Advanced Search (OLGA)

Gene: Ghrhr (growth hormone releasing hormone receptor) Rattus norvegicus

Analyze

Symbol:

Ghrhr

Name:

growth hormone releasing hormone receptor

RGD ID:

2688

Description:

Enables growth hormone-releasing hormone receptor activity. Involved in several processes, including cAMP/PKA signal transduction; positive regulation of circadian sleep/wake cycle, non-REM sleep; and positive regulation of growth hormone secretion. Located in cell surface and sarcolemma. Used to study isolated growth hormone deficiency. Biomarker of sleep disorder. Human ortholog(s) of this gene implicated in isolated growth hormone deficiency and isolated growth hormone deficiency type IB. Orthologous to human GHRHR (growth hormone releasing hormone receptor); INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; alendronic acid.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

GHRH receptor; GHRHREC; GRF receptor; GRFR; growth hormone - releasing receptor; growth hormone releasing hormone receptor variant 1; growth hormone releasing hormone receptor variant 2; growth hormone releasing hormone receptor variant 3; growth hormone releasing hormone receptor variant 4; growth hormone releasing hormone receptor variant 5; growth hormone-releasing factor receptor; growth hormone-releasing hormone receptor

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Candidate Gene For:

Hcar7 Ept5

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	85,830,345 - 85,863,127 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	85,830,486 - 85,863,127 (+)	Ensembl				GRCr8
mRatBN7.2	4	84,498,159 - 84,532,851 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	84,500,212 - 84,532,776 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	89,718,589 - 89,754,998 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	85,493,999 - 85,530,402 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	83,899,789 - 83,936,121 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	85,587,321 - 85,602,389 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	85,588,595 - 85,601,666 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	150,221,064 - 150,253,706 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	84,135,530 - 84,148,503 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	79,386,911 - 79,400,313 (+)	NCBI		Celera
RGSC_v3.1	4	84,421,996 - 84,434,974 (+)	NCBI
Cytogenetic Map	4	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Desbuquois dysplasia (ISO)

disorder of sexual development (ISO)

Experimental Diabetes Mellitus (IEP)

genetic disease (ISO)

Genu Valgum (ISO)

isolated growth hormone deficiency (IAGP,ISO)

isolated growth hormone deficiency type IB (ISO)

Prostatic Neoplasms (ISO)

sleep disorder (IEP)

Upper Airway Obstruction (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

aldehydo-D-glucose (ISO)

alendronic acid (EXP)

ammonium chloride (EXP)

atrazine (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

bromobenzene (ISO)

butanal (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

CGP 52608 (ISO)

clothianidin (ISO)

D-glucose (ISO)

flavonoids (EXP)

folic acid (ISO)

fructose (ISO)

glucose (ISO)

monosodium L-glutamate (EXP)

N-nitrosodiethylamine (ISO)

okadaic acid (ISO)

paracetamol (ISO)

phosphorus atom (ISO)

phosphorus(.) (ISO)

raloxifene (EXP,ISO)

sodium arsenite (ISO)

tebuconazole (ISO)

tetrachloromethane (ISO)

thimerosal (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

troglitazone (EXP)

Zoxazolamine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

activation of adenylate cyclase activity (IDA)

adenohypophysis development (ISO)

adenylate cyclase-activating G protein-coupled receptor signaling pathway (IBA,IEA,ISO)

cAMP/PKA signal transduction (IDA)

cell maturation (ISO)

cell surface receptor signaling pathway (IEA)

cellular response to glucose stimulus (IEP)

cellular response to insulin stimulus (ISO)

determination of adult lifespan (ISO)

G protein-coupled receptor signaling pathway (IEA)

hormone metabolic process (ISO)

lactation (ISO)

mammary gland development (ISO)

positive regulation of cell population proliferation (IBA,IEA,ISO)

positive regulation of circadian sleep/wake cycle, non-REM sleep (IMP)

positive regulation of growth hormone secretion (IEA,IMP,ISO)

positive regulation of hormone secretion (ISO)

positive regulation of multicellular organism growth (IEA,ISO)

positive regulation of multicellular organismal process (IEA)

regulation of growth (IEA,TAS)

regulation of insulin-like growth factor receptor signaling pathway (ISO)

regulation of intracellular steroid hormone receptor signaling pathway (ISO)

regulation of protein metabolic process (ISO)

response to estrogen (IEA,ISO)

response to glucocorticoid (IEA,ISO)

response to insulin (IEA,ISO)

signal transduction (IEA)

somatotropin secreting cell development (ISO)

Cellular Component

cell surface (IDA,IEA,ISO)

cytoplasm (IEA,ISO)

membrane (IEA,ISO)

nuclear inner membrane (IEA,ISO)

nuclear matrix (IEA,ISO)

nuclear outer membrane (IEA,ISO)

plasma membrane (IBA,IEA,ISO)

sarcolemma (IDA)

secretory granule (IEA,ISO)

Molecular Function

G protein-coupled peptide receptor activity (IBA)

G protein-coupled receptor activity (IEA)

growth factor binding (IBA,IEA,ISO)

growth hormone-releasing hormone receptor activity (IBA,IDA,IEA,ISO)

peptide hormone binding (IBA,IEA,ISO)

protein binding (ISO)

transmembrane signaling receptor activity (IEA)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal sleep pattern (IDA)

References

References - curated

#	Reference Title	Reference Citation
1.	Effects of a high-glucose environment on the pituitary growth hormone-releasing hormone receptor: type 1 diabetes compared with in vitro glucotoxicity.	Bedard K, etal., Am J Physiol Endocrinol Metab. 2008 Apr;294(4):E740-51. doi: 10.1152/ajpendo.00141.2007. Epub 2008 Feb 19.
2.	Characterization of a growth hormone-releasing hormone binding site in the rat renal medulla.	Boulanger L, etal., Peptides 2002 Jan;23(1):43-50.
3.	Ghrelin and growth hormone (GH) secretagogues potentiate GH-releasing hormone (GHRH)-induced cyclic adenosine 3',5'-monophosphate production in cells expressing transfected GHRH and GH secretagogue receptors.	Cunha SR and Mayo KE, Endocrinology 2002 Dec;143(12):4570-82.
4.	Isolated GH deficiency due to a GHRH receptor mutation causes hip joint problems and genu valgum, and reduces size but not density of trabecular and mixed bone.	Epitacio-Pereira CC, etal., J Clin Endocrinol Metab. 2013 Nov;98(11):E1710-5. doi: 10.1210/jc.2013-2349. Epub 2013 Sep 20.
5.	Sleep loss alters hypothalamic growth hormone-releasing hormone receptors in rats.	Gardi J, etal., Neurosci Lett 2002 Aug 23;329(1):69-72.
6.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
8.	Growth hormone-releasing hormone promotes survival of cardiac myocytes in vitro and protects against ischaemia-reperfusion injury in rat heart.	Granata R, etal., Cardiovasc Res. 2009 Jul 15;83(2):303-12. Epub 2009 Mar 17.
9.	Regulation of GHRH receptor gene expression in the neonatal and adult rat pituitary.	Korytko AI and Cuttler L, Growth Horm IGF Res 2001 Oct;11(5):282-8.
10.	GHRH receptor-targeted botulinum neurotoxin selectively inhibits pulsatile GH secretion in male rats.	Leggett J, etal., Endocrinology. 2013 Sep;154(9):3305-18. doi: 10.1210/en.2012-2175. Epub 2013 Jul 3.
11.	Localized suppression of cortical growth hormone-releasing hormone receptors state-specifically attenuates electroencephalographic delta waves.	Liao F, etal., J Neurosci. 2010 Mar 17;30(11):4151-9. doi: 10.1523/JNEUROSCI.6047-09.2010.
12.	A germ line mutation that delays prostate cancer progression and prolongs survival in a murine prostate cancer model.	Majeed N, etal., Oncogene. 2005 Jul 7;24(29):4736-40.
13.	Molecular cloning and expression of a pituitary-specific receptor for growth hormone-releasing hormone.	Mayo KE Mol Endocrinol 1992 Oct;6(10):1734-44.
14.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
15.	The rat growth hormone-releasing hormone receptor gene: structure, regulation, and generation of receptor isoforms with different signaling properties.	Miller TL, etal., Endocrinology. 1999 Sep;140(9):4152-65.
16.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
17.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
18.	Online Mendelian Inheritance in Man, OMIM (TM).	Online Mendelian Inheritance in Man, OMIM (TM).
19.	GOA pipeline	RGD automated data pipeline
20.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
21.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
22.	Role of growth hormone-releasing hormone in sleep and growth impairments induced by upper airway obstruction in rats.	Tarasiuk A, etal., Eur Respir J. 2011 Oct;38(4):870-7. Epub 2011 Mar 15.
23.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
24.	Internalization and trafficking of the human and rat growth hormone-releasing hormone receptor.	Veyrat-Durebex C, etal., J Cell Physiol 2005 May;203(2):335-44.
25.	Nonsense mutation in the human growth hormone-releasing hormone receptor causes growth failure analogous to the little (lit) mouse.	Wajnrajch MP, etal., Nat Genet. 1996 Jan;12(1):88-90.
26.	Functional GHRH receptor carboxyl terminal isoforms in normal and dwarf (dw) rats.	Zeitler P, etal., J Mol Endocrinol. 1998 Dec;21(3):363-71.

Additional References at PubMed

PMID:978118	PMID:1270792	PMID:1329576	PMID:1334535	PMID:1504465	PMID:1778592	PMID:2980124	PMID:3008329	PMID:6116352	PMID:6194978	PMID:6303755	PMID:7390396
PMID:7510770	PMID:7679139	PMID:7680413	PMID:8391647	PMID:8395283	PMID:9482665	PMID:10459853	PMID:10461027	PMID:10537133	PMID:10689811	PMID:11371619	PMID:11773624
PMID:12867592	PMID:15059953	PMID:15690087	PMID:16513828	PMID:16867182	PMID:17356054	PMID:17536003	PMID:17537840	PMID:22203988	PMID:23417421	PMID:23770714	PMID:25404316

Genomics

Comparative Map Data

Ghrhr
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	85,830,345 - 85,863,127 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	85,830,486 - 85,863,127 (+)	Ensembl				GRCr8
mRatBN7.2	4	84,498,159 - 84,532,851 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	84,500,212 - 84,532,776 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	89,718,589 - 89,754,998 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	85,493,999 - 85,530,402 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	83,899,789 - 83,936,121 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	85,587,321 - 85,602,389 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	85,588,595 - 85,601,666 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	150,221,064 - 150,253,706 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	84,135,530 - 84,148,503 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	79,386,911 - 79,400,313 (+)	NCBI		Celera
RGSC_v3.1	4	84,421,996 - 84,434,974 (+)	NCBI
Cytogenetic Map	4	q24	NCBI

GHRHR
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	30,963,953 - 30,979,528 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	30,938,669 - 30,993,254 (+)	Ensembl			hg38	GRCh38
GRCh37	7	31,003,568 - 31,019,143 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	30,970,161 - 30,985,668 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	7	30,776,875 - 30,788,828	NCBI
Celera	7	30,992,840 - 31,008,351 (+)	NCBI		Celera
Cytogenetic Map	7	p14.3	NCBI
HuRef	7	30,885,854 - 30,901,378 (+)	NCBI		HuRef
CHM1_1	7	31,003,564 - 31,019,092 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	7	31,101,596 - 31,117,172 (+)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	31,053,140 - 31,068,651 (+)	NCBI

Ghrhr
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	55,353,204 - 55,365,515 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	55,353,280 - 55,365,515 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	6	55,376,295 - 55,388,530 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	55,376,295 - 55,388,530 (+)	Ensembl			mm10	GRCm38
MGSCv37	6	55,326,289 - 55,338,524 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	6	55,305,940 - 55,317,897 (+)	NCBI		MGSCv36	mm8
Celera	6	55,910,067 - 55,922,286 (+)	NCBI		Celera
Cytogenetic Map	6	B3	NCBI
cM Map	6	27.38	NCBI

Ghrhr
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955410	32,102,367 - 32,115,080 (+)	Ensembl
ChiLan1.0	NW_004955410	32,084,210 - 32,114,844 (+)	NCBI	ChiLan1.0	ChiLan1.0

GHRHR
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	35,775,238 - 35,790,875 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	84,099,966 - 84,115,603 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	31,582,134 - 31,592,914 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	31,701,641 - 31,712,200 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	31,696,914 - 31,712,200 (+)	Ensembl			panPan2	panpan1.1

GHRHR
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	14	43,626,862 - 43,638,737 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	14	43,626,845 - 43,638,753 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	14	43,059,230 - 43,070,721 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	14	43,567,602 - 43,579,114 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	14	43,567,473 - 43,579,402 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	14	43,683,226 - 43,694,708 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	14	43,359,784 - 43,371,271 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	14	43,721,032 - 43,732,545 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ghrhr
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	87,980,695 - 87,991,200 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936478	7,188,826 - 7,201,932 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936478	7,188,826 - 7,202,854 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GHRHR
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	18	42,030,510 - 42,046,184 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	18	42,030,505 - 42,046,178 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	18	46,427,131 - 46,436,821 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GHRHR
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	27,402,765 - 27,417,536 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	27,404,886 - 27,417,521 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666042	77,286,895 - 77,301,754 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ghrhr
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624783	200,940 - 214,373 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624783	200,935 - 214,453 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Ghrhr
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	6	85,684,312 - 85,697,608 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Ghrhr
239 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	326
Count of miRNA genes:	156
Interacting mature miRNAs:	177
Transcripts:	ENSRNOT00000016087, ENSRNOT00000044578
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	39431983	123203361	Rat
1549843	Bw53	Body weight QTL 53		0.0001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	59753119	104753119	Rat
61445	Strs3	Sensitivity to stroke QTL 3	3		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	4	41400577	86400577	Rat
6893678	Bw108	Body weight QTL 108	2.6	0.006	body mass (VT:0001259)	body weight (CMO:0000012)	4	44425024	89425024	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	27730518	170099664	Rat
1357342	Bw40	Body weight QTL 40		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	4	74233320	119233320	Rat
631556	Bp135	Blood pressure QTL 135		0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	80212111	119233320	Rat
1358363	Sradr3	Stress Responsive Adrenal Weight QTL 3	6.19		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	4	58817672	103817672	Rat
61330	Eau1	Experimental allergic uveoretinitis QTL 1		0.0003	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	4	26234499	134199155	Rat
70167	Bw22	Body weight QTL 22	3.1		body mass (VT:0001259)	body weight (CMO:0000012)	4	74233320	119233320	Rat
1549839	Bw52	Body weight QTL 52		0.0001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	71647492	116647492	Rat
70177	Xhs1	X-ray hypersensitivity QTL 1	25.1		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	82944895	154403548	Rat
6909128	Pancm4	Pancreatic morphology QTL 4	11.35		pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	4	27862204	126119996	Rat
8694439	Bw168	Body weight QTL 168	9.57	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	4	41400603	86400603	Rat
61476	Aia3	Adjuvant induced arthritis QTL 3	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	75939858	140508796	Rat
1641919	Alc22	Alcohol consumption QTL 22		0.0005	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	65060960	127749483	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	45429897	149763204	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	51085655	113588029	Rat
61364	Iddm2	Insulin dependent diabetes mellitus QTL 2			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	80216705	104243248	Rat
2317588	Eae27	Experimental allergic encephalomyelitis QTL 27			nervous system integrity trait (VT:0010566)	percentage of study population developing experimental autoimmune encephalomyelitis during a period of time (CMO:0001047)	4	69036742	114036742	Rat
1300139	Hrtrt6	Heart rate QTL 6	2.85		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	40490442	117737312	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	57613339	151163960	Rat
4889969	Bss96	Bone structure and strength QTL 96	4.9		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	4	57613242	102613242	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	12212457	182430611	Rat
4889972	Bss97	Bone structure and strength QTL 97	5.6		tibia size trait (VT:0100001)	tibia total bone volume (CMO:0001724)	4	57613242	102613242	Rat
6478684	Anxrr30	Anxiety related response QTL 30		0.00087	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	64084079	109084079	Rat
5685009	Bmd86	Bone mineral density QTL 86	3.7		tibia mineral mass (VT:1000283)	bone mineral density (CMO:0001226)	4	57613242	102613242	Rat
2306794	Ean2	Experimental allergic neuritis QTL 2	6.4		nervous system integrity trait (VT:0010566)	IFNG-secreting splenocyte count (CMO:0002122)	4	82790777	97183061	Rat
2306547	Iddm38	Insulin dependent diabetes mellitus QTL 38			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	68353567	113353567	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	60916264	184426481	Rat
2306545	Iddm39	Insulin dependent diabetes mellitus QTL 39			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	78687630	123687630	Rat
631261	Tcas3	Tongue tumor susceptibility QTL 3	6.88		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	4	11706604	92690519	Rat
6478772	Anxrr49	Anxiety related response QTL 49		0.15488	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	64084079	109084079	Rat
631646	Stl4	Serum triglyceride level QTL 4	6.5	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	4	74169813	134199155	Rat
2312569	Pur19	Proteinuria QTL 19	3.4	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	4	59836842	104836842	Rat
61406	Scwia1	Streptococcal cell wall induced arthritis QTL 1	2.3		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	4	75939858	140508796	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	45429897	149763204	Rat
634344	Hcar7	Hepatocarcinoma resistance QTL 7	7.8		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	4	61041057	94638356	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5889999	148002343	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	174095838	Rat
631662	Hcar2	Hepatocarcinoma resistance QTL 2	3.1	0.0003	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	84349032	129349032	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	45429709	157555683	Rat
61418	Pia5	Pristane induced arthritis QTL 5	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	63245026	129846354	Rat
631651	Bp124	Blood pressure QTL 124	3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	64209744	109209744	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	184426481	Rat
1558651	Swd3	Spike wave discharge measurement QTL 3	4.62	0.000024	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge frequency (CMO:0001742)	4	41400577	86400577	Rat
1641833	Alc21	Alcohol consumption QTL 21	8.6	0.0001	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	57664252	127749483	Rat
2306899	Bp338	Blood pressure QTL 338		0.071	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	82336765	127336765	Rat
631546	Bp86	Blood pressure QTL 86	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	58079875	92690793	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	65495851	159259805	Rat
6478743	Anxrr40	Anxiety related response QTL 40		0.83076	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	64084079	109084079	Rat
61434	Cia3	Collagen induced arthritis QTL 3	4.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	63224393	108224393	Rat
7394826	Bw126	Body weight QTL 126		0.002	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	63900458	88813920	Rat
12798520	Anxrr55	Anxiety related response QTL 55	4.45	0.01	locomotor behavior trait (VT:0001392)	number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715)	4	33538597	116185060	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	59	64	72	72	44	60	44	6	297	151	11	36	78	62	28	6	6

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001398554	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001398565	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_012850	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008762872	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063285592	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063285593	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063285594	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063285595	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063285596	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063285597	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063285598	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC091710	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC128116	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF121969	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF122055	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF409106	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EU253552	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GQ888702	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GQ888703	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GQ888704	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GQ888705	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GQ888706	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L01407	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000016087 ⟹ ENSRNOP00000016087

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	85,849,905 - 85,862,614 (+)	Ensembl
mRatBN7.2 Ensembl	4	84,519,692 - 84,532,338 (+)	Ensembl
Rnor_6.0 Ensembl	4	85,588,711 - 85,601,335 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000044578 ⟹ ENSRNOP00000043884

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	85,849,905 - 85,863,127 (+)	Ensembl
mRatBN7.2 Ensembl	4	84,519,692 - 84,532,669 (+)	Ensembl
Rnor_6.0 Ensembl	4	85,588,689 - 85,601,666 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000081953 ⟹ ENSRNOP00000075689

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	85,849,874 - 85,862,585 (+)	Ensembl
mRatBN7.2 Ensembl	4	84,519,598 - 84,532,309 (+)	Ensembl
Rnor_6.0 Ensembl	4	85,588,595 - 85,601,306 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000084855 ⟹ ENSRNOP00000071248

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	85,849,905 - 85,863,127 (+)	Ensembl
mRatBN7.2 Ensembl	4	84,519,692 - 84,532,517 (+)	Ensembl
Rnor_6.0 Ensembl	4	85,588,711 - 85,601,514 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112196 ⟹ ENSRNOP00000086351

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	85,830,486 - 85,857,936 (+)	Ensembl
mRatBN7.2 Ensembl	4	84,500,212 - 84,532,776 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112212 ⟹ ENSRNOP00000092627

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	85,830,486 - 85,863,127 (+)	Ensembl
mRatBN7.2 Ensembl	4	84,500,212 - 84,532,776 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114226 ⟹ ENSRNOP00000081121

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	84,526,241 - 84,532,338 (+)	Ensembl

RefSeq Acc Id:

NM_001398554 ⟹ NP_001385483

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	85,830,486 - 85,863,127 (+)	NCBI
mRatBN7.2	4	84,500,212 - 84,532,851 (+)	NCBI

RefSeq Acc Id:

NM_001398565 ⟹ NP_001385494

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	85,849,905 - 85,863,127 (+)	NCBI
mRatBN7.2	4	84,519,629 - 84,532,851 (+)	NCBI

RefSeq Acc Id:

NM_012850 ⟹ NP_036982

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	85,849,905 - 85,863,127 (+)	NCBI
mRatBN7.2	4	84,519,629 - 84,532,851 (+)	NCBI
Rnor_6.0	4	85,588,689 - 85,601,666 (+)	NCBI
Rnor_5.0	4	150,221,064 - 150,253,706 (+)	NCBI
RGSC_v3.4	4	84,135,530 - 84,148,503 (+)	RGD
Celera	4	79,386,911 - 79,400,313 (+)	RGD

Sequence:

show sequence

AAACAGCGGACTACAGGCACCACTGCCATGGACAGCCTGTTGTGGGCTACCTGGGTCCTCTGCT
TGCTGAACCTGTGGGGAGTTGCACTGGGTCACCTCCACCTAGAATGTGACTTCATCACTCAGCT
GAGAGACGATGAGCTTGCATGCCTTCAGGCGGCAGAGGGGACCAACAACTCGTCCATGGGATGC
CCTGGGACCTGGGATGGGCTGCTGTGCTGGCCCCCAACTGGCTCTGGCCAGTGGGTCTCCCTCC
CCTGCCCTGAATTCTTCTCTCATTTTGGCTCAGACCCAGGGGCTGTGAAAAGGGACTGCACCAT
CACGGGTTGGTCTGATCCCTTCCCACCATATCCCGTGGCCTGTCCTGTGCCCTTGGAACTGCTA
ACAGAGGAGAAGTCTTACTTCTCCACGGTGAAGATCATCTACACCACAGGCCACAGCATCTCCA
TTGTAGCCCTCTGCGTGGCTATTGCCATCCTGGTTGCTCTCAGGAGGCTCCACTGCCCCAGGAA
CTACATCCACACGCAGCTGTTTGCTACTTTCATCCTCAAGGCCAGTGCTGTGTTCCTGAAGGAT
GCTGCTGTCTTCCAGGGTGATAGCACGGACCACTGCAGCATGTCCACTATTCTGTGCAAGGTCT
CTGTGGCCGTCTCACATTTTGCCACCATGACCAACTTCAGCTGGCTGCTGGCAGAAGCCGTCTA
CCTGAGCTGTCTGTTGGCCTCCACATCTCCTAGGTCCAAACCAGCTTTCTGGTGGCTGGTTCTC
GCTGGCTGGGGACTCCCTGTGCTATGCACTGGTACGTGGGTGGGCTGCAAACTGGCTTTTGAGG
ACACTGCGTGCTGGGACCTAGACGACAGCTCCCCCTACTGGTGGATCATCAAAGGGCCCATAGT
CCTCTCTGTTGGGGTGAACTTTGGGCTGTTTCTCAATATAATTTGCATCCTGCTGAGGAAGCTG
GGGCCTGCACAAGGCGGCTTACACACACGGGCTCAGTACTGGCGGCTTTCCAAATCAACACTTC
TCCTTATCCCGCTGTTTGGAATTCATTACATCATCTTCAACTTCCTGCCTGACAGTGCTGGCCT
TGGCATCCGTCTACCCCTGGAGCTGGGACTGGGGTCCTTCCAGGGTTTTGTTGTTGCTGTCCTC
TACTGCTTCCTCAATCAAGAGGTGAGGACGGAGATTTCACGCAAATGGTATGGCCATGACCCTG
AACTTCTGCCAGCTCGGCGGACCTGCACTGAGTGGACCACACCTCCCCGATCGAGAGTGAAGGT
GCTCACCTCTGAGTGCTAGGCCAGCCATCACAAAGGCCGAGCCCCAAAACCCTGCACTCAAACT
GCCATGCCACCAAGGGCAACAAGGTCCTCCCTTCCGTTCTCATTCTCTGCATCTGCTTTCTCTA
GGTCCCTGTATACCAACCTCCGACTTTCTCAGTTCCTGTATGCCCCCATCTGTTCTTTCTTCCT
ATCTAGGCTATTGCCCAAGGCCCAGGGAAACCAATAAACTTGTACATGAGTGATCTGCAGTTGA
GTCAATGTGGCTCTGAAGGGGAGCTCTTGTCAGCAGCCATTATTTGCACTTCCGGTGCATTCCT
CATCCCTTGGCTGCAGCTGCCTCATTGCC

hide sequence

RefSeq Acc Id:

XM_063285592 ⟹ XP_063141662

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	85,848,308 - 85,859,258 (+)	NCBI

RefSeq Acc Id:

XM_063285593 ⟹ XP_063141663

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	85,830,345 - 85,859,258 (+)	NCBI

RefSeq Acc Id:

XM_063285594 ⟹ XP_063141664

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	85,830,345 - 85,859,258 (+)	NCBI

RefSeq Acc Id:

XM_063285595 ⟹ XP_063141665

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	85,830,345 - 85,859,258 (+)	NCBI

RefSeq Acc Id:

XM_063285596 ⟹ XP_063141666

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	85,830,345 - 85,859,258 (+)	NCBI

RefSeq Acc Id:

XM_063285597 ⟹ XP_063141667

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	85,830,345 - 85,859,258 (+)	NCBI

RefSeq Acc Id:

XM_063285598 ⟹ XP_063141668

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	85,834,948 - 85,859,258 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001385483	(Get FASTA)	NCBI Sequence Viewer
	NP_001385494	(Get FASTA)	NCBI Sequence Viewer
	NP_036982	(Get FASTA)	NCBI Sequence Viewer
	XP_063141662	(Get FASTA)	NCBI Sequence Viewer
	XP_063141663	(Get FASTA)	NCBI Sequence Viewer
	XP_063141664	(Get FASTA)	NCBI Sequence Viewer
	XP_063141665	(Get FASTA)	NCBI Sequence Viewer
	XP_063141666	(Get FASTA)	NCBI Sequence Viewer
	XP_063141667	(Get FASTA)	NCBI Sequence Viewer
	XP_063141668	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41221	(Get FASTA)	NCBI Sequence Viewer
	AAD26335	(Get FASTA)	NCBI Sequence Viewer
	AAD30979	(Get FASTA)	NCBI Sequence Viewer
	AAK97654	(Get FASTA)	NCBI Sequence Viewer
	ABX55781	(Get FASTA)	NCBI Sequence Viewer
	ADP89434	(Get FASTA)	NCBI Sequence Viewer
	ADP89435	(Get FASTA)	NCBI Sequence Viewer
	ADP89436	(Get FASTA)	NCBI Sequence Viewer
	ADP89437	(Get FASTA)	NCBI Sequence Viewer
	ADP89438	(Get FASTA)	NCBI Sequence Viewer
	EDL88086	(Get FASTA)	NCBI Sequence Viewer
	EDL88087	(Get FASTA)	NCBI Sequence Viewer
	EDL88088	(Get FASTA)	NCBI Sequence Viewer
	EDL88089	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000043884
	ENSRNOP00000071248
	ENSRNOP00000092627
GenBank Protein	Q02644	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_036982 ⟸ NM_012850
- Peptide Label:	isoform 1 precursor
- UniProtKB:	A6K0Y0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MDSLLWATWVLCLLNLWGVALGHLHLECDFITQLRDDELACLQAAEGTNNSSMGCPGTWDGLLC WPPTGSGQWVSLPCPEFFSHFGSDPGAVKRDCTITGWSDPFPPYPVACPVPLELLTEEKSYFST VKIIYTTGHSISIVALCVAIAILVALRRLHCPRNYIHTQLFATFILKASAVFLKDAAVFQGDST DHCSMSTILCKVSVAVSHFATMTNFSWLLAEAVYLSCLLASTSPRSKPAFWWLVLAGWGLPVLC TGTWVGCKLAFEDTACWDLDDSSPYWWIIKGPIVLSVGVNFGLFLNIICILLRKLGPAQGGLHT RAQYWRLSKSTLLLIPLFGIHYIIFNFLPDSAGLGIRLPLELGLGSFQGFVVAVLYCFLNQEVR TEISRKWYGHDPELLPARRTCTEWTTPPRSRVKVLTSEC hide sequence

Ensembl Acc Id:

ENSRNOP00000016087 ⟸ ENSRNOT00000016087

Ensembl Acc Id:

ENSRNOP00000071248 ⟸ ENSRNOT00000084855

Ensembl Acc Id:

ENSRNOP00000043884 ⟸ ENSRNOT00000044578

Ensembl Acc Id:

ENSRNOP00000075689 ⟸ ENSRNOT00000081953

Ensembl Acc Id:

ENSRNOP00000086351 ⟸ ENSRNOT00000112196

Ensembl Acc Id:

ENSRNOP00000092627 ⟸ ENSRNOT00000112212

Ensembl Acc Id:

ENSRNOP00000081121 ⟸ ENSRNOT00000114226

RefSeq Acc Id:	NP_001385483 ⟸ NM_001398554
- Peptide Label:	isoform 2
- UniProtKB:	A6K0Y0 (UniProtKB/TrEMBL), A0A1B0HAQ2 (UniProtKB/TrEMBL)

RefSeq Acc Id:	NP_001385494 ⟸ NM_001398565
- Peptide Label:	isoform 3 precursor
- UniProtKB:	A6K0X9 (UniProtKB/TrEMBL), Q9WU99 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063141666 ⟸ XM_063285596
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_063141665 ⟸ XM_063285595
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_063141664 ⟸ XM_063285594
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_063141663 ⟸ XM_063285593
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_063141667 ⟸ XM_063285597
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_063141668 ⟸ XM_063285598
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_063141662 ⟸ XM_063285592
- Peptide Label:	isoform X1

Protein Domains

G-protein coupled receptors family 2 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q02644-F1-model_v2	AlphaFold	Q02644	1-464	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2688	AgrOrtholog
BioCyc Gene	G2FUF-44732	BioCyc
Ensembl Genes	ENSRNOG00000011808	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000044578	ENTREZGENE
	ENSRNOT00000084855	ENTREZGENE
	ENSRNOT00000112212	ENTREZGENE
Gene3D-CATH	4.10.1240.10	UniProtKB/Swiss-Prot
	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot
InterPro	GPCR_2	UniProtKB/Swiss-Prot
	GPCR_2-like	UniProtKB/Swiss-Prot
	GPCR_2_extracell_dom_sf	UniProtKB/Swiss-Prot
	GPCR_2_extracellular_dom	UniProtKB/Swiss-Prot
	GPCR_2_GHRH_rcpt	UniProtKB/Swiss-Prot
	GPCR_2_secretin-like	UniProtKB/Swiss-Prot
	GPCR_2_secretin-like_CS	UniProtKB/Swiss-Prot
KEGG Report	rno:25321	UniProtKB/Swiss-Prot
NCBI Gene	25321	ENTREZGENE
PANTHER	PDF RECEPTOR-LIKE PROTEIN-RELATED	UniProtKB/Swiss-Prot
	PTHR45620:SF14	UniProtKB/Swiss-Prot
Pfam	7tm_2	UniProtKB/Swiss-Prot
	HRM	UniProtKB/Swiss-Prot
PhenoGen	Ghrhr	PhenoGen
PRINTS	GHRHRECEPTOR	UniProtKB/Swiss-Prot
	GPCRSECRETIN	UniProtKB/Swiss-Prot
PROSITE	G_PROTEIN_RECEP_F2_1	UniProtKB/Swiss-Prot
	G_PROTEIN_RECEP_F2_2	UniProtKB/Swiss-Prot
	G_PROTEIN_RECEP_F2_3	UniProtKB/Swiss-Prot
	G_PROTEIN_RECEP_F2_4	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000011808	RatGTEx
SMART	HormR	UniProtKB/Swiss-Prot
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot
	SSF111418	UniProtKB/Swiss-Prot
TIGR	TC224151
UniProt	A0A1B0H847_RAT	UniProtKB/TrEMBL
	A0A1B0H858_RAT	UniProtKB/TrEMBL
	A0A1B0HAQ2	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2Q8Q1_RAT	UniProtKB/TrEMBL
	A0A8L2QMQ8_RAT	UniProtKB/TrEMBL
	A6K0X9	ENTREZGENE, UniProtKB/TrEMBL
	A6K0Y0	ENTREZGENE, UniProtKB/TrEMBL
	A6K0Y1_RAT	UniProtKB/TrEMBL
	A6K0Y2_RAT	UniProtKB/TrEMBL
	GHRHR_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q91WX4_RAT	UniProtKB/TrEMBL
	Q9WU99	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	Ghrhr	Growth hormone - releasing receptor			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	decreased mRNA levels are associated with sleep deprivation	728477
gene_pathway	act directly to potentiate the second messenger cAMP pathway through a PKC-independent mechanism	628502

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Mammalian Phenotype