Symbol:
Man2b1
Name:
mannosidase, alpha, class 2B, member 1
RGD ID:
3039
Description:
Enables D-mannose binding activity and alpha-mannosidase activity. Predicted to be involved in oligosaccharide catabolic process and protein modification process. Predicted to act upstream of or within learning or memory and mannose metabolic process. Predicted to be located in extracellular space and nucleoplasm. Predicted to be active in lysosomal lumen. Human ortholog(s) of this gene implicated in alpha-mannosidosis. Orthologous to human MAN2B1 (mannosidase alpha class 2B member 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
lysosomal alpha-mannosidase; Manb; mannosidase 2, alpha B1; Mannosidase alpha B lysosomal; Mannosidase, alpha B, lysosomal; MGC72561; similar to mannosidase 2, alpha B1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MAN2B1 (mannosidase alpha class 2B member 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Man2b1 (mannosidase 2, alpha B1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Man2b1 (mannosidase alpha class 2B member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MAN2B1 (mannosidase alpha class 2B member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MAN2B1 (mannosidase alpha class 2B member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Man2b1 (mannosidase alpha class 2B member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MAN2B1 (mannosidase alpha class 2B member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MAN2B1 (mannosidase alpha class 2B member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Man2b1 (mannosidase alpha class 2B member 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
MAN2B1 (mannosidase alpha class 2B member 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Man2b1 (mannosidase 2, alpha B1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
man2b1 (mannosidase, alpha, class 2B, member 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
aman-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
LManI
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
LManII
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
LManIII
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
LManIV
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
LManV
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
LManVI
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
man2b1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 39,959,964 - 39,979,299 (-) NCBI GRCr8 mRatBN7.2 19 23,055,092 - 23,074,398 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 23,055,097 - 23,074,389 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 29,877,660 - 29,896,989 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 30,532,022 - 30,551,353 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 32,754,699 - 32,774,034 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 26,196,797 - 26,216,981 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 26,196,837 - 26,216,267 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 37,172,434 - 37,191,891 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 24,711,378 - 24,730,659 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 24,716,204 - 24,735,485 (-) NCBI Celera 19 22,613,060 - 22,632,343 (-) NCBI Celera Cytogenetic Map 19 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Man2b1 Rat 17beta-estradiol increases expression ISO Man2b1 (Mus musculus) 6480464 Estradiol results in increased expression of MAN2B1 mRNA CTD PMID:15289156 Man2b1 Rat 17beta-estradiol affects expression ISO Man2b1 (Mus musculus) 6480464 Estradiol affects the expression of MAN2B1 mRNA CTD PMID:15598610 Man2b1 Rat 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions ISO Man2b1 (Mus musculus) 6480464 [Flame Retardants results in increased abundance of 2 more ... CTD PMID:38995820 Man2b1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Man2b1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin binds to AHR protein] which results in increased expression of MAN2B1 mRNA CTD PMID:16214954 Man2b1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of MAN2B1 mRNA CTD PMID:34747641 Man2b1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Man2b1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MAN2B1 mRNA CTD PMID:21570461 Man2b1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of MAN2B1 mRNA CTD PMID:21346803 Man2b1 Rat 4,4'-sulfonyldiphenol decreases expression ISO Man2b1 (Mus musculus) 6480464 bisphenol S results in decreased expression of MAN2B1 mRNA CTD PMID:39298647 Man2b1 Rat 4,4'-sulfonyldiphenol decreases methylation ISO Man2b1 (Mus musculus) 6480464 bisphenol S results in decreased methylation of MAN2B1 exon CTD PMID:33297965 Man2b1 Rat 4-hydroxyphenyl retinamide decreases expression ISO Man2b1 (Mus musculus) 6480464 Fenretinide results in decreased expression of MAN2B1 mRNA CTD PMID:28973697 Man2b1 Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of MAN2B1 mRNA CTD PMID:19483382 Man2b1 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of MAN2B1 mRNA CTD PMID:19483382 Man2b1 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of MAN2B1 mRNA CTD PMID:31881176 Man2b1 Rat actinomycin D multiple interactions ISO MAN2B1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of MAN2B1 protein CTD PMID:38460933 Man2b1 Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of MAN2B1 mRNA CTD PMID:19483382 Man2b1 Rat antirheumatic drug decreases expression ISO MAN2B1 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of MAN2B1 mRNA CTD PMID:24449571 Man2b1 Rat bafilomycin A1 multiple interactions ISO Man2b1 (Mus musculus) 6480464 bafilomycin A1 inhibits the reaction [Swainsonine results in decreased expression of MAN2B1 mRNA] CTD PMID:36402259 Man2b1 Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of MAN2B1 mRNA CTD PMID:19483382 Man2b1 Rat benzo[a]pyrene affects methylation ISO MAN2B1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of MAN2B1 3' UTR CTD PMID:27901495 Man2b1 Rat bisphenol A increases expression ISO Man2b1 (Mus musculus) 6480464 bisphenol A results in increased expression of MAN2B1 mRNA CTD PMID:26063408 more ... Man2b1 Rat bisphenol A increases expression ISO MAN2B1 (Homo sapiens) 6480464 bisphenol A results in increased expression of MAN2B1 protein CTD PMID:34186270 Man2b1 Rat bisphenol A decreases methylation ISO MAN2B1 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of MAN2B1 gene CTD PMID:31601247 Man2b1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of MAN2B1 mRNA CTD PMID:30816183 more ... Man2b1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MAN2B1 mRNA CTD PMID:25181051 Man2b1 Rat bisphenol AF increases expression ISO MAN2B1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of MAN2B1 protein CTD PMID:34186270 Man2b1 Rat Bisphenol B increases expression ISO MAN2B1 (Homo sapiens) 6480464 bisphenol B results in increased expression of MAN2B1 protein CTD PMID:34186270 Man2b1 Rat cisplatin increases expression ISO MAN2B1 (Homo sapiens) 6480464 Cisplatin results in increased expression of MAN2B1 mRNA CTD PMID:27392435 Man2b1 Rat cisplatin multiple interactions ISO MAN2B1 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of MAN2B1 mRNA CTD PMID:27392435 Man2b1 Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of MAN2B1 mRNA CTD PMID:19483382 Man2b1 Rat clofibrate decreases expression ISO Man2b1 (Mus musculus) 6480464 Clofibrate results in decreased expression of MAN2B1 mRNA CTD PMID:17585979 Man2b1 Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of MAN2B1 mRNA CTD PMID:17602206 Man2b1 Rat cobalt dichloride increases expression ISO MAN2B1 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of MAN2B1 mRNA CTD PMID:19376846 Man2b1 Rat diethylstilbestrol increases expression ISO Man2b1 (Mus musculus) 6480464 Diethylstilbestrol results in increased expression of MAN2B1 mRNA CTD PMID:15289156 Man2b1 Rat doxorubicin decreases expression ISO MAN2B1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of MAN2B1 mRNA CTD PMID:29803840 Man2b1 Rat elemental selenium increases expression ISO MAN2B1 (Homo sapiens) 6480464 Selenium results in increased expression of MAN2B1 mRNA CTD PMID:19244175 Man2b1 Rat epoxiconazole decreases expression ISO Man2b1 (Mus musculus) 6480464 epoxiconazole results in decreased expression of MAN2B1 mRNA CTD PMID:35436446 Man2b1 Rat ethanol increases expression ISO Man2b1 (Mus musculus) 6480464 Ethanol results in increased expression of MAN2B1 mRNA CTD PMID:30319688 Man2b1 Rat ethanol affects splicing ISO Man2b1 (Mus musculus) 6480464 Ethanol affects the splicing of MAN2B1 mRNA CTD PMID:30319688 Man2b1 Rat etoposide increases expression ISO Man2b1 (Mus musculus) 6480464 Etoposide results in increased expression of MAN2B1 mRNA CTD PMID:25270620 Man2b1 Rat fenamidone increases expression ISO Man2b1 (Mus musculus) 6480464 fenamidone results in increased expression of MAN2B1 mRNA CTD PMID:27029645 Man2b1 Rat fenthion decreases expression ISO Man2b1 (Mus musculus) 6480464 Fenthion results in decreased expression of MAN2B1 mRNA CTD PMID:34813904 Man2b1 Rat fumonisin B1 increases expression ISO Man2b1 (Mus musculus) 6480464 fumonisin B1 results in increased expression of MAN2B1 mRNA CTD PMID:16221962 Man2b1 Rat furan decreases expression EXP 6480464 furan results in decreased expression of MAN2B1 mRNA CTD PMID:25539665 and PMID:26194646 Man2b1 Rat genistein increases expression ISO Man2b1 (Mus musculus) 6480464 Genistein results in increased expression of MAN2B1 mRNA CTD PMID:15289156 Man2b1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of MAN2B1 mRNA CTD PMID:22061828 Man2b1 Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of MAN2B1 mRNA CTD PMID:24136188 Man2b1 Rat hydrogen peroxide affects expression ISO MAN2B1 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of MAN2B1 mRNA CTD PMID:20044591 Man2b1 Rat ivermectin decreases expression ISO MAN2B1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of MAN2B1 protein CTD PMID:32959892 Man2b1 Rat ketamine increases expression EXP 6480464 Ketamine results in increased expression of MAN2B1 mRNA CTD PMID:20080153 Man2b1 Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of MAN2B1 mRNA CTD PMID:19483382 Man2b1 Rat lidocaine increases expression EXP 6480464 Lidocaine results in increased expression of MAN2B1 mRNA CTD PMID:35283115 Man2b1 Rat methidathion decreases expression ISO Man2b1 (Mus musculus) 6480464 methidathion results in decreased expression of MAN2B1 mRNA CTD PMID:34813904 Man2b1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of MAN2B1 mRNA CTD PMID:17602206 Man2b1 Rat nimesulide decreases expression EXP 6480464 nimesulide results in decreased expression of MAN2B1 mRNA CTD PMID:24136188 Man2b1 Rat Nutlin-3 multiple interactions ISO MAN2B1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of MAN2B1 protein CTD PMID:38460933 Man2b1 Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of MAN2B1 mRNA CTD PMID:19483382 Man2b1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of MAN2B1 mRNA CTD PMID:25729387 Man2b1 Rat paracetamol affects expression ISO Man2b1 (Mus musculus) 6480464 Acetaminophen affects the expression of MAN2B1 mRNA CTD PMID:17562736 Man2b1 Rat perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of MAN2B1 mRNA CTD PMID:19162173 Man2b1 Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of MAN2B1 mRNA CTD PMID:19483382 Man2b1 Rat potassium dichromate decreases expression ISO Man2b1 (Mus musculus) 6480464 Potassium Dichromate results in decreased expression of MAN2B1 mRNA CTD PMID:23608068 Man2b1 Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of MAN2B1 mRNA CTD PMID:19162173 Man2b1 Rat SB 431542 multiple interactions ISO MAN2B1 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of MAN2B1 protein CTD PMID:37664457 Man2b1 Rat selenium atom increases expression ISO MAN2B1 (Homo sapiens) 6480464 Selenium results in increased expression of MAN2B1 mRNA CTD PMID:19244175 Man2b1 Rat silicon dioxide decreases expression ISO Man2b1 (Mus musculus) 6480464 Silicon Dioxide results in decreased expression of MAN2B1 mRNA CTD PMID:19073995 Man2b1 Rat sodium arsenite affects expression ISO MAN2B1 (Homo sapiens) 6480464 sodium arsenite affects the expression of MAN2B1 mRNA CTD PMID:20816728 Man2b1 Rat sodium arsenite increases expression ISO MAN2B1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of MAN2B1 mRNA CTD PMID:38568856 Man2b1 Rat sodium fluoride increases expression ISO Man2b1 (Mus musculus) 6480464 Sodium Fluoride results in increased expression of MAN2B1 protein CTD PMID:28918527 Man2b1 Rat swainsonine multiple interactions ISO Man2b1 (Mus musculus) 6480464 bafilomycin A1 inhibits the reaction [Swainsonine results in decreased expression of MAN2B1 mRNA] CTD PMID:36402259 Man2b1 Rat swainsonine decreases expression ISO Man2b1 (Mus musculus) 6480464 Swainsonine results in decreased expression of MAN2B1 mRNA CTD PMID:36402259 Man2b1 Rat tetrachloromethane affects expression ISO Man2b1 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of MAN2B1 mRNA CTD PMID:17484886 Man2b1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of MAN2B1 mRNA CTD PMID:31150632 Man2b1 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of MAN2B1 mRNA CTD PMID:19483382 Man2b1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of MAN2B1 mRNA CTD PMID:23411599 and PMID:34492290 Man2b1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of MAN2B1 mRNA CTD PMID:25729387 Man2b1 Rat triphenyl phosphate affects expression ISO MAN2B1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of MAN2B1 mRNA CTD PMID:37042841 Man2b1 Rat triptonide increases expression ISO Man2b1 (Mus musculus) 6480464 triptonide results in increased expression of MAN2B1 mRNA CTD PMID:33045310 Man2b1 Rat troglitazone increases expression ISO Man2b1 (Mus musculus) 6480464 troglitazone results in increased expression of MAN2B1 mRNA CTD PMID:28973697 Man2b1 Rat tungsten decreases expression ISO Man2b1 (Mus musculus) 6480464 Tungsten results in decreased expression of MAN2B1 mRNA CTD PMID:30912803 Man2b1 Rat valproic acid increases methylation ISO MAN2B1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of MAN2B1 gene CTD PMID:29154799 Man2b1 Rat valproic acid increases expression ISO MAN2B1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of MAN2B1 mRNA CTD PMID:19101580
17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) acetamide (EXP) actinomycin D (ISO) amiodarone (EXP) antirheumatic drug (ISO) bafilomycin A1 (ISO) benzbromarone (EXP) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) cisplatin (ISO) clofibrate (EXP,ISO) clofibric acid (EXP) cobalt dichloride (ISO) diethylstilbestrol (ISO) doxorubicin (ISO) elemental selenium (ISO) epoxiconazole (ISO) ethanol (ISO) etoposide (ISO) fenamidone (ISO) fenthion (ISO) fumonisin B1 (ISO) furan (EXP) genistein (ISO) gentamycin (EXP) glafenine (EXP) hydrogen peroxide (ISO) ivermectin (ISO) ketamine (EXP) L-ethionine (EXP) lidocaine (EXP) methidathion (ISO) N-nitrosodiethylamine (EXP) nimesulide (EXP) Nutlin-3 (ISO) omeprazole (EXP) oxaliplatin (EXP) paracetamol (ISO) perfluorooctanoic acid (EXP) pirinixic acid (EXP) potassium dichromate (ISO) pregnenolone 16alpha-carbonitrile (EXP) SB 431542 (ISO) selenium atom (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium fluoride (ISO) swainsonine (ISO) tetrachloromethane (EXP,ISO) thioacetamide (EXP) topotecan (EXP) triphenyl phosphate (ISO) triptonide (ISO) troglitazone (ISO) tungsten (ISO) valproic acid (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Cloning, expression, purification, and characterization of the murine lysosomal acid alpha-mannosidase.
Merkle RK, etal., Biochim Biophys Acta 1997 Aug 29;1336(2):132-46.
3.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
4.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
5.
Alterations in certain lysosomal glycohydrolases and cathepsins in rats on dexamethasone administration.
Rajashree S and Puvanakrishnan R, Mol Cell Biochem. 1996 Jan 26;154(2):165-70.
6.
GOA pipeline
RGD automated data pipeline
7.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
9.
Rat brain contains high levels of mannose-6-phosphorylated glycoproteins including lysosomal enzymes and palmitoyl-protein thioesterase, an enzyme implicated in infantile neuronal lipofuscinosis.
Sleat DE, etal., J Biol Chem. 1996 Aug 9;271(32):19191-8.
10.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Man2b1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 39,959,964 - 39,979,299 (-) NCBI GRCr8 mRatBN7.2 19 23,055,092 - 23,074,398 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 23,055,097 - 23,074,389 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 29,877,660 - 29,896,989 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 30,532,022 - 30,551,353 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 32,754,699 - 32,774,034 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 26,196,797 - 26,216,981 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 26,196,837 - 26,216,267 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 37,172,434 - 37,191,891 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 24,711,378 - 24,730,659 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 24,716,204 - 24,735,485 (-) NCBI Celera 19 22,613,060 - 22,632,343 (-) NCBI Celera Cytogenetic Map 19 q11 NCBI
MAN2B1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 12,646,512 - 12,666,742 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 12,643,831 - 12,666,742 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 12,757,326 - 12,777,556 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 12,618,322 - 12,638,828 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 12,618,321 - 12,638,828 NCBI Celera 19 12,647,038 - 12,667,305 (-) NCBI Celera Cytogenetic Map 19 p13.13 NCBI HuRef 19 12,330,278 - 12,350,679 (-) NCBI HuRef CHM1_1 19 12,757,826 - 12,778,096 (-) NCBI CHM1_1 T2T-CHM13v2.0 19 12,771,019 - 12,791,240 (-) NCBI T2T-CHM13v2.0
Man2b1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 85,809,941 - 85,824,215 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 85,809,899 - 85,824,911 (+) Ensembl GRCm39 Ensembl GRCm38 8 85,082,730 - 85,098,739 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 85,083,270 - 85,098,282 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 87,607,168 - 87,622,638 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 87,973,435 - 87,987,622 (+) NCBI MGSCv36 mm8 Celera 8 89,377,736 - 89,392,568 (+) NCBI Celera Cytogenetic Map 8 C3 NCBI cM Map 8 41.55 NCBI
Man2b1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955415 31,743,812 - 31,770,284 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955415 31,743,813 - 31,770,560 (-) NCBI ChiLan1.0 ChiLan1.0
MAN2B1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 17,575,076 - 17,595,722 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 16,575,673 - 16,596,297 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 12,208,319 - 12,228,934 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 12,954,103 - 12,974,056 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 12,954,103 - 12,974,056 (-) Ensembl panpan1.1 panPan2
MAN2B1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 49,446,162 - 49,461,812 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 49,319,770 - 49,335,161 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 49,964,867 - 49,980,270 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 49,964,838 - 49,985,978 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 49,175,662 - 49,191,234 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 49,602,404 - 49,618,026 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 49,844,716 - 49,860,091 (+) NCBI UU_Cfam_GSD_1.0
Man2b1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 208,561,069 - 208,578,396 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936659 1,774,773 - 1,793,670 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936659 1,776,212 - 1,793,651 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MAN2B1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 66,329,045 - 66,348,056 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 66,329,051 - 66,347,051 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 66,706,800 - 66,724,791 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MAN2B1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 11,334,639 - 11,355,391 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 11,334,752 - 11,355,334 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666074 8,442,103 - 8,462,838 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Man2b1
.
Predicted Target Of
Count of predictions: 98 Count of miRNA genes: 88 Interacting mature miRNAs: 89 Transcripts: ENSRNOT00000037699 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1549847 Bss8 Bone structure and strength QTL 8 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 19 1 31963836 Rat 61447 Tcas1 Tongue tumor susceptibility QTL 1 6.08 tongue integrity trait (VT:0010553) squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875) 19 2316121 47316121 Rat 631681 Cm12 Cardiac mass QTL 12 3.33 0.00053 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 19 1 28982497 Rat 9590298 Uminl5 Urine mineral level QTL 5 3.59 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 19 1 36824771 Rat 1331737 Uae29 Urinary albumin excretion QTL 29 5.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 4096155 55283277 Rat 2298478 Eau8 Experimental allergic uveoretinitis QTL 8 0.0163 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 19 17154433 57337602 Rat 1578764 Stresp19 Stress response QTL 19 3.6 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 19 15630201 57337602 Rat 1558656 Prcs1 Prostate cancer susceptibility QTL 1 5 prostate integrity trait (VT:0010571) percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943) 19 15114598 34521833 Rat 9590090 Insglur8 Insulin/glucose ratio QTL 8 10.81 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 19 1 36824771 Rat 1331788 Rf45 Renal function QTL 45 2.818 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 19 15605023 46559041 Rat 724566 Uae12 Urinary albumin excretion QTL 12 5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 2187927 56457239 Rat 724565 Tcas5 Tongue tumor susceptibility QTL 5 10.04 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 19 9977753 39654489 Rat 61407 Scl12 Serum cholesterol level QTL 12 0.001 blood HDL cholesterol amount (VT:0000184) serum high density lipoprotein cholesterol level (CMO:0000361) 19 13926401 30303727 Rat 8552935 Pigfal10 Plasma insulin-like growth factor 1 level QTL 10 5.7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 19 1 36824771 Rat 61350 Bp32 Blood pressure QTL 32 0.012 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 19 20483575 57337602 Rat 631840 Niddm38 Non-insulin dependent diabetes mellitus QTL 38 3.86 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 19 10323180 23069265 Rat 7411549 Bw130 Body weight QTL 130 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 15455860 57337602 Rat 10054132 Srcrt9 Stress Responsive Cort QTL 9 2.87 0.0017 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 19 1 27355345 Rat 724518 Uae19 Urinary albumin excretion QTL 19 5.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 7457249 42983518 Rat 8694186 Bw152 Body weight QTL 152 3.34 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 569374 45569374 Rat 61423 Cia14 Collagen induced arthritis QTL 14 3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 19 10827970 43544039 Rat 7411590 Foco7 Food consumption QTL 7 6.8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 19 1 24688055 Rat 631678 Cm9 Cardiac mass QTL 9 4.27 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 19 1 28982497 Rat 9590250 Scort11 Serum corticosterone level QTL 11 23.45 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 19 1 36824771 Rat 2317848 Alcrsp21 Alcohol response QTL 21 1.899999976158142 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 19 3204777 48204777 Rat 9589102 Slep13 Serum leptin concentration QTL 13 4.63 0.001 blood leptin amount (VT:0005667) plasma leptin level (CMO:0000781) 19 569374 45569374 Rat 7247442 Uae39 Urinary albumin excretion QTL 39 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 2187927 46708701 Rat
D19Rat13
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 23,069,265 - 23,069,484 (-) MAPPER mRatBN7.2 Rnor_6.0 19 26,201,726 - 26,201,944 NCBI Rnor6.0 Rnor_5.0 19 37,177,349 - 37,177,567 UniSTS Rnor5.0 RGSC_v3.4 19 24,725,428 - 24,725,843 RGD RGSC3.4 RGSC_v3.4 19 24,725,553 - 24,725,771 UniSTS RGSC3.4 RGSC_v3.1 19 24,730,254 - 24,730,669 RGD Celera 19 22,627,236 - 22,627,454 UniSTS FHH x ACI Map 19 21.7099 RGD FHH x ACI Map 19 21.7099 UniSTS Cytogenetic Map 19 q11 UniSTS
AU047579
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 23,059,835 - 23,060,066 (-) MAPPER mRatBN7.2 Rnor_6.0 19 26,211,292 - 26,211,524 NCBI Rnor6.0 Rnor_5.0 19 37,186,915 - 37,187,147 UniSTS Rnor5.0 RGSC_v3.4 19 24,716,121 - 24,716,353 UniSTS RGSC3.4 Celera 19 22,617,804 - 22,618,036 UniSTS Cytogenetic Map 19 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000037699 ⟹ ENSRNOP00000030766
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 23,055,097 - 23,074,389 (-) Ensembl Rnor_6.0 Ensembl 19 26,196,837 - 26,216,267 (+) Ensembl
RefSeq Acc Id:
NM_199404 ⟹ NP_955436
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 39,959,964 - 39,979,246 (-) NCBI mRatBN7.2 19 23,055,092 - 23,074,372 (-) NCBI Rnor_6.0 19 26,196,837 - 26,216,268 (+) NCBI Rnor_5.0 19 37,172,434 - 37,191,891 (+) NCBI RGSC_v3.4 19 24,711,378 - 24,730,659 (-) RGD Celera 19 22,613,060 - 22,632,343 (-) RGD
Sequence:
CTGCGGAAGCAGCGTCGCCGGAACCATGGGCACCGGATCGCTTGCCCCTGGTGTCCGTGCTGGTGGCGGGAACACTGGGTGGCTCTGGATGAGCTCCTGCAACTTAGGTTTGCCAGTCCTGTCTATTT
hide sequence
RefSeq Acc Id:
XM_006255273 ⟹ XP_006255335
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 39,959,968 - 39,979,299 (-) NCBI mRatBN7.2 19 23,055,096 - 23,074,392 (-) NCBI Rnor_6.0 19 26,196,798 - 26,216,264 (+) NCBI Rnor_5.0 19 37,172,434 - 37,191,891 (+) NCBI
Sequence:
GGCGGAGCATTCGCAAGGATTTAGCTAAACCAGAGAAAGCTGCGGAAGCAGCGTCGCCGGAACCATGGGCACCGGATCGCTTGCCCCTGGTGTCCGTGCTGGTGGCGGGAACACTGGGTGGCTCTGGA
hide sequence
RefSeq Acc Id:
XM_039097817 ⟹ XP_038953745
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 39,959,968 - 39,979,299 (-) NCBI mRatBN7.2 19 23,055,096 - 23,074,391 (-) NCBI
RefSeq Acc Id:
XM_039097818 ⟹ XP_038953746
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 39,959,968 - 39,979,299 (-) NCBI mRatBN7.2 19 23,055,096 - 23,074,398 (-) NCBI
RefSeq Acc Id:
XM_063278113 ⟹ XP_063134183
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 39,962,444 - 39,979,299 (-) NCBI
RefSeq Acc Id:
NP_955436 ⟸ NM_199404
- Peptide Label:
precursor
- UniProtKB:
Q6P762 (UniProtKB/TrEMBL)
- Sequence:
MGTGSLAPGVRAGGGNTGWLWMSSCNLGLPVLSISFLIWLLLAAPGAQAAGYKTCPTTKPGMLNVHLLPHTHDDVGWLKTVDQYYYGIMSDVQHASVQYILDSVIYSLLNDPTRRFIYVEMAFFSRWW
hide sequence
RefSeq Acc Id:
XP_006255335 ⟸ XM_006255273
- Peptide Label:
isoform X1
- Sequence:
MGTGSLAPGVRAGGGNTGWLWMSSCNLGLPVLSISFLIWLLLAAPGAQAAGYKTCPTTKPGMLNVHLLPHTHDDVGWLKTVDQYYYGMDPHLLTFMPIVMSDVQHASVQYILDSVIYSLLNDPTRRFI
hide sequence
Ensembl Acc Id:
ENSRNOP00000030766 ⟸ ENSRNOT00000037699
RefSeq Acc Id:
XP_038953746 ⟸ XM_039097818
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_038953745 ⟸ XM_039097817
- Peptide Label:
isoform X2
- UniProtKB:
F7FG85 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063134183 ⟸ XM_063278113
- Peptide Label:
isoform X4
RGD ID: 13701043 Promoter ID: EPDNEW_R11566 Type: initiation region Name: Man2b1_1 Description: mannosidase, alpha, class 2B, member 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 19 26,196,844 - 26,196,904 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-11-06
Man2b1
mannosidase, alpha, class 2B, member 1
Man2b1
mannosidase 2, alpha B1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-02-28
Man2b1
mannosidase 2, alpha B1
MGC72561
similar to mannosidase 2, alpha B1
Data merged from RGD:735135
737654 APPROVED
2002-11-06
Man2b1
mannosidase 2, alpha B1
Manb
Mannosidase, alpha B, lysosomal
Symbol and Name updated
625702 APPROVED
2002-06-10
Manb
Mannosidase, alpha B, lysosomal
Symbol and Name status set to approved
70586 APPROVED
