Symbol:
Mc5r
Name:
melanocortin 5 receptor
RGD ID:
3058
Description:
Enables hormone binding activity and melanocortin receptor activity. Predicted to be involved in adenylate cyclase-activating G protein-coupled receptor signaling pathway and regulation of metabolic process. Predicted to be active in cytoplasm and plasma membrane. Orthologous to human MC5R (melanocortin 5 receptor); PARTICIPATES IN G protein mediated signaling pathway via Galphas family; melanocortin system pathway; INTERACTS WITH 1,2-dimethylhydrazine; 2,3,7,8-tetrachlorodibenzodioxine; alpha-Zearalanol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
MC5-R; melanocortin receptor 5
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MC5R (melanocortin 5 receptor) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Mc5r (melanocortin 5 receptor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Mc5r (melanocortin 5 receptor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MC5R (melanocortin 5 receptor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MC5R (melanocortin 5 receptor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Mc5r (melanocortin 5 receptor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MC5R (melanocortin 5 receptor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MC5R (melanocortin 5 receptor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Mc5r (melanocortin 5 receptor)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
MC5R (melanocortin 5 receptor)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
mc5ra (melanocortin 5a receptor)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
mc5rb (melanocortin 5b receptor)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
mc5r
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 64,185,013 - 64,190,054 (+) NCBI GRCr8 mRatBN7.2 18 61,915,188 - 61,920,229 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 61,915,188 - 61,920,229 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 18 63,990,228 - 63,995,268 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 18 64,695,178 - 64,700,218 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 18 62,539,890 - 62,544,930 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 18 64,113,659 - 64,118,700 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 64,114,933 - 64,116,524 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 63,329,399 - 63,330,432 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 64,679,384 - 64,680,417 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 18 64,752,231 - 64,753,823 (-) NCBI Celera 18 60,019,520 - 60,020,553 (+) NCBI Celera RH 3.4 Map 18 628.5 RGD RH 3.4 Map 18 628.4 RGD Cytogenetic Map 18 q12.1 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
1.
Binding of alpha-melanocyte-stimulating hormone to its G-protein-coupled receptor on B-lymphocytes activates the Jak/STAT pathway.
Buggy JJ Biochem J. 1998 Apr 1;331 ( Pt 1):211-6.
2.
The melanocortin system in control of inflammation.
Catania A, etal., ScientificWorldJournal. 2010 Sep 14;10:1840-53.
3.
Linkage and association studies between the melanocortin receptors 4 and 5 genes and obesity-related phenotypes in the Quebec Family Study.
Chagnon YC, etal., Mol Med. 1997 Oct;3(10):663-73.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
6.
Molecular cloning and characterization of the rat fifth melanocortin receptor.
Griffon N, etal., Biochem Biophys Res Commun 1994 Apr 29;200(2):1007-14.
7.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
8.
Melanocortin receptors in rat liver cells: change of gene expression and intracellular localization during acute-phase response.
Malik IA, etal., Histochem Cell Biol. 2012 Mar;137(3):279-91. Epub 2011 Dec 20.
9.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
10.
Evidence for a stimulatory action of melanin-concentrating hormone on luteinising hormone release involving MCH1 and melanocortin-5 receptors.
Murray JF, etal., J Neuroendocrinol. 2006 Mar;18(3):157-67.
11.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.
GOA pipeline
RGD automated data pipeline
13.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Mc5r Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 64,185,013 - 64,190,054 (+) NCBI GRCr8 mRatBN7.2 18 61,915,188 - 61,920,229 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 61,915,188 - 61,920,229 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 18 63,990,228 - 63,995,268 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 18 64,695,178 - 64,700,218 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 18 62,539,890 - 62,544,930 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 18 64,113,659 - 64,118,700 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 64,114,933 - 64,116,524 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 63,329,399 - 63,330,432 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 64,679,384 - 64,680,417 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 18 64,752,231 - 64,753,823 (-) NCBI Celera 18 60,019,520 - 60,020,553 (+) NCBI Celera RH 3.4 Map 18 628.5 RGD RH 3.4 Map 18 628.4 RGD Cytogenetic Map 18 q12.1 NCBI
MC5R Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 18 13,824,149 - 13,827,323 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 18 13,824,149 - 13,827,323 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 18 13,824,148 - 13,827,322 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 18 13,815,765 - 13,816,742 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 18 13,815,764 - 13,816,742 NCBI Celera 18 13,706,729 - 13,708,047 (+) NCBI Celera Cytogenetic Map 18 p11.21 NCBI HuRef 18 13,778,780 - 13,780,099 (+) NCBI HuRef CHM1_1 18 13,824,630 - 13,825,948 (+) NCBI CHM1_1 T2T-CHM13v2.0 18 13,986,528 - 13,989,701 (+) NCBI T2T-CHM13v2.0
Mc5r Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 18 68,469,811 - 68,475,517 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 18 68,470,575 - 68,475,517 (+) Ensembl GRCm39 Ensembl GRCm38 18 68,336,744 - 68,342,446 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 18 68,337,596 - 68,342,446 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 18 68,497,257 - 68,499,365 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 18 68,462,972 - 68,465,092 (+) NCBI MGSCv36 mm8 Celera 18 69,645,563 - 69,647,671 (+) NCBI Celera Cytogenetic Map 18 E2 NCBI cM Map 18 41.46 NCBI
Mc5r Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955402 283,388 - 286,884 (-) NCBI ChiLan1.0 ChiLan1.0
MC5R Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 17 24,217,275 - 24,222,385 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 18 9,907,321 - 9,914,981 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 18 495,561 - 501,555 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 18 2,668,281 - 2,669,586 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 18 2,668,394 - 2,669,371 (-) Ensembl panpan1.1 panPan2
MC5R Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 24,429,331 - 24,433,212 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 25,410,285 - 25,414,162 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 24,326,030 - 24,331,495 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 24,328,811 - 24,329,788 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 24,381,249 - 24,385,125 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 24,267,632 - 24,271,507 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 24,538,879 - 24,544,347 (-) NCBI UU_Cfam_GSD_1.0
Mc5r Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404944 3,972,966 - 3,976,952 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936626 3,202,346 - 3,204,477 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936626 3,203,437 - 3,204,743 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MC5R Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 96,322,422 - 96,323,339 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 96,322,276 - 96,323,795 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 89,672,688 - 89,674,974 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MC5R Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 18 72,263,016 - 72,268,436 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 18 72,264,815 - 72,265,792 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666050 47,330,875 - 47,334,183 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
.
Predicted Target Of
Count of predictions: 124 Count of miRNA genes: 103 Interacting mature miRNAs: 110 Transcripts: ENSRNOT00000022364 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331733 Bp233 Blood pressure QTL 233 3.97196 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 24796977 79788953 Rat 1331741 Bp232 Blood pressure QTL 232 3.59112 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 21372893 83213037 Rat 1298072 Cia26 Collagen induced arthritis QTL 26 3.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 18 54709769 83828827 Rat 1300125 Rf26 Renal function QTL 26 3.2 urine potassium amount (VT:0010539) urine potassium excretion rate (CMO:0000761) 18 52539863 65844950 Rat 631834 Sach3 Saccharin preference QTL 3 3.9 0.01 consumption behavior trait (VT:0002069) calculated saccharin drink intake volume (CMO:0001600) 18 58805687 63636873 Rat 6893683 Bw110 Body weight QTL 110 2.7 0.002 body mass (VT:0001259) body weight (CMO:0000012) 18 43345022 83828827 Rat 9589041 Epfw12 Epididymal fat weight QTL 12 17.08 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 18 46640675 83828827 Rat 8694432 Bw165 Body weight QTL 165 3.81 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 18 46640675 83828827 Rat 70185 BpQTLcluster15 Blood pressure QTL cluster 15 4.61 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 18 59712417 76477814 Rat 9589816 Gluco68 Glucose level QTL 68 7.25 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 18 29792965 74792965 Rat 1331770 Bp234 Blood pressure QTL 234 3.807 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 59796478 71893566 Rat 2300177 Bmd65 Bone mineral density QTL 65 19.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 18 28964853 73964853 Rat 2301969 Bp324 Blood pressure QTL 324 4.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 59712417 76477814 Rat 1578667 Bss21 Bone structure and strength QTL 21 3.5 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 18 11791518 83218561 Rat 2303120 Mamtr8 Mammary tumor resistance QTL 8 0.001 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 18 31359408 83218561 Rat 12880368 Bw187 Body weight QTL 187 0.045 body mass (VT:0001259) body weight (CMO:0000012) 18 52539763 76104388 Rat 724542 Kidm2 Kidney mass QTL 2 2.6 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 18 59172115 83828827 Rat 61367 Iddm4 Insulin dependent diabetes mellitus QTL 4 2.33 0.0074 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 18 38192455 83192455 Rat 2293658 Bmd23 Bone mineral density QTL 23 7.3 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 18 51464733 63636873 Rat 1359020 Ppulsi2 Prepulse inhibition QTL 2 2.71 prepulse inhibition trait (VT:0003088) acoustic startle response measurement (CMO:0001519) 18 52292875 73997283 Rat 2312600 Bp341 Blood pressure QTL 341 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 59330409 70263868 Rat 9590318 Scort22 Serum corticosterone level QTL 22 7.64 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 18 29792965 74792965 Rat 1331752 Bw27 Body weight QTL 27 2.963 body mass (VT:0001259) body weight (CMO:0000012) 18 52292875 65845095 Rat 1578661 Bss20 Bone structure and strength QTL 20 3.7 femur morphology trait (VT:0000559) femoral neck cross-sectional area (CMO:0001697) 18 11791518 83218561 Rat 1331754 Bp230 Blood pressure QTL 230 4.61609 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 29792965 74792965 Rat 12904069 Cm123 Cardiac mass QTL 123 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 18 52539763 76104388 Rat 12904070 Cm124 Cardiac mass QTL 124 0.01 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 18 52539763 76104388 Rat 2303584 Gluco55 Glucose level QTL 55 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 18 48520044 83828827 Rat 12904071 Am18 Aortic mass QTL 18 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 18 52539763 76104388 Rat 12904067 Cm122 Cardiac mass QTL 122 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 18 52539763 76104388 Rat 61384 Bp48 Blood pressure QTL 48 19.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 60622311 77209844 Rat 2301417 Bp319 Blood pressure QTL 319 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 52539763 76104388 Rat 12904073 Kidm71 Kidney mass QTL 71 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 18 52539763 76104388 Rat 6903353 Bp353 Blood pressure QTL 353 2.8 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 59796478 83828827 Rat 738008 Hcar14 Hepatocarcinoma resistance QTL 14 4.3 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion number (CMO:0001462) 18 51464733 83218561 Rat 6903356 Bp354 Blood pressure QTL 354 4.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 59796478 83828827 Rat 631518 Bw11 Body weight QTL 11 2.8 body mass (VT:0001259) body weight (CMO:0000012) 18 35870723 80870723 Rat 8694366 Abfw8 Abdominal fat weight QTL 8 6.38 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 18 46640675 83828827 Rat 631509 Sald2 Serum aldosterone level QTL 2 2.9 blood aldosterone amount (VT:0005346) serum aldosterone level (CMO:0000487) 18 52539763 69140759 Rat 2300157 Bmd66 Bone mineral density QTL 66 13.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 18 28964853 73964853 Rat 738005 Anxrr11 Anxiety related response QTL 11 3.4 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 18 30039813 75039813 Rat 631274 Sprol1 Serum protein level QTL 1 5.3 blood total protein amount (VT:0005567) serum total protein level (CMO:0000661) 18 31393320 77209694 Rat 1358193 Emca2 Estrogen-induced mammary cancer QTL 2 1.6 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 18 18007599 63571040 Rat 2293704 Bss35 Bone structure and strength QTL 35 4.59 0.0002 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 18 28964853 73964853 Rat 2325839 Bp348 Blood pressure QTL 348 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 25570985 70570985 Rat 1600373 Mamtr6 Mammary tumor resistance QTL 6 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 18 19278901 83218561 Rat 2293708 Bss46 Bone structure and strength QTL 46 8.8 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 18 11791518 63636873 Rat 8694378 Bw157 Body weight QTL 157 3.59 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 18 29792965 74792965 Rat 1600375 Mcs22 Mammary carcinoma susceptibility QTL 22 3.3 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 18 52539763 63933058 Rat 2303571 Bw92 Body weight QTL 92 3 body mass (VT:0001259) body weight (CMO:0000012) 18 48520044 83828827 Rat 1598826 Anxrr20 Anxiety related response QTL 20 3.04 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 18 41432971 83828827 Rat 631675 Iddm15 Insulin dependent diabetes mellitus QTL 15 urine glucose amount (VT:0001758) percentage of study population developing diabetes mellitus during a period of time (CMO:0001114) 18 60622311 77209844 Rat 61429 Cia17 Collagen induced arthritis QTL 17 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 18 31359408 70263868 Rat 7411719 Strs5 Sensitivity to stroke QTL 5 9.4 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 18 49999958 65845095 Rat
RH142200
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 61,916,479 - 61,916,660 (+) MAPPER mRatBN7.2 Rnor_6.0 18 64,114,951 - 64,115,131 NCBI Rnor6.0 Rnor_5.0 18 63,329,212 - 63,329,392 UniSTS Rnor5.0 RGSC_v3.4 18 64,680,424 - 64,680,604 UniSTS RGSC3.4 Celera 18 60,019,333 - 60,019,513 UniSTS RH 3.4 Map 18 628.5 UniSTS Cytogenetic Map 18 q12.1 UniSTS
RH94550
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 61,917,854 - 61,918,026 (+) MAPPER mRatBN7.2 Rnor_6.0 18 64,116,326 - 64,116,497 NCBI Rnor6.0 Rnor_5.0 18 63,330,587 - 63,330,758 UniSTS Rnor5.0 RGSC_v3.4 18 64,679,058 - 64,679,229 UniSTS RGSC3.4 Celera 18 60,020,708 - 60,020,879 UniSTS Cytogenetic Map 18 q12.1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
6
11
8
69
63
62
33
18
33
6
101
49
49
5
38
29
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000022364 ⟹ ENSRNOP00000022364
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 61,915,188 - 61,920,229 (+) Ensembl Rnor_6.0 Ensembl 18 64,114,933 - 64,116,524 (+) Ensembl
RefSeq Acc Id:
NM_013182 ⟹ NP_037314
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 64,185,013 - 64,190,054 (+) NCBI mRatBN7.2 18 61,915,188 - 61,920,229 (+) NCBI Rnor_6.0 18 64,115,138 - 64,116,171 (+) NCBI Rnor_5.0 18 63,329,399 - 63,330,432 (+) NCBI RGSC_v3.4 18 64,679,384 - 64,680,417 (-) RGD Celera 18 60,019,520 - 60,020,553 (+) RGD
Sequence:
TAAGTTTGAGGCCAAGAAGTGGAGGCATTTTCTTCCAGCGATGAACTCCTCGTCTCACCTGACTTTATTGGATCTTACCCTGAACGCCTCGGAGGACAACATCCTAGGACAAAATGTCAATAACAAGT
hide sequence
RefSeq Acc Id:
NP_037314 ⟸ NM_013182
- UniProtKB:
P35345 (UniProtKB/Swiss-Prot), A6IXX6 (UniProtKB/TrEMBL)
- Sequence:
MNSSSHLTLLDLTLNASEDNILGQNVNNKSSACEDMGIAVEVFLTLGLVSLLENILVIGAIVKNKNLHSPMYFFVGSLAVADMLVSMSNAWETITIYLINNKHVVIADTFVRHIDNVFDSMICISVVA
hide sequence
Ensembl Acc Id:
ENSRNOP00000022364 ⟸ ENSRNOT00000022364
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Mc5r
Melanocortin 5 receptor
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_process
causes an increase in cAMP accumulation
729030
gene_protein
325 amino acids
729030
