Symbol:
Mst1
Name:
macrophage stimulating 1
RGD ID:
3114
Description:
Enables enzyme binding activity and histone kinase activity. Involved in several processes, including cellular response to hypoxia; cellular response to type II interferon; and flagellated sperm motility. Predicted to be located in vacuole. Predicted to be active in extracellular space. Orthologous to several human genes including MST1 (macrophage stimulating 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
D8h3f15s2; E2F transcription factor 2; E2F2; hepatocyte growth factor-like protein; Macrophage stimulating 1 (hepatocyte growth factor-like)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MST1 (macrophage stimulating 1) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Mst1 (macrophage stimulating 1 (hepatocyte growth factor-like)) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Mst1 (macrophage stimulating 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MST1 (macrophage stimulating 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MST1 (macrophage stimulating 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Mst1 (macrophage stimulating 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MST1 (macrophage stimulating 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MST1 (macrophage stimulating 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Mst1 (macrophage stimulating 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
MST1L (macrophage stimulating 1 like (pseudogene)) HGNC
Panther, PhylomeDB
Alliance orthologs 3
Homo sapiens (human):
MST1 (macrophage stimulating 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Mst1 (macrophage stimulating 1 (hepatocyte growth factor-like))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
MST1L (macrophage stimulating 1 like (pseudogene))
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
mst1 (macrophage stimulating 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
mst1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 117,646,485 - 117,652,016 (+) NCBI GRCr8 mRatBN7.2 8 108,767,886 - 108,773,425 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 108,768,839 - 108,773,416 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 114,395,059 - 114,399,629 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 112,594,383 - 112,598,953 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 110,437,023 - 110,441,594 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 116,857,716 - 116,862,286 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 116,857,684 - 116,862,423 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 116,211,755 - 116,216,379 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 113,348,203 - 113,352,773 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 113,367,657 - 113,372,228 (+) NCBI Celera 8 108,073,056 - 108,077,626 (+) NCBI Celera Cytogenetic Map 8 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mst1 Rat (S)-nicotine decreases expression ISO MST1 (Homo sapiens) 6480464 Nicotine results in decreased expression of MST1 mRNA CTD PMID:18247414 Mst1 Rat 1,2-dimethylhydrazine increases expression ISO Mst1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of MST1 mRNA CTD PMID:22206623 Mst1 Rat 17beta-estradiol increases expression ISO MST1 (Homo sapiens) 6480464 Estradiol results in increased expression of MST1 mRNA CTD PMID:19429434 Mst1 Rat 17beta-estradiol decreases expression ISO MST1 (Homo sapiens) 6480464 Estradiol results in decreased expression of MST1 mRNA CTD PMID:31614463 Mst1 Rat 17beta-estradiol increases expression ISO Mst1 (Mus musculus) 6480464 Estradiol results in increased expression of MST1 mRNA CTD PMID:39298647 Mst1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of MST1 mRNA CTD PMID:21215274 Mst1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO MST1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of MST1 mRNA CTD PMID:27913140 Mst1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Mst1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MST1 mRNA CTD PMID:21570461 Mst1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Mst1 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Mst1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of MST1 mRNA CTD PMID:21346803 Mst1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of MST1 mRNA CTD PMID:21346803 Mst1 Rat 2-naphthylamine decreases expression ISO MST1 (Homo sapiens) 6480464 2-Naphthylamine results in decreased expression of MST1 mRNA CTD PMID:18247414 Mst1 Rat 2-palmitoylglycerol increases expression ISO MST1 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of MST1 mRNA CTD PMID:37199045 Mst1 Rat 4,4'-diaminodiphenylmethane decreases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of MST1 mRNA CTD PMID:30723492 Mst1 Rat 4,4'-sulfonyldiphenol affects expression ISO Mst1 (Mus musculus) 6480464 bisphenol S affects the expression of MST1 mRNA CTD PMID:39298647 Mst1 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of MST1 mRNA CTD PMID:31881176 Mst1 Rat acrylamide decreases expression ISO MST1 (Homo sapiens) 6480464 Acrylamide results in decreased expression of MST1 mRNA CTD PMID:32763439 Mst1 Rat aflatoxin B1 affects expression ISO MST1 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of MST1 protein CTD PMID:20106945 Mst1 Rat aflatoxin B1 decreases expression ISO MST1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of MST1 mRNA CTD PMID:22100608 and PMID:27153756 Mst1 Rat aflatoxin B1 decreases expression ISO Mst1 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of MST1 mRNA CTD PMID:19770486 Mst1 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of MST1 mRNA CTD PMID:35163327 Mst1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of MST1 mRNA CTD PMID:16483693 Mst1 Rat arsane increases expression ISO Mst1 (Mus musculus) 6480464 Arsenic results in increased expression of MST1 protein CTD PMID:23942117 Mst1 Rat arsenic atom increases expression ISO Mst1 (Mus musculus) 6480464 Arsenic results in increased expression of MST1 protein CTD PMID:23942117 Mst1 Rat atrazine decreases expression ISO MST1 (Homo sapiens) 6480464 Atrazine results in decreased expression of MST1 mRNA CTD PMID:22378314 Mst1 Rat benzo[a]pyrene decreases expression ISO MST1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of MST1 mRNA CTD PMID:18247414 and PMID:32234424 Mst1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MST1 mRNA CTD PMID:25181051 and PMID:31129395 Mst1 Rat bisphenol A decreases expression ISO MST1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of MST1 protein CTD PMID:33376534 Mst1 Rat bisphenol A increases expression ISO Mst1 (Mus musculus) 6480464 bisphenol A results in increased expression of MST1 mRNA CTD PMID:30245210 and PMID:33221593 Mst1 Rat bisphenol A affects expression ISO MST1 (Homo sapiens) 6480464 bisphenol A affects the expression of MST1 mRNA CTD PMID:30903817 Mst1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with tributyltin] results in increased expression of MST1 mRNA CTD PMID:31129395 Mst1 Rat bisphenol A decreases methylation ISO Mst1 (Mus musculus) 6480464 bisphenol A results in decreased methylation of MST1 promoter CTD PMID:27312807 Mst1 Rat bisphenol A increases methylation ISO Mst1 (Mus musculus) 6480464 bisphenol A results in increased methylation of MST1 promoter CTD PMID:27312807 Mst1 Rat buta-1,3-diene decreases expression ISO Mst1 (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of MST1 mRNA CTD PMID:29038090 Mst1 Rat butanal decreases expression ISO MST1 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of MST1 mRNA CTD PMID:26079696 Mst1 Rat cadmium atom affects binding ISO MST1 (Homo sapiens) 6480464 MST1 protein binds to Cadmium CTD PMID:23896426 Mst1 Rat carbon nanotube decreases expression ISO Mst1 (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of MST1 mRNA CTD PMID:25554681 Mst1 Rat CGP 52608 multiple interactions ISO MST1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to MST1 gene] CTD PMID:28238834 Mst1 Rat chlorpromazine increases phosphorylation ISO MST1 (Homo sapiens) 6480464 Chlorpromazine results in increased phosphorylation of MST1 protein CTD PMID:30703373 Mst1 Rat chlorpyrifos increases expression ISO Mst1 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of MST1 mRNA CTD PMID:32715474 Mst1 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of MST1 mRNA CTD PMID:24386269 Mst1 Rat copper(II) sulfate decreases expression ISO MST1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of MST1 mRNA CTD PMID:19549813 Mst1 Rat cyclosporin A affects expression ISO MST1 (Homo sapiens) 6480464 Cyclosporine affects the expression of MST1 mRNA CTD PMID:20106945 Mst1 Rat cyclosporin A increases expression ISO MST1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of MST1 mRNA CTD PMID:21632981 more ... Mst1 Rat dioxygen increases expression ISO MST1 (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of MST1 mRNA CTD PMID:26516004 Mst1 Rat disulfiram increases expression ISO MST1 (Homo sapiens) 6480464 Disulfiram results in increased expression of MST1 mRNA CTD PMID:34182011 Mst1 Rat entinostat increases expression ISO MST1 (Homo sapiens) 6480464 entinostat results in increased expression of MST1 mRNA CTD PMID:27188386 Mst1 Rat ethanol increases expression ISO Mst1 (Mus musculus) 6480464 Ethanol results in increased expression of MST1 mRNA CTD PMID:30319688 Mst1 Rat Evodiamine increases expression ISO MST1 (Homo sapiens) 6480464 evodiamine results in increased expression of MST1 mRNA and evodiamine results in increased expression of MST1 protein CTD PMID:32057900 Mst1 Rat Evodiamine multiple interactions ISO MST1 (Homo sapiens) 6480464 XMU-MP-1 inhibits the reaction [evodiamine results in increased expression of MST1 mRNA] and XMU-MP-1 inhibits the reaction [evodiamine results in increased expression of MST1 protein] CTD PMID:32057900 Mst1 Rat furan increases methylation EXP 6480464 furan results in increased methylation of MST1 gene CTD PMID:22079235 Mst1 Rat furan decreases expression EXP 6480464 furan results in decreased expression of MST1 mRNA CTD PMID:25539665 and PMID:26194646 Mst1 Rat L-ascorbic acid multiple interactions ISO MST1 (Homo sapiens) 6480464 [Quercetin co-treated with Ascorbic Acid] results in decreased expression of MST1 mRNA CTD PMID:17639512 Mst1 Rat lipopolysaccharide decreases metabolic processing ISO Mst1 (Mus musculus) 6480464 Lipopolysaccharides results in decreased metabolism of MST1 protein CTD PMID:20453108 Mst1 Rat N-methyl-N'-nitro-N-nitrosoguanidine increases expression EXP 6480464 Methylnitronitrosoguanidine results in increased expression of MST1 mRNA CTD PMID:15120970 Mst1 Rat N-Nitrosopyrrolidine decreases expression ISO MST1 (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in decreased expression of MST1 mRNA CTD PMID:32234424 Mst1 Rat nickel atom decreases expression ISO MST1 (Homo sapiens) 6480464 Nickel results in decreased expression of MST1 mRNA CTD PMID:24768652 and PMID:25583101 Mst1 Rat nicotine decreases expression ISO MST1 (Homo sapiens) 6480464 Nicotine results in decreased expression of MST1 mRNA CTD PMID:18247414 Mst1 Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of MST1 mRNA CTD PMID:33484710 Mst1 Rat O-methyleugenol decreases expression ISO MST1 (Homo sapiens) 6480464 methyleugenol results in decreased expression of MST1 mRNA CTD PMID:32234424 Mst1 Rat paracetamol decreases expression ISO MST1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of MST1 mRNA CTD PMID:29067470 Mst1 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of MST1 mRNA CTD PMID:32680482 Mst1 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of MST1 mRNA CTD PMID:35163327 Mst1 Rat prothioconazole increases expression ISO MST1 (Homo sapiens) 6480464 prothioconazole results in increased expression of MST1 mRNA CTD PMID:35048155 Mst1 Rat quercetin multiple interactions ISO MST1 (Homo sapiens) 6480464 [Quercetin co-treated with Ascorbic Acid] results in decreased expression of MST1 mRNA CTD PMID:17639512 Mst1 Rat raloxifene increases expression ISO MST1 (Homo sapiens) 6480464 Raloxifene Hydrochloride results in increased expression of MST1 mRNA CTD PMID:19429434 Mst1 Rat silicon dioxide decreases expression ISO MST1 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of MST1 mRNA CTD PMID:25895662 Mst1 Rat silver atom increases expression ISO Mst1 (Mus musculus) 6480464 Silver results in increased expression of MST1 mRNA CTD PMID:27131904 Mst1 Rat silver(0) increases expression ISO Mst1 (Mus musculus) 6480464 Silver results in increased expression of MST1 mRNA CTD PMID:27131904 Mst1 Rat sodium arsenite decreases expression ISO MST1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of MST1 mRNA CTD PMID:29301061 Mst1 Rat sodium arsenite decreases expression ISO Mst1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of MST1 mRNA CTD PMID:37682722 Mst1 Rat sodium dichromate affects expression EXP 6480464 sodium bichromate affects the expression of MST1 mRNA CTD PMID:22110744 Mst1 Rat sulforaphane increases expression ISO Mst1 (Mus musculus) 6480464 sulforaphane results in increased expression of MST1 mRNA CTD PMID:30529165 Mst1 Rat tamoxifen increases expression ISO MST1 (Homo sapiens) 6480464 Tamoxifen results in increased expression of MST1 mRNA CTD PMID:19429434 Mst1 Rat tetrachloromethane affects expression EXP 6480464 Carbon Tetrachloride affects the expression of MST1 mRNA CTD PMID:12734012 Mst1 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of MST1 mRNA CTD PMID:8074719 Mst1 Rat thapsigargin increases expression ISO MST1 (Homo sapiens) 6480464 Thapsigargin results in increased expression of MST1 mRNA CTD PMID:22378314 Mst1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of MST1 mRNA CTD PMID:34492290 Mst1 Rat titanium dioxide affects expression ISO Mst1 (Mus musculus) 6480464 titanium dioxide affects the expression of MST1 mRNA CTD PMID:23557971 Mst1 Rat tributylstannane multiple interactions EXP 6480464 [bisphenol A co-treated with tributyltin] results in increased expression of MST1 mRNA CTD PMID:31129395 Mst1 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of MST1 mRNA CTD PMID:33387578 Mst1 Rat valproic acid decreases expression ISO MST1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of MST1 mRNA CTD PMID:29154799 Mst1 Rat valproic acid increases methylation ISO MST1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of MST1 gene CTD PMID:29154799 Mst1 Rat vinclozolin increases expression ISO Mst1 (Mus musculus) 6480464 vinclozolin results in increased expression of MST1 mRNA CTD PMID:34182078 Mst1 Rat XMU-MP-1 decreases expression ISO MST1 (Homo sapiens) 6480464 XMU-MP-1 results in decreased expression of MST1 mRNA and XMU-MP-1 results in decreased expression of MST1 protein CTD PMID:32057900 Mst1 Rat XMU-MP-1 multiple interactions ISO MST1 (Homo sapiens) 6480464 XMU-MP-1 inhibits the reaction [evodiamine results in increased expression of MST1 mRNA] and XMU-MP-1 inhibits the reaction [evodiamine results in increased expression of MST1 protein] CTD PMID:32057900 Mst1 Rat zinc sulfate decreases expression ISO MST1 (Homo sapiens) 6480464 Zinc Sulfate results in decreased expression of MST1 mRNA CTD PMID:16330358
(S)-nicotine (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 2-naphthylamine (ISO) 2-palmitoylglycerol (ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) acetamide (EXP) acrylamide (ISO) aflatoxin B1 (ISO) alpha-Zearalanol (EXP) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) atrazine (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) buta-1,3-diene (ISO) butanal (ISO) cadmium atom (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlorpromazine (ISO) chlorpyrifos (ISO) cobalt dichloride (EXP) copper(II) sulfate (ISO) cyclosporin A (ISO) dioxygen (ISO) disulfiram (ISO) entinostat (ISO) ethanol (ISO) Evodiamine (ISO) furan (EXP) L-ascorbic acid (ISO) lipopolysaccharide (ISO) N-methyl-N'-nitro-N-nitrosoguanidine (EXP) N-Nitrosopyrrolidine (ISO) nickel atom (ISO) nicotine (ISO) nitrofen (EXP) O-methyleugenol (ISO) paracetamol (ISO) paraquat (EXP) perfluorooctanoic acid (EXP) prothioconazole (ISO) quercetin (ISO) raloxifene (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sodium dichromate (EXP) sulforaphane (ISO) tamoxifen (ISO) tetrachloromethane (EXP) thapsigargin (ISO) thioacetamide (EXP) titanium dioxide (ISO) tributylstannane (EXP) trichloroethene (EXP) valproic acid (ISO) vinclozolin (ISO) XMU-MP-1 (ISO) zinc sulfate (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
3.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
4.
Molecular cloning of rat macrophage-stimulating protein and its involvement in the male reproductive system.
Ohshiro K, etal., Biochem Biophys Res Commun 1996 Oct 3;227(1):273-80.
5.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
6.
GOA pipeline
RGD automated data pipeline
7.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
9.
Protein-L-isoaspartate (D-aspartate) O-methyltransferase protects cardiomyocytes against hypoxia induced apoptosis through inhibiting proapoptotic kinase Mst1.
Yan G, etal., Int J Cardiol. 2013 Oct 9;168(4):3291-9. doi: 10.1016/j.ijcard.2013.04.045. Epub 2013 May 3.
10.
Daxx mediates activation-induced cell death in microglia by triggering MST1 signalling.
Yun HJ, etal., EMBO J. 2011 May 13;30(12):2465-76. doi: 10.1038/emboj.2011.152.
Mst1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 117,646,485 - 117,652,016 (+) NCBI GRCr8 mRatBN7.2 8 108,767,886 - 108,773,425 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 108,768,839 - 108,773,416 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 114,395,059 - 114,399,629 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 112,594,383 - 112,598,953 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 110,437,023 - 110,441,594 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 116,857,716 - 116,862,286 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 116,857,684 - 116,862,423 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 116,211,755 - 116,216,379 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 113,348,203 - 113,352,773 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 113,367,657 - 113,372,228 (+) NCBI Celera 8 108,073,056 - 108,077,626 (+) NCBI Celera Cytogenetic Map 8 q32 NCBI
MST1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 49,683,947 - 49,689,474 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 49,683,947 - 49,689,501 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 49,721,380 - 49,726,907 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 49,696,391 - 49,701,099 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 49,696,391 - 49,701,099 NCBI Celera 3 49,686,072 - 49,690,887 (-) NCBI Celera Cytogenetic Map 3 p21.31 NCBI HuRef 3 49,780,360 - 49,785,175 (-) NCBI HuRef CHM1_1 3 49,673,436 - 49,678,251 (-) NCBI CHM1_1 T2T-CHM13v2.0 3 49,713,231 - 49,718,759 (-) NCBI T2T-CHM13v2.0
Mst1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 107,957,607 - 107,962,226 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 107,957,635 - 107,962,202 (+) Ensembl GRCm39 Ensembl GRCm38 9 108,080,409 - 108,085,027 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 108,080,436 - 108,085,003 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 107,982,767 - 107,987,358 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 107,938,552 - 107,943,099 (+) NCBI MGSCv36 mm8 Celera 9 107,690,205 - 107,694,796 (+) NCBI Celera Cytogenetic Map 9 F1 NCBI cM Map 9 59.07 NCBI
Mst1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955532 1,590,755 - 1,595,148 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955532 1,590,685 - 1,595,655 (-) NCBI ChiLan1.0 ChiLan1.0
MST1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 49,670,785 - 49,676,364 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 49,675,558 - 49,681,137 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 49,616,339 - 49,621,749 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 50,855,283 - 50,856,052 (-) NCBI panpan1.1 PanPan1.1 panPan2
MST1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 39,582,237 - 39,586,958 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 39,582,282 - 39,586,908 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 39,503,160 - 39,507,883 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 39,939,767 - 39,944,483 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 39,938,823 - 39,944,461 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 39,306,836 - 39,311,565 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 39,710,205 - 39,714,921 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 39,990,036 - 39,994,752 (+) NCBI UU_Cfam_GSD_1.0
Mst1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 64,538,735 - 64,545,696 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936529 1,299,300 - 1,303,959 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936529 1,298,853 - 1,306,088 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MST1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 32,214,937 - 32,219,902 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 32,214,934 - 32,220,045 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 35,394,134 - 35,399,843 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MST1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 22 11,078,662 - 11,083,885 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 22 11,074,114 - 11,083,368 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 155,916,564 - 155,921,896 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mst1
.
Predicted Target Of
Count of predictions: 47 Count of miRNA genes: 45 Interacting mature miRNAs: 45 Transcripts: ENSRNOT00000026711 Prediction methods: Microtar, Rnahybrid Result types: miRGate_prediction
2303171 Bp331 Blood pressure QTL 331 5.57 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 61290298 119084929 Rat 1549909 Stresp11 Stress response QTL 11 6.83 0.0019 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 8 73473045 118473045 Rat 631210 Bw3 Body weight QTL3 5.9 mesenteric fat pad mass (VT:0010427) mesenteric fat pad weight to body weight ratio (CMO:0000654) 8 69349194 112783834 Rat 1358903 Bp252 Blood pressure QTL 252 7 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 93965141 123900184 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 9590292 Uminl3 Urine mineral level QTL 3 3.62 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 8 71888757 116888757 Rat 8694446 Bw170 Body weight QTL 170 12.07 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 8 71888757 116888757 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 631653 Bp125 Blood pressure QTL 125 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 66142385 111142385 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 738011 Anxrr9 Anxiety related response QTL 9 6.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 8 93535351 123900184 Rat 724539 Cm19 Cardiac mass QTL 19 2.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 8 100149864 120994388 Rat 70197 BpQTLcluster8 Blood pressure QTL cluster 8 3.482 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 46531639 119088626 Rat 738014 Anxrr15 Anxiety related response QTL 15 3.6 0.005 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 8 95718998 123900184 Rat 2300182 Bmd56 Bone mineral density QTL 56 5.4 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 95718998 123900184 Rat 2300181 Bmd55 Bone mineral density QTL 55 5.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 76468691 121468691 Rat 1300171 Bp184 Blood pressure QTL 184 3.66 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 8 70513503 118219066 Rat 631217 Activ1 Activity QTL 1 15.9 voluntary movement trait (VT:0003491) number of photobeam interruptions in an experimental apparatus (CMO:0001517) 8 102370617 108923645 Rat 1358893 Bp263 Blood pressure QTL 263 5.01 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 93965141 123900184 Rat 2313400 Anxrr25 Anxiety related response QTL 25 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 8 89265192 114019816 Rat 8694200 Abfw4 Abdominal fat weight QTL 4 9.07 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 8 71888757 116888757 Rat 8694392 Bw161 Body weight QTL 161 8.06 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 8 71888757 116888757 Rat 61437 Cia6 Collagen induced arthritis QTL 6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 8 82460758 122812818 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
47
82
91
90
59
25
59
6
214
95
62
43
59
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000026711 ⟹ ENSRNOP00000026711
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 108,768,839 - 108,773,416 (+) Ensembl Rnor_6.0 Ensembl 8 116,857,684 - 116,862,423 (+) Ensembl
RefSeq Acc Id:
NM_024352 ⟹ NP_077328
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 117,647,442 - 117,652,012 (+) NCBI mRatBN7.2 8 108,768,843 - 108,773,413 (+) NCBI Rnor_6.0 8 116,857,716 - 116,862,286 (+) NCBI Rnor_5.0 8 116,211,755 - 116,216,379 (+) NCBI RGSC_v3.4 8 113,348,203 - 113,352,773 (+) RGD Celera 8 108,073,056 - 108,077,626 (+) RGD
Sequence:
CAGCTTAGGAGAATGGGGTGGCTCCCACTACTGCTGCTTCTGGCACAGTGTTCAAGGGCTCTTGGGCAGCGCTCACCGCTGAATGACTTCCAGCTGCTTCGGGGCACAGAGTTAAGGAACCTGCTACA
hide sequence
RefSeq Acc Id:
XM_039080801 ⟹ XP_038936729
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 117,646,929 - 117,652,016 (+) NCBI mRatBN7.2 8 108,768,326 - 108,773,425 (+) NCBI
RefSeq Acc Id:
XM_039080802 ⟹ XP_038936730
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 117,646,485 - 117,652,016 (+) NCBI mRatBN7.2 8 108,767,886 - 108,773,425 (+) NCBI
RefSeq Acc Id:
NP_077328 ⟸ NM_024352
- Peptide Label:
precursor
- UniProtKB:
P70521 (UniProtKB/TrEMBL), Q5EBC6 (UniProtKB/TrEMBL), F7FMS0 (UniProtKB/TrEMBL)
- Sequence:
MGWLPLLLLLAQCSRALGQRSPLNDFQLLRGTELRNLLHPVVPGPWQEDVADAEECARRCGPLLDCRAFHYNMSSHGCQLLPWTQHSLRAQLHHSSLCDLFQKKDYVRTCIMDNGASYRGTVARTADG
hide sequence
Ensembl Acc Id:
ENSRNOP00000026711 ⟸ ENSRNOT00000026711
RefSeq Acc Id:
XP_038936730 ⟸ XM_039080802
- Peptide Label:
isoform X2
- UniProtKB:
F7FMS0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038936729 ⟸ XM_039080801
- Peptide Label:
isoform X1
- UniProtKB:
F7FMS0 (UniProtKB/TrEMBL)
RGD ID: 13696289 Promoter ID: EPDNEW_R6814 Type: multiple initiation site Name: Mst1_1 Description: macrophage stimulating 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 116,857,703 - 116,857,763 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-03-04
Mst1
macrophage stimulating 1
Mst1
Macrophage stimulating 1 (hepatocyte growth factor-like)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Mst1
Macrophage stimulating 1 (hepatocyte growth factor-like)
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_expression
mRNA expressed in spermatogonia and spermatocytes in the testis and the epithelium lining the lumen of the epididymis
633226
gene_product
member of the hepatocyte growth factor family
633226
