deficiency] results in decreased expression of RBP2 mRNA CTD PMID:36706583 Rbp2 Rat fenofibrate increases expression EXP 6480464 Fenofibrate results in increased expression of RBP2 mRNA CTD PMID:32741897 Rbp2 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of RBP2 mRNA CTD PMID:30307764 Rbp2 Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of RBP2 mRNA CTD PMID:18035473 Rbp2 Rat irinotecan affects expression EXP 6480464 Irinotecan affects the expression of RBP2 mRNA CTD PMID:20097248 Rbp2 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of RBP2 mRNA CTD PMID:30047161 Rbp2 Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of RBP2 mRNA CTD PMID:33484710 Rbp2 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of RBP2 mRNA CTD PMID:33387578 Rbp2 Rat perfluorooctanoic acid decreases expression ISO Rbp2 (Mus musculus) 6480464 perfluorooctanoic acid results in decreased expression of RBP2 mRNA CTD PMID:17681415 Rbp2 Rat phenytoin increases expression ISO Rbp2 (Mus musculus) 6480464 Phenytoin results in increased expression of RBP2 mRNA CTD PMID:9118846 Rbp2 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of RBP2 mRNA CTD PMID:19162173 and PMID:32741897 Rbp2 Rat rac-lactic acid increases expression ISO RBP2 (Homo sapiens) 6480464 Lactic Acid results in increased expression of RBP2 mRNA CTD PMID:30851411 Rbp2 Rat resveratrol multiple interactions ISO RBP2 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of RBP2 mRNA CTD PMID:23557933 Rbp2 Rat sodium arsenite decreases expression ISO Rbp2 (Mus musculus) 6480464 sodium arsenite results in decreased expression of RBP2 mRNA CTD PMID:37682722 Rbp2 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of RBP2 mRNA CTD PMID:30047161 Rbp2 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of RBP2 mRNA CTD PMID:33387578 Rbp2 Rat triphenyl phosphate increases expression EXP 6480464 triphenyl phosphate results in increased expression of RBP2 mRNA CTD PMID:30589522 Rbp2 Rat undecane decreases expression EXP 6480464 undecane results in decreased expression of RBP2 protein CTD PMID:17337753
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-hydroxypropanoic acid (ISO) 6-propyl-2-thiouracil (ISO) 9-cis-retinoic acid (EXP) acetamide (EXP) all-trans-retinoic acid (EXP,ISO) all-trans-retinol (ISO) amitrole (EXP) ammonium chloride (EXP) arsenous acid (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) cadmium atom (ISO) cadmium dichloride (ISO) cefaloridine (EXP) chlorpyrifos (ISO) clofibrate (EXP) clotrimazole (EXP) copper(II) sulfate (ISO) D-mannitol (ISO) diarsenic trioxide (ISO) dicrotophos (ISO) diethylstilbestrol (ISO) diiodine (ISO) fenofibrate (EXP) fenvalerate (EXP) flavonoids (EXP) irinotecan (EXP) methimazole (EXP) nitrofen (EXP) paracetamol (EXP) perfluorooctanoic acid (ISO) phenytoin (ISO) pirinixic acid (EXP) rac-lactic acid (ISO) resveratrol (ISO) sodium arsenite (ISO) sulfadimethoxine (EXP) trichloroethene (EXP) triphenyl phosphate (EXP) undecane (EXP)
1.
The cellular retinol binding protein II gene. Sequence analysis of the rat gene, chromosomal localization in mice and humans, and documentation of its close linkage to the cellular retinol binding protein gene.
Demmer LA, etal., J Biol Chem 1987 Feb 25;262(6):2458-67.
2.
New insights on the protein-ligand interaction differences between the two primary cellular retinol carriers.
Franzoni L, etal., J Lipid Res. 2010 Jun;51(6):1332-43. Epub 2009 Nov 25.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Differential expression of interphotoreceptor retinoid-binding protein, opsin, cellular retinaldehyde-binding protein, and basic fibroblastic growth factor.
Gonzalez-Fernandez F, etal., Exp Eye Res 1993 Apr;56(4):411-27.
6.
Mechanisms involved in the intestinal absorption of dietary vitamin A and provitamin A carotenoids.
Harrison EH Biochim Biophys Acta. 2012 Jan;1821(1):70-7. Epub 2011 Jun 12.
7.
Genetic isolation of a region of chromosome 8 that exerts major effects on blood pressure and cardiac mass in the spontaneously hypertensive rat.
Kren V, etal., J Clin Invest 1997 Feb 15;99(4):577-81
8.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
9.
Rat cellular retinol-binding protein II: use of a cloned cDNA to define its primary structure, tissue-specific expression, and developmental regulation.
Li E, etal., Proc Natl Acad Sci U S A 1986 Aug;83(16):5779-83.
10.
Two homologous rat cellular retinol-binding proteins differ in local conformational flexibility.
Lu J, etal., J Mol Biol. 2003 Jul 18;330(4):799-812.
11.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
12.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
13.
GOA pipeline
RGD automated data pipeline
14.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
15.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
16.
Gene-based anchoring of the rat genetic linkage and cytogenetic maps: new regional localizations, orientation of the linkage groups, and insights into mammalian chromosome evolution.
Szpirer C, etal., Mamm Genome 1998 Sep;9(9):721-34
Rbp2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 107,958,670 - 107,983,850 (+) NCBI GRCr8 mRatBN7.2 8 99,079,293 - 99,104,489 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 99,079,104 - 99,104,473 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 104,752,605 - 104,772,947 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 102,951,869 - 102,972,216 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 100,794,370 - 100,814,714 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 106,479,253 - 106,527,726 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 106,503,504 - 106,527,711 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 105,945,338 - 105,969,565 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 103,665,461 - 103,685,771 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 103,684,970 - 103,705,027 (+) NCBI Celera 8 98,493,627 - 98,513,957 (+) NCBI Celera RH 3.4 Map 8 1052.2 RGD Cytogenetic Map 8 q31 NCBI
RBP2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 139,452,884 - 139,476,516 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 139,452,884 - 139,480,747 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 139,171,726 - 139,195,358 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 140,654,416 - 140,678,042 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 140,654,424 - 140,678,050 NCBI Celera 3 137,594,686 - 137,618,327 (-) NCBI Celera Cytogenetic Map 3 q23 NCBI HuRef 3 136,547,188 - 136,570,833 (-) NCBI HuRef CHM1_1 3 139,135,301 - 139,158,940 (-) NCBI CHM1_1 T2T-CHM13v2.0 3 142,200,416 - 142,224,059 (-) NCBI T2T-CHM13v2.0
Rbp2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 98,372,590 - 98,391,824 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 98,368,168 - 98,391,834 (+) Ensembl GRCm39 Ensembl GRCm38 9 98,490,537 - 98,509,771 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 98,486,115 - 98,509,781 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 98,390,956 - 98,410,190 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 98,299,905 - 98,319,089 (+) NCBI MGSCv36 mm8 Celera 9 98,036,063 - 98,055,300 (+) NCBI Celera Cytogenetic Map 9 E3.3 NCBI cM Map 9 51.37 NCBI
Rbp2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955508 6,111,168 - 6,136,010 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955508 6,111,558 - 6,135,929 (+) NCBI ChiLan1.0 ChiLan1.0
RBP2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 137,366,814 - 137,394,504 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 137,369,656 - 137,399,234 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 136,488,536 - 136,513,337 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 144,089,322 - 144,112,840 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 144,089,322 - 144,112,840 (-) Ensembl panpan1.1 panPan2
RBP2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 23 35,619,215 - 35,642,249 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 23 35,619,221 - 35,642,213 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 23 35,607,084 - 35,630,082 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 23 36,157,741 - 36,180,747 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 23 36,157,751 - 36,180,723 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 23 35,838,270 - 35,861,272 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 23 35,911,556 - 35,934,581 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 23 36,153,873 - 36,176,911 (-) NCBI UU_Cfam_GSD_1.0
Rbp2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 74,807,601 - 74,831,624 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936540 1,547,386 - 1,571,430 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936540 1,547,406 - 1,571,374 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
RBP2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 80,320,931 - 80,352,975 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 80,321,024 - 80,346,032 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 87,988,050 - 88,013,085 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
RBP2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 15 51,077,753 - 51,102,110 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 15 51,078,169 - 51,102,249 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 24,055,079 - 24,079,140 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Rbp2
.
Predicted Target Of
Count of predictions: 45 Count of miRNA genes: 40 Interacting mature miRNAs: 45 Transcripts: ENSRNOT00000018755 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300177 Cm2 Cardiac mass QTL 2 3.65 heart mass (VT:0007028) heart weight (CMO:0000017) 8 54259986 100382532 Rat 1549909 Stresp11 Stress response QTL 11 6.83 0.0019 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 8 73473045 118473045 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 9590292 Uminl3 Urine mineral level QTL 3 3.62 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 8 71888757 116888757 Rat 1578769 Uae31 Urinary albumin excretion QTL 31 3.3 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 30848154 101699754 Rat 738011 Anxrr9 Anxiety related response QTL 9 6.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 8 93535351 123900184 Rat 8693654 Alc32 Alcohol consumption QTL 32 2 0.755 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 8 88612425 107550209 Rat 1358912 Bw51 Body weight QTL 51 2.95 body mass (VT:0001259) body weight (CMO:0000012) 8 51351728 107062046 Rat 1578765 Klgr1 Kidney lesion grade QTL 1 3.3 0.0001 kidney morphology trait (VT:0002135) organ lesion measurement (CMO:0000677) 8 30848154 101699754 Rat 738014 Anxrr15 Anxiety related response QTL 15 3.6 0.005 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 8 95718998 123900184 Rat 1300171 Bp184 Blood pressure QTL 184 3.66 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 8 70513503 118219066 Rat 1578755 Pur5 Proteinuria QTL 5 3.3 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 8 30848154 101699754 Rat 2313400 Anxrr25 Anxiety related response QTL 25 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 8 89265192 114019816 Rat 2303171 Bp331 Blood pressure QTL 331 5.57 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 61290298 119084929 Rat 8662823 Vetf5 Vascular elastic tissue fragility QTL 5 1.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 8 28242912 99525068 Rat 631210 Bw3 Body weight QTL3 5.9 mesenteric fat pad mass (VT:0010427) mesenteric fat pad weight to body weight ratio (CMO:0000654) 8 69349194 112783834 Rat 1358903 Bp252 Blood pressure QTL 252 7 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 93965141 123900184 Rat 1358896 Bp262 Blood pressure QTL 262 2.89 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 27205715 99103503 Rat 1331837 Bw23 Body weight QTL 23 4.19 0.00007 body mass (VT:0001259) body weight (CMO:0000012) 8 46531722 99083736 Rat 1331838 Niddm61 Non-insulin dependent diabetes mellitus QTL 61 3.53 0.0004 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 36469535 99083736 Rat 8694446 Bw170 Body weight QTL 170 12.07 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 8 71888757 116888757 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 631653 Bp125 Blood pressure QTL 125 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 66142385 111142385 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 1358907 Cm40 Cardiac mass QTL 40 1.89 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 27205715 99103503 Rat 70197 BpQTLcluster8 Blood pressure QTL cluster 8 3.482 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 46531639 119088626 Rat 2316950 Scl66 Serum cholesterol level QTL 66 4.1 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30848259 105647037 Rat 2300182 Bmd56 Bone mineral density QTL 56 5.4 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 95718998 123900184 Rat 2300181 Bmd55 Bone mineral density QTL 55 5.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 76468691 121468691 Rat 1358892 Kidm26 Kidney mass QTL 26 3.69 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 27205715 99103503 Rat 631664 Hcar3 Hepatocarcinoma resistance QTL 3 2.9 0.0005 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 8 54237644 99103503 Rat 1358893 Bp263 Blood pressure QTL 263 5.01 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 93965141 123900184 Rat 8694200 Abfw4 Abdominal fat weight QTL 4 9.07 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 8 71888757 116888757 Rat 8694392 Bw161 Body weight QTL 161 8.06 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 8 71888757 116888757 Rat 61437 Cia6 Collagen induced arthritis QTL 6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 8 82460758 122812818 Rat
D8Mgh3
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 8 107,982,728 - 107,982,864 (+) Marker Load Pipeline mRatBN7.2 8 99,103,367 - 99,103,503 (+) MAPPER mRatBN7.2 Rnor_6.0 8 106,526,605 - 106,526,740 NCBI Rnor6.0 Rnor_5.0 8 105,968,444 - 105,968,579 UniSTS Rnor5.0 RGSC_v3.4 8 103,684,650 - 103,684,785 UniSTS RGSC3.4 RGSC_v3.4 8 103,684,649 - 103,684,785 RGD RGSC3.4 RGSC_v3.1 8 103,704,104 - 103,704,240 RGD Celera 8 98,512,833 - 98,512,971 UniSTS RH 3.4 Map 8 1051.79 RGD RH 3.4 Map 8 1051.79 UniSTS RH 2.0 Map 8 841.5 RGD SHRSP x BN Map 8 59.54 RGD FHH x ACI Map 8 69.0899 RGD Cytogenetic Map 8 q31 UniSTS
D8Wox6
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 8 107,962,975 - 107,963,099 (+) Marker Load Pipeline mRatBN7.2 8 99,083,612 - 99,083,736 (+) MAPPER mRatBN7.2 Rnor_6.0 8 106,506,850 - 106,506,973 NCBI Rnor6.0 Rnor_5.0 8 105,948,689 - 105,948,812 UniSTS Rnor5.0 RGSC_v3.4 8 103,664,894 - 103,665,018 RGD RGSC3.4 RGSC_v3.4 8 103,664,895 - 103,665,018 UniSTS RGSC3.4 RGSC_v3.1 8 103,684,349 - 103,684,473 RGD Celera 8 98,493,061 - 98,493,184 UniSTS RH 3.4 Map 8 1052.4 RGD RH 3.4 Map 8 1052.4 UniSTS RH 2.0 Map 8 834.8 RGD Cytogenetic Map 8 q31 UniSTS
D8Arb17
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 8 107,962,659 - 107,963,151 (+) Marker Load Pipeline mRatBN7.2 8 99,083,296 - 99,083,788 (+) MAPPER mRatBN7.2 Rnor_6.0 8 106,506,534 - 106,507,025 NCBI Rnor6.0 Rnor_5.0 8 105,948,373 - 105,948,864 UniSTS Rnor5.0 RGSC_v3.4 8 103,664,579 - 103,665,070 UniSTS RGSC3.4 Celera 8 98,492,745 - 98,493,236 UniSTS RH 3.4 Map 8 1052.0 UniSTS RH 3.4 Map 8 1052.0 RGD RH 2.0 Map 8 852.6 RGD SHRSP x BN Map 8 60.6299 RGD Cytogenetic Map 8 q31 UniSTS
D8Mgh15
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 8 107,970,397 - 107,970,527 (+) Marker Load Pipeline Rnor_5.0 8 105,956,109 - 105,956,241 NCBI Rnor5.0 RGSC_v3.4 8 103,672,316 - 103,672,447 RGD RGSC3.4 RGSC_v3.1 8 103,691,771 - 103,691,902 RGD Cytogenetic Map 8 q31 UniSTS
RH94395
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 8 107,962,959 - 107,963,126 (+) Marker Load Pipeline mRatBN7.2 8 99,083,596 - 99,083,763 (+) MAPPER mRatBN7.2 Rnor_6.0 8 106,506,834 - 106,507,000 NCBI Rnor6.0 Rnor_5.0 8 105,948,673 - 105,948,839 UniSTS Rnor5.0 RGSC_v3.4 8 103,664,879 - 103,665,045 UniSTS RGSC3.4 Celera 8 98,493,045 - 98,493,211 UniSTS RH 3.4 Map 8 1052.2 UniSTS Cytogenetic Map 8 q31 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
3
30
88
79
87
57
16
57
6
166
54
77
45
58
30
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000018755 ⟹ ENSRNOP00000018755
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 99,079,104 - 99,104,473 (+) Ensembl Rnor_6.0 Ensembl 8 106,503,504 - 106,527,711 (+) Ensembl
RefSeq Acc Id:
NM_012640 ⟹ NP_036772
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 107,963,542 - 107,983,850 (+) NCBI mRatBN7.2 8 99,084,179 - 99,104,489 (+) NCBI Rnor_6.0 8 106,507,416 - 106,527,726 (+) NCBI Rnor_5.0 8 105,945,338 - 105,969,565 (+) NCBI RGSC_v3.4 8 103,665,461 - 103,685,771 (+) RGD Celera 8 98,493,627 - 98,513,957 (+) RGD
Sequence:
GCAGCTTGTTCCTTCACGGTCACCAAACGTCCGCATCAAACCAGAGGCCGCCATCATGACGAAGGACCAGAATGGAACCTGGGAAATGGAGAGTAATGAGAACTTTGAAGGCTACATGAAGGCCCTAG
hide sequence
RefSeq Acc Id:
XM_006243607 ⟹ XP_006243669
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 107,958,670 - 107,983,834 (+) NCBI mRatBN7.2 8 99,079,293 - 99,104,489 (+) NCBI Rnor_6.0 8 106,503,499 - 106,527,711 (+) NCBI Rnor_5.0 8 105,945,338 - 105,969,565 (+) NCBI
Sequence:
CCTGGGCCTTTTGTTGAGCTCACTCTCAGCTGGCTGACTGATCTCAGATTCAACCTTCCACCGA
hide sequence
RefSeq Acc Id:
XM_039080832 ⟹ XP_038936760
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 107,958,670 - 107,983,834 (+) NCBI mRatBN7.2 8 99,079,293 - 99,104,489 (+) NCBI
RefSeq Acc Id:
NP_036772 ⟸ NM_012640
- UniProtKB:
P06768 (UniProtKB/Swiss-Prot), A6I2B3 (UniProtKB/TrEMBL)
- Sequence:
MTKDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKIIVQDGDNFKTKTNSTFRNYDLDFTVGVEFDEHTKGLDGRNVKTLVTWEGNTLVCVQKGEKENRGWKQWVEGDKLYLELTCGDQVCR
hide sequence
RefSeq Acc Id:
XP_006243669 ⟸ XM_006243607
- Peptide Label:
isoform X1
- UniProtKB:
P06768 (UniProtKB/Swiss-Prot), A6I2B3 (UniProtKB/TrEMBL)
- Sequence:
MTKDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKIIVQDGDNFKTKTNSTFRNYDLD
hide sequence
Ensembl Acc Id:
ENSRNOP00000018755 ⟸ ENSRNOT00000018755
RefSeq Acc Id:
XP_038936760 ⟸ XM_039080832
- Peptide Label:
isoform X1
- UniProtKB:
P06768 (UniProtKB/Swiss-Prot), A6I2B3 (UniProtKB/TrEMBL)
RGD ID: 13696203 Promoter ID: EPDNEW_R6727 Type: single initiation site Name: Rbp2_1 Description: retinol binding protein 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 106,503,475 - 106,503,535 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-12-09
Rbp2
retinol binding protein 2
Rbp2
retinol binding protein 2, cellular
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Rbp2
retinol binding protein 2, cellular
retinol-binding protein 2
Name updated
1299863 APPROVED
2002-06-10
Rbp2
retinol-binding protein 2
Name updated
70585 PROVISIONAL
Note Type
Note
Reference
gene_expression
found primarily in the enterocytes of small intestine
61054
gene_expression
found primarily in the enterocytes of small intestine
61489
gene_homology
highly conserved in rats, mice, and humans
61054
gene_homology
highly conserved in rats, mice, and humans
61489
gene_process
may play a role in the intestinal absorption and/or metabolism of vitamin A
61054
gene_process
may modulate the supply of retinoic acid to the nuclei of endometrial cells during the menstrual cycle
61054
gene_transcript
contains 4 exons that span 0.65 kb
61054
