Symbol:
Fkbp1a
Name:
FKBP prolyl isomerase 1A
RGD ID:
2617
Description:
Enables several functions, including FK506 binding activity; Hsp70 protein binding activity; and type I transforming growth factor beta receptor binding activity. Involved in response to iron ion. Located in axon terminus. Biomarker of Parkinsonism. Orthologous to several human genes including FKBP1A (FKBP prolyl isomerase 1A); PARTICIPATES IN activin signaling pathway; mTOR signaling pathway; transforming growth factor-beta Smad dependent signaling pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
12 kDa FK506-binding protein; 12 kDa FKBP; FK506 binding protein 1a; FK506 binding protein 2; FK506 binding protein 2 (13 kDa); FK506-binding protein 1 (12kD); FK506-binding protein 1a; FKBP-12; FKBP-1A; FKBP12; Fkbp2; immunophilin FKBP12; MGC156543; peptidyl-prolyl cis-trans isomerase FKBP1A; PPIase FKBP1A; rotamase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
FKBP1A (FKBP prolyl isomerase 1A) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):
Fkbp1a (FK506 binding protein 1a) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Fkbp1a (FKBP prolyl isomerase 1A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
FKBP1A (FKBP prolyl isomerase 1A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
FKBP1A (FKBP prolyl isomerase 1A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Fkbp1a (FKBP prolyl isomerase 1A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
FKBP1A (FKBP prolyl isomerase 1A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
FKBP1A (FKBP prolyl isomerase 1A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Fkbp1a (FKBP prolyl isomerase 1A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
FKBP1C (FKBP prolyl isomerase family member 1C) HGNC
Ensembl, OrthoDB, Panther, PhylomeDB
Homo sapiens (human):
FKBP1B (FKBP prolyl isomerase 1B) HGNC
OrthoDB
Alliance orthologs 3
Homo sapiens (human):
FKBP1A (FKBP prolyl isomerase 1A)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Fkbp1a (FK506 binding protein 1a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
FKBP1C (FKBP prolyl isomerase family member 1C)
Alliance
DIOPT (Ensembl Compara|OMA|PANTHER)
Danio rerio (zebrafish):
fkbp1aa (FKBP prolyl isomerase 1Aa)
Alliance
DIOPT (Hieranoid|OMA|PANTHER)
Danio rerio (zebrafish):
fkbp1ab (FKBP prolyl isomerase 1Ab)
Alliance
DIOPT (Hieranoid|OMA|PANTHER)
Saccharomyces cerevisiae (baker's yeast):
FPR1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
Fkbp12
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
fkb-2
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 160,500,748 - 160,520,492 (+) NCBI GRCr8 mRatBN7.2 3 140,040,359 - 140,060,107 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 140,040,278 - 140,060,743 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 143,944,928 - 143,964,668 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 152,528,701 - 152,548,443 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 150,269,170 - 150,288,910 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 147,042,944 - 147,062,725 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 147,042,944 - 147,062,724 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 153,399,455 - 153,418,857 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 141,861,237 - 141,880,797 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 141,766,809 - 141,786,369 (+) NCBI Celera 3 138,799,643 - 138,819,482 (+) NCBI Celera Cytogenetic Map 3 q41 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Fkbp1a Rat (1->4)-beta-D-glucan multiple interactions ISO Fkbp1a (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of FKBP1A mRNA CTD PMID:36331819 Fkbp1a Rat 1,2-dimethylhydrazine multiple interactions ISO Fkbp1a (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of FKBP1A mRNA CTD PMID:22206623 Fkbp1a Rat 1-naphthyl isothiocyanate decreases expression EXP 6480464 1-Naphthylisothiocyanate results in decreased expression of FKBP1A mRNA CTD PMID:25380136 Fkbp1a Rat 14-Deoxy-11,12-didehydroandrographolide decreases expression ISO FKBP1A (Homo sapiens) 6480464 14-deoxy-11 and 12-didehydroandrographolide results in decreased expression of FKBP1A mRNA CTD PMID:22101062 Fkbp1a Rat 17beta-estradiol multiple interactions ISO FKBP1A (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of FKBP1A mRNA CTD PMID:30165855 Fkbp1a Rat 17beta-estradiol increases expression ISO Fkbp1a (Mus musculus) 6480464 Estradiol results in increased expression of FKBP1A mRNA CTD PMID:39298647 Fkbp1a Rat 1H-pyrazole increases expression ISO Fkbp1a (Mus musculus) 6480464 pyrazole results in increased expression of FKBP1A mRNA CTD PMID:17945193 Fkbp1a Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Fkbp1a (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Fkbp1a Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Fkbp1a (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Fkbp1a Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Fkbp1a (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of FKBP1A mRNA CTD PMID:16960034 Fkbp1a Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of FKBP1A mRNA CTD PMID:34747641 Fkbp1a Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of FKBP1A mRNA CTD PMID:16960034 and PMID:26232522 Fkbp1a Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of FKBP1A mRNA CTD PMID:20959002 Fkbp1a Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Fkbp1a (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of FKBP1A mRNA CTD PMID:21570461 Fkbp1a Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of FKBP1A mRNA CTD PMID:21346803 Fkbp1a Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of FKBP1A mRNA CTD PMID:21346803 Fkbp1a Rat 3,4-methylenedioxymethamphetamine increases expression ISO Fkbp1a (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of FKBP1A mRNA CTD PMID:20188158 Fkbp1a Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO FKBP1A (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of FKBP1A mRNA CTD PMID:28628672 Fkbp1a Rat 3H-1,2-dithiole-3-thione increases expression EXP 6480464 1 and 2-dithiol-3-thione results in increased expression of FKBP1A mRNA CTD PMID:19162173 Fkbp1a Rat 4,4'-sulfonyldiphenol increases expression ISO Fkbp1a (Mus musculus) 6480464 bisphenol S results in increased expression of FKBP1A mRNA CTD PMID:39298647 Fkbp1a Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of FKBP1A mRNA CTD PMID:36041667 Fkbp1a Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of FKBP1A mRNA CTD PMID:30047161 Fkbp1a Rat actinomycin D multiple interactions ISO FKBP1A (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of FKBP1A protein CTD PMID:38460933 Fkbp1a Rat Aflatoxin B2 alpha decreases methylation ISO FKBP1A (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of FKBP1A intron CTD PMID:30157460 Fkbp1a Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of FKBP1A mRNA CTD PMID:30047161 Fkbp1a Rat arsenite(3-) increases methylation ISO FKBP1A (Homo sapiens) 6480464 arsenite results in increased methylation of FKBP1A promoter CTD PMID:23974009 Fkbp1a Rat arsenite(3-) multiple interactions ISO FKBP1A (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to FKBP1A mRNA] CTD PMID:32406909 Fkbp1a Rat asbestos affects expression ISO FKBP1A (Homo sapiens) 6480464 Asbestos affects the expression of FKBP1A mRNA CTD PMID:17297452 Fkbp1a Rat ascomycin multiple interactions ISO Fkbp1a (Mus musculus) 6480464 immunomycin inhibits the reaction [Sirolimus binds to FKBP1A protein] CTD PMID:7503980 Fkbp1a Rat ascomycin multiple interactions EXP 6480464 immunomycin inhibits the reaction [Sirolimus binds to FKBP1A protein] CTD PMID:7532117 Fkbp1a Rat atrazine increases expression ISO FKBP1A (Homo sapiens) 6480464 Atrazine results in increased expression of FKBP1A mRNA CTD PMID:22378314 Fkbp1a Rat benzene increases expression ISO FKBP1A (Homo sapiens) 6480464 Benzene results in increased expression of FKBP1A protein CTD PMID:14673790 Fkbp1a Rat benzo[a]pyrene decreases expression ISO Fkbp1a (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of FKBP1A mRNA CTD PMID:19770486 Fkbp1a Rat benzo[a]pyrene affects methylation ISO FKBP1A (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of FKBP1A intron CTD PMID:30157460 Fkbp1a Rat benzo[a]pyrene decreases methylation ISO FKBP1A (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of FKBP1A promoter CTD PMID:27901495 Fkbp1a Rat benzo[a]pyrene multiple interactions ISO Fkbp1a (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of FKBP1A mRNA CTD PMID:27858113 Fkbp1a Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of FKBP1A mRNA CTD PMID:21839799 Fkbp1a Rat benzo[b]fluoranthene multiple interactions ISO Fkbp1a (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of FKBP1A mRNA CTD PMID:27858113 Fkbp1a Rat beta-lapachone increases expression ISO FKBP1A (Homo sapiens) 6480464 beta-lapachone results in increased expression of FKBP1A mRNA CTD PMID:38218311 Fkbp1a Rat beta-lapachone decreases expression ISO FKBP1A (Homo sapiens) 6480464 beta-lapachone results in decreased expression of FKBP1A mRNA CTD PMID:38218311 Fkbp1a Rat bis(2-ethylhexyl) phthalate increases expression ISO Fkbp1a (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of FKBP1A mRNA CTD PMID:33754040 Fkbp1a Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of FKBP1A mRNA CTD PMID:25181051 Fkbp1a Rat bisphenol A increases expression ISO FKBP1A (Homo sapiens) 6480464 bisphenol A results in increased expression of FKBP1A protein CTD PMID:37567409 Fkbp1a Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of FKBP1A mRNA CTD PMID:36041667 Fkbp1a Rat bisphenol A decreases expression ISO Fkbp1a (Mus musculus) 6480464 bisphenol A results in decreased expression of FKBP1A mRNA CTD PMID:33221593 Fkbp1a Rat bisphenol A affects expression ISO FKBP1A (Homo sapiens) 6480464 bisphenol A affects the expression of FKBP1A mRNA CTD PMID:30903817 Fkbp1a Rat bisphenol A decreases expression ISO FKBP1A (Homo sapiens) 6480464 bisphenol A results in decreased expression of FKBP1A mRNA CTD PMID:29275510 Fkbp1a Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of FKBP1A mRNA CTD PMID:30816183 Fkbp1a Rat bisphenol A multiple interactions ISO FKBP1A (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of FKBP1A mRNA CTD PMID:28628672 Fkbp1a Rat bisphenol A decreases methylation ISO Fkbp1a (Mus musculus) 6480464 bisphenol A results in decreased methylation of FKBP1A promoter CTD PMID:27312807 Fkbp1a Rat bisphenol AF increases expression ISO FKBP1A (Homo sapiens) 6480464 bisphenol AF results in increased expression of FKBP1A mRNA and bisphenol AF results in increased expression of FKBP1A protein CTD PMID:34186270 and PMID:36190352 Fkbp1a Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of FKBP1A mRNA CTD PMID:36041667 Fkbp1a Rat bleomycin A5 increases expression ISO FKBP1A (Homo sapiens) 6480464 bleomycetin results in increased expression of FKBP1A mRNA CTD PMID:21040473 Fkbp1a Rat bortezomib decreases expression ISO FKBP1A (Homo sapiens) 6480464 Bortezomib results in decreased expression of FKBP1A mRNA CTD PMID:20977926 Fkbp1a Rat Brodifacoum decreases expression EXP 6480464 bromfenacoum results in decreased expression of FKBP1A protein CTD PMID:28903499 Fkbp1a Rat butan-1-ol multiple interactions ISO FKBP1A (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of FKBP1A mRNA CTD PMID:29432896 Fkbp1a Rat cadmium atom multiple interactions ISO FKBP1A (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of FKBP1A protein CTD PMID:33040242 Fkbp1a Rat cadmium atom increases oxidation ISO Fkbp1a (Mus musculus) 6480464 Cadmium results in increased oxidation of FKBP1A protein CTD PMID:24077948 Fkbp1a Rat cadmium dichloride multiple interactions ISO FKBP1A (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of FKBP1A protein CTD PMID:33040242 Fkbp1a Rat cadmium dichloride increases expression ISO FKBP1A (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of FKBP1A mRNA CTD PMID:33129824 Fkbp1a Rat calcidiol decreases expression EXP 6480464 Calcifediol deficiency results in decreased expression of FKBP1A mRNA CTD PMID:17293106 Fkbp1a Rat calcium atom multiple interactions ISO FKBP1A (Homo sapiens) 6480464 FKBP1A protein inhibits the reaction [Calcium results in increased activity of RYR2 protein] CTD PMID:17872463 Fkbp1a Rat calcium(0) multiple interactions ISO FKBP1A (Homo sapiens) 6480464 FKBP1A protein inhibits the reaction [Calcium results in increased activity of RYR2 protein] CTD PMID:17872463 Fkbp1a Rat carmustine decreases expression ISO FKBP1A (Homo sapiens) 6480464 Carmustine results in decreased expression of FKBP1A mRNA CTD PMID:15980968 Fkbp1a Rat chloropicrin decreases expression ISO FKBP1A (Homo sapiens) 6480464 chloropicrin results in decreased expression of FKBP1A mRNA CTD PMID:26352163 and PMID:28476498 Fkbp1a Rat chlorpyrifos increases expression ISO Fkbp1a (Mus musculus) 6480464 Chlorpyrifos results in increased expression of FKBP1A mRNA CTD PMID:37019170 Fkbp1a Rat chrysene decreases expression ISO Fkbp1a (Mus musculus) 6480464 chrysene results in decreased expression of FKBP1A mRNA CTD PMID:26377693 Fkbp1a Rat chrysene multiple interactions ISO Fkbp1a (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of FKBP1A mRNA CTD PMID:27858113 Fkbp1a Rat cisplatin increases expression ISO FKBP1A (Homo sapiens) 6480464 Cisplatin results in increased expression of FKBP1A mRNA CTD PMID:27392435 Fkbp1a Rat cobalt dichloride decreases expression ISO FKBP1A (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of FKBP1A mRNA CTD PMID:19376846 Fkbp1a Rat copper atom increases expression EXP 6480464 Copper results in increased expression of FKBP1A mRNA CTD PMID:22465980 Fkbp1a Rat copper atom multiple interactions ISO FKBP1A (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of FKBP1A mRNA CTD PMID:24690739 Fkbp1a Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of FKBP1A mRNA CTD PMID:22465980 Fkbp1a Rat copper(0) multiple interactions ISO FKBP1A (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of FKBP1A mRNA CTD PMID:24690739 Fkbp1a Rat copper(II) sulfate increases expression ISO FKBP1A (Homo sapiens) 6480464 Copper Sulfate results in increased expression of FKBP1A mRNA CTD PMID:19549813 Fkbp1a Rat dantrolene multiple interactions ISO Fkbp1a (Mus musculus) 6480464 Dantrolene inhibits the reaction [Halothane results in increased expression of FKBP1A mRNA] CTD PMID:32795494 Fkbp1a Rat dexamethasone multiple interactions ISO FKBP1A (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of FKBP1A mRNA CTD PMID:28628672 Fkbp1a Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of FKBP1A mRNA CTD PMID:21266533 Fkbp1a Rat dibutyl phthalate increases expression ISO Fkbp1a (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of FKBP1A mRNA CTD PMID:17361019 and PMID:21266533 Fkbp1a Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of FKBP1A mRNA CTD PMID:21266533 Fkbp1a Rat disulfiram multiple interactions ISO FKBP1A (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of FKBP1A mRNA CTD PMID:24690739 Fkbp1a Rat diuron increases expression EXP 6480464 Diuron results in increased expression of FKBP1A mRNA CTD PMID:21551480 Fkbp1a Rat diuron decreases expression ISO FKBP1A (Homo sapiens) 6480464 Diuron results in decreased expression of FKBP1A mRNA CTD PMID:35967413 Fkbp1a Rat doxorubicin affects response to substance ISO FKBP1A (Homo sapiens) 6480464 FKBP1A protein affects the susceptibility to Doxorubicin CTD PMID:16217747 Fkbp1a Rat doxorubicin decreases expression ISO FKBP1A (Homo sapiens) 6480464 Doxorubicin results in decreased expression of FKBP1A mRNA CTD PMID:29803840 Fkbp1a Rat elemental selenium increases expression ISO FKBP1A (Homo sapiens) 6480464 Selenium results in increased expression of FKBP1A mRNA CTD PMID:19244175 Fkbp1a Rat elemental selenium multiple interactions ISO FKBP1A (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of FKBP1A mRNA CTD PMID:19244175 Fkbp1a Rat enzyme inhibitor multiple interactions ISO FKBP1A (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of FKBP1A protein CTD PMID:23301498 Fkbp1a Rat ethanol increases expression ISO Fkbp1a (Mus musculus) 6480464 Ethanol results in increased expression of FKBP1A mRNA CTD PMID:30319688 Fkbp1a Rat ethanol multiple interactions ISO Fkbp1a (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of FKBP1A mRNA CTD PMID:30319688 Fkbp1a Rat fenthion increases expression ISO Fkbp1a (Mus musculus) 6480464 Fenthion results in increased expression of FKBP1A mRNA CTD PMID:34813904 Fkbp1a Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of FKBP1A mRNA CTD PMID:24136188 Fkbp1a Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of FKBP1A mRNA CTD PMID:24136188 Fkbp1a Rat folic acid decreases expression ISO Fkbp1a (Mus musculus) 6480464 Folic Acid results in decreased expression of FKBP1A mRNA CTD PMID:25629700 Fkbp1a Rat folic acid multiple interactions ISO Fkbp1a (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of FKBP1A mRNA CTD PMID:22206623 Fkbp1a Rat fumonisin B1 increases expression ISO Fkbp1a (Mus musculus) 6480464 fumonisin B1 results in increased expression of FKBP1A mRNA CTD PMID:16221962 Fkbp1a Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of FKBP1A mRNA CTD PMID:22061828 Fkbp1a Rat halothane increases expression ISO Fkbp1a (Mus musculus) 6480464 Halothane results in increased expression of FKBP1A mRNA CTD PMID:32795494 Fkbp1a Rat halothane multiple interactions ISO Fkbp1a (Mus musculus) 6480464 Dantrolene inhibits the reaction [Halothane results in increased expression of FKBP1A mRNA] and Ryanodine promotes the reaction [Halothane results in increased expression of FKBP1A mRNA] CTD PMID:32795494 Fkbp1a Rat hydrogen cyanide decreases expression ISO Fkbp1a (Mus musculus) 6480464 Hydrogen Cyanide results in decreased expression of FKBP1A mRNA CTD PMID:33914522 Fkbp1a Rat hydrogen peroxide increases expression EXP 6480464 Hydrogen Peroxide results in increased expression of FKBP1A mRNA and Hydrogen Peroxide results in increased expression of FKBP1A protein CTD PMID:15780950 Fkbp1a Rat hydrogen peroxide affects expression ISO FKBP1A (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of FKBP1A mRNA CTD PMID:21179406 Fkbp1a Rat indometacin multiple interactions EXP 6480464 rebamipide inhibits the reaction [Indomethacin results in increased expression of FKBP1A mRNA] CTD PMID:18299717 Fkbp1a Rat indometacin multiple interactions ISO FKBP1A (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of FKBP1A mRNA CTD PMID:28628672 Fkbp1a Rat indometacin increases expression EXP 6480464 Indomethacin results in increased expression of FKBP1A mRNA CTD PMID:18299717 Fkbp1a Rat inulin multiple interactions ISO Fkbp1a (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of FKBP1A mRNA CTD PMID:36331819 Fkbp1a Rat ivermectin decreases expression ISO FKBP1A (Homo sapiens) 6480464 Ivermectin results in decreased expression of FKBP1A protein CTD PMID:32959892 Fkbp1a Rat mercury dichloride increases expression EXP 6480464 Mercuric Chloride results in increased expression of FKBP1A mRNA CTD PMID:16507785 Fkbp1a Rat metformin multiple interactions ISO FKBP1A (Homo sapiens) 6480464 [Paclitaxel co-treated with Metformin] results in increased expression of FKBP1A mRNA CTD PMID:29309887 Fkbp1a Rat methidathion affects expression ISO Fkbp1a (Mus musculus) 6480464 methidathion affects the expression of FKBP1A mRNA CTD PMID:34813904 Fkbp1a Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of FKBP1A mRNA CTD PMID:30047161 Fkbp1a Rat methotrexate decreases expression ISO FKBP1A (Homo sapiens) 6480464 Methotrexate results in decreased expression of FKBP1A mRNA CTD PMID:24449571 Fkbp1a Rat mono(2-ethylhexyl) phthalate decreases expression ISO Fkbp1a (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of FKBP1A mRNA CTD PMID:22401849 Fkbp1a Rat N-nitrosodimethylamine decreases expression EXP 6480464 Dimethylnitrosamine results in decreased expression of FKBP1A mRNA CTD PMID:25380136 Fkbp1a Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of FKBP1A mRNA CTD PMID:24136188 Fkbp1a Rat nickel atom increases expression ISO FKBP1A (Homo sapiens) 6480464 Nickel results in increased expression of FKBP1A mRNA CTD PMID:24768652 and PMID:25583101 Fkbp1a Rat nickel sulfate decreases expression ISO FKBP1A (Homo sapiens) 6480464 nickel sulfate results in decreased expression of FKBP1A mRNA CTD PMID:22714537 Fkbp1a Rat nitrates multiple interactions ISO Fkbp1a (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of FKBP1A mRNA CTD PMID:35964746 Fkbp1a Rat Nutlin-3 multiple interactions ISO FKBP1A (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of FKBP1A protein CTD PMID:38460933 Fkbp1a Rat ochratoxin A increases expression ISO FKBP1A (Homo sapiens) 6480464 ochratoxin A results in increased expression of FKBP1A mRNA CTD PMID:29098329 Fkbp1a Rat ochratoxin A multiple interactions ISO FKBP1A (Homo sapiens) 6480464 [ochratoxin A results in increased acetylation of FKBP1A promoter] which results in increased expression of FKBP1A mRNA CTD PMID:29098329 Fkbp1a Rat ochratoxin A increases acetylation ISO FKBP1A (Homo sapiens) 6480464 ochratoxin A results in increased acetylation of FKBP1A promoter CTD PMID:29098329 Fkbp1a Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of FKBP1A mRNA CTD PMID:25729387 Fkbp1a Rat paclitaxel multiple interactions ISO FKBP1A (Homo sapiens) 6480464 [Paclitaxel co-treated with Metformin] results in increased expression of FKBP1A mRNA CTD PMID:29309887 Fkbp1a Rat paracetamol affects expression ISO Fkbp1a (Mus musculus) 6480464 Acetaminophen affects the expression of FKBP1A mRNA CTD PMID:17562736 Fkbp1a Rat paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of FKBP1A mRNA CTD PMID:18246545 Fkbp1a Rat PCB138 multiple interactions ISO Fkbp1a (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Fkbp1a Rat pentachlorophenol increases expression ISO Fkbp1a (Mus musculus) 6480464 Pentachlorophenol results in increased expression of FKBP1A mRNA CTD PMID:23892564 Fkbp1a Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Fkbp1a (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of FKBP1A mRNA more ... CTD PMID:36331819 Fkbp1a Rat perfluorooctanoic acid increases expression ISO Fkbp1a (Mus musculus) 6480464 perfluorooctanoic acid results in increased expression of FKBP1A mRNA CTD PMID:21318169 Fkbp1a Rat perfluorooctanoic acid multiple interactions ISO Fkbp1a (Mus musculus) 6480464 PPARA protein affects the reaction [perfluorooctanoic acid results in increased expression of FKBP1A mRNA] CTD PMID:21318169 Fkbp1a Rat phenobarbital multiple interactions ISO Fkbp1a (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of FKBP1A mRNA] CTD PMID:19482888 Fkbp1a Rat phenobarbital increases expression ISO Fkbp1a (Mus musculus) 6480464 Phenobarbital results in increased expression of FKBP1A mRNA CTD PMID:19363144 and PMID:19482888 Fkbp1a Rat picoxystrobin increases expression ISO FKBP1A (Homo sapiens) 6480464 picoxystrobin results in increased expression of FKBP1A mRNA CTD PMID:33512557 Fkbp1a Rat pioglitazone increases expression ISO FKBP1A (Homo sapiens) 6480464 Pioglitazone results in increased expression of FKBP1A mRNA CTD PMID:32589349 Fkbp1a Rat pirinixic acid increases expression ISO Fkbp1a (Mus musculus) 6480464 pirinixic acid results in increased expression of FKBP1A mRNA CTD PMID:15375163 more ... Fkbp1a Rat potassium cyanide increases expression ISO Fkbp1a (Mus musculus) 6480464 Potassium Cyanide results in increased expression of FKBP1A mRNA CTD PMID:33914522 Fkbp1a Rat propiconazole increases expression ISO Fkbp1a (Mus musculus) 6480464 propiconazole results in increased expression of FKBP1A mRNA CTD PMID:19363144 Fkbp1a Rat propiconazole increases expression EXP 6480464 propiconazole results in increased expression of FKBP1A mRNA CTD PMID:30047161 Fkbp1a Rat Rebamipide multiple interactions EXP 6480464 rebamipide inhibits the reaction [Indomethacin results in increased expression of FKBP1A mRNA] CTD PMID:18299717 Fkbp1a Rat rotenone decreases expression ISO Fkbp1a (Mus musculus) 6480464 Rotenone results in decreased expression of FKBP1A mRNA CTD PMID:23186747 Fkbp1a Rat ryanodine multiple interactions ISO Fkbp1a (Mus musculus) 6480464 Ryanodine promotes the reaction [Halothane results in increased expression of FKBP1A mRNA] CTD PMID:32795494 Fkbp1a Rat selenium atom increases expression ISO FKBP1A (Homo sapiens) 6480464 Selenium results in increased expression of FKBP1A mRNA CTD PMID:19244175 Fkbp1a Rat selenium atom multiple interactions ISO FKBP1A (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of FKBP1A mRNA CTD PMID:19244175 Fkbp1a Rat simvastatin decreases expression EXP 6480464 Simvastatin results in decreased expression of FKBP1A mRNA CTD PMID:16414398 Fkbp1a Rat sirolimus affects binding ISO FKBP1A (Homo sapiens) 6480464 Sirolimus binds to FKBP1A protein CTD PMID:17438408 Fkbp1a Rat sirolimus affects binding EXP 6480464 Sirolimus binds to FKBP1A protein CTD PMID:17438408 and PMID:7532117 Fkbp1a Rat sirolimus multiple interactions EXP 6480464 immunomycin inhibits the reaction [Sirolimus binds to FKBP1A protein] CTD PMID:7532117 Fkbp1a Rat sirolimus affects binding ISO Fkbp1a (Mus musculus) 6480464 Sirolimus binds to FKBP1A protein CTD PMID:7503980 Fkbp1a Rat sirolimus multiple interactions ISO Fkbp1a (Mus musculus) 6480464 [Sirolimus binds to FKBP1A protein] which results in decreased expression of IL2RG mRNA more ... CTD PMID:12531798 and PMID:7503980 Fkbp1a Rat sirolimus multiple interactions ISO FKBP1A (Homo sapiens) 6480464 [Sirolimus binds to FKBP1A protein] which results in increased activity of TGFB1 protein and [Tacrolimus binds to FKBP1A protein] inhibits the reaction [Sirolimus binds to FKBP1A protein] CTD PMID:10361256 and PMID:12417722 Fkbp1a Rat sodium arsenite decreases expression ISO FKBP1A (Homo sapiens) 6480464 sodium arsenite results in decreased expression of FKBP1A mRNA CTD PMID:22714537 Fkbp1a Rat sodium arsenite increases expression ISO FKBP1A (Homo sapiens) 6480464 sodium arsenite results in increased expression of FKBP1A mRNA CTD PMID:38568856 Fkbp1a Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of FKBP1A mRNA CTD PMID:30047161 Fkbp1a Rat sulindac decreases expression EXP 6480464 Sulindac results in decreased expression of FKBP1A mRNA CTD PMID:24136188 Fkbp1a Rat tacrolimus (anhydrous) affects binding ISO FKBP1A (Homo sapiens) 329848996 tacrolimus affects binding of Fkbp12 to type 1 receptors in 293T cells RGD Fkbp1a Rat tacrolimus hydrate multiple interactions ISO FKBP1A (Homo sapiens) 6480464 [Tacrolimus binds to FKBP1A protein] inhibits the reaction [Sirolimus binds to FKBP1A protein] more ... CTD PMID:10361256 and PMID:16720724 Fkbp1a Rat tacrolimus hydrate increases expression EXP 6480464 Tacrolimus results in increased expression of FKBP1A protein CTD PMID:11041285 Fkbp1a Rat tert-butyl hydroperoxide increases expression ISO FKBP1A (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of FKBP1A mRNA CTD PMID:15336504 Fkbp1a Rat Tetrachlorobisphenol A multiple interactions ISO Fkbp1a (Mus musculus) 6480464 U 0126 inhibits the reaction [tetrachlorodian results in increased expression of FKBP1A mRNA] and Wortmannin inhibits the reaction [tetrachlorodian results in increased expression of FKBP1A mRNA] CTD PMID:37992829 Fkbp1a Rat Tetrachlorobisphenol A increases expression ISO FKBP1A (Homo sapiens) 6480464 tetrachlorodian results in increased expression of FKBP1A mRNA CTD PMID:33582643 and PMID:36190352 Fkbp1a Rat Tetrachlorobisphenol A multiple interactions ISO FKBP1A (Homo sapiens) 6480464 4-(6-bromo-1 more ... CTD PMID:36190352 Fkbp1a Rat Tetrachlorobisphenol A increases expression ISO Fkbp1a (Mus musculus) 6480464 tetrachlorodian results in increased expression of FKBP1A mRNA CTD PMID:37992829 Fkbp1a Rat Tetrachlorobisphenol A affects expression EXP 6480464 tetrachlorodian affects the expression of FKBP1A mRNA CTD PMID:37992829 Fkbp1a Rat tetrachloroethene decreases expression ISO Fkbp1a (Mus musculus) 6480464 Tetrachloroethylene results in decreased expression of FKBP1A mRNA CTD PMID:28973375 Fkbp1a Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of FKBP1A mRNA CTD PMID:16239168 Fkbp1a Rat tetrachloromethane increases expression ISO Fkbp1a (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of FKBP1A mRNA CTD PMID:27339419 and PMID:31919559 Fkbp1a Rat tetraphene decreases expression ISO Fkbp1a (Mus musculus) 6480464 benz(a)anthracene results in decreased expression of FKBP1A mRNA CTD PMID:26377693 Fkbp1a Rat tetraphene multiple interactions ISO Fkbp1a (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of FKBP1A mRNA CTD PMID:27858113 Fkbp1a Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of FKBP1A mRNA CTD PMID:34492290 Fkbp1a Rat titanium dioxide decreases methylation ISO Fkbp1a (Mus musculus) 6480464 titanium dioxide results in decreased methylation of FKBP1A gene CTD PMID:35295148 Fkbp1a Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of FKBP1A mRNA CTD PMID:25729387 Fkbp1a Rat triadimefon increases expression ISO Fkbp1a (Mus musculus) 6480464 triadimefon results in increased expression of FKBP1A mRNA CTD PMID:19363144 Fkbp1a Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of FKBP1A mRNA CTD PMID:19448997 and PMID:33387578 Fkbp1a Rat trimellitic anhydride increases expression ISO Fkbp1a (Mus musculus) 6480464 trimellitic anhydride results in increased expression of FKBP1A mRNA CTD PMID:19042947 Fkbp1a Rat triphenyl phosphate affects expression ISO FKBP1A (Homo sapiens) 6480464 triphenyl phosphate affects the expression of FKBP1A mRNA CTD PMID:37042841 Fkbp1a Rat triptonide decreases expression ISO Fkbp1a (Mus musculus) 6480464 triptonide results in decreased expression of FKBP1A mRNA CTD PMID:33045310 Fkbp1a Rat valproic acid affects expression ISO FKBP1A (Homo sapiens) 6480464 Valproic Acid affects the expression of FKBP1A mRNA CTD PMID:25979313 Fkbp1a Rat valproic acid increases expression ISO FKBP1A (Homo sapiens) 6480464 Valproic Acid results in increased expression of FKBP1A mRNA CTD PMID:23179753 more ... Fkbp1a Rat vincaleukoblastine affects response to substance ISO FKBP1A (Homo sapiens) 6480464 FKBP1A protein affects the susceptibility to Vinblastine CTD PMID:16217747 Fkbp1a Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of FKBP1A mRNA CTD PMID:22570695 Fkbp1a Rat vitamin E multiple interactions ISO FKBP1A (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of FKBP1A mRNA CTD PMID:19244175 Fkbp1a Rat vitamin E increases expression ISO FKBP1A (Homo sapiens) 6480464 Vitamin E results in increased expression of FKBP1A mRNA CTD PMID:19244175 Fkbp1a Rat wortmannin multiple interactions ISO Fkbp1a (Mus musculus) 6480464 Wortmannin inhibits the reaction [tetrachlorodian results in increased expression of FKBP1A mRNA] CTD PMID:37992829 Fkbp1a Rat wortmannin multiple interactions ISO FKBP1A (Homo sapiens) 6480464 Wortmannin inhibits the reaction [tetrachlorodian results in increased expression of FKBP1A mRNA] CTD PMID:36190352 Fkbp1a Rat zoledronic acid increases expression ISO FKBP1A (Homo sapiens) 6480464 zoledronic acid results in increased expression of FKBP1A mRNA CTD PMID:24714768 Fkbp1a Rat zotarolimus affects binding ISO FKBP1A (Homo sapiens) 6480464 zotarolimus binds to FKBP1A protein CTD PMID:17438408 Fkbp1a Rat zotarolimus affects binding EXP 6480464 zotarolimus binds to FKBP1A protein CTD PMID:17438408
Imported Annotations - PID (archival)
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 14-Deoxy-11,12-didehydroandrographolide (ISO) 17beta-estradiol (ISO) 1H-pyrazole (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 3,4-methylenedioxymethamphetamine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) 6-propyl-2-thiouracil (EXP) actinomycin D (ISO) Aflatoxin B2 alpha (ISO) amitrole (EXP) arsenite(3-) (ISO) asbestos (ISO) ascomycin (EXP,ISO) atrazine (ISO) benzene (ISO) benzo[a]pyrene (EXP,ISO) benzo[b]fluoranthene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (EXP) bleomycin A5 (ISO) bortezomib (ISO) Brodifacoum (EXP) butan-1-ol (ISO) cadmium atom (ISO) cadmium dichloride (ISO) calcidiol (EXP) calcium atom (ISO) calcium(0) (ISO) carmustine (ISO) chloropicrin (ISO) chlorpyrifos (ISO) chrysene (ISO) cisplatin (ISO) cobalt dichloride (ISO) copper atom (EXP,ISO) copper(0) (EXP,ISO) copper(II) sulfate (ISO) dantrolene (ISO) dexamethasone (ISO) dibutyl phthalate (EXP,ISO) disulfiram (ISO) diuron (EXP,ISO) doxorubicin (ISO) elemental selenium (ISO) enzyme inhibitor (ISO) ethanol (ISO) fenthion (ISO) finasteride (EXP) flutamide (EXP) folic acid (ISO) fumonisin B1 (ISO) gentamycin (EXP) halothane (ISO) hydrogen cyanide (ISO) hydrogen peroxide (EXP,ISO) indometacin (EXP,ISO) inulin (ISO) ivermectin (ISO) mercury dichloride (EXP) metformin (ISO) methidathion (ISO) methimazole (EXP) methotrexate (ISO) mono(2-ethylhexyl) phthalate (ISO) N-nitrosodimethylamine (EXP) nefazodone (EXP) nickel atom (ISO) nickel sulfate (ISO) nitrates (ISO) Nutlin-3 (ISO) ochratoxin A (ISO) oxaliplatin (EXP) paclitaxel (ISO) paracetamol (EXP,ISO) PCB138 (ISO) pentachlorophenol (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) picoxystrobin (ISO) pioglitazone (ISO) pirinixic acid (ISO) potassium cyanide (ISO) propiconazole (EXP,ISO) Rebamipide (EXP) rotenone (ISO) ryanodine (ISO) selenium atom (ISO) simvastatin (EXP) sirolimus (EXP,ISO) sodium arsenite (ISO) sulfadimethoxine (EXP) sulindac (EXP) tacrolimus (anhydrous) (ISO) tacrolimus hydrate (EXP,ISO) tert-butyl hydroperoxide (ISO) Tetrachlorobisphenol A (EXP,ISO) tetrachloroethene (ISO) tetrachloromethane (EXP,ISO) tetraphene (ISO) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) triadimefon (ISO) trichloroethene (EXP) trimellitic anhydride (ISO) triphenyl phosphate (ISO) triptonide (ISO) valproic acid (ISO) vincaleukoblastine (ISO) vinclozolin (EXP) vitamin E (ISO) wortmannin (ISO) zoledronic acid (ISO) zotarolimus (EXP,ISO)
1.
Perinatal iron deficiency results in altered developmental expression of genes mediating energy metabolism and neuronal morphogenesis in hippocampus.
Carlson ES, etal., Hippocampus. 2007;17(8):679-91.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
mTOR signaling in growth control and disease.
Laplante M and Sabatini DM, Cell. 2012 Apr 13;149(2):274-93. doi: 10.1016/j.cell.2012.03.017.
4.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
5.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.
Increased striatal mRNA and protein levels of the immunophilin FKBP-12 in experimental Parkinson's disease and identification of FKBP-12-binding proteins.
Nilsson A, etal., J Proteome Res. 2007 Oct;6(10):3952-61. Epub 2007 Sep 18.
7.
Cyclic ADP-ribose binds to FK506-binding protein 12.6 to release Ca2+ from islet microsomes.
Noguchi N, etal., J Biol Chem 1997 Feb 7;272(6):3133-6.
8.
Online Mendelian Inheritance in Man, OMIM (TM).
Online Mendelian Inheritance in Man, OMIM (TM).
9.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
10.
Rapamycin inhibits vascular smooth muscle cell migration.
Poon M, etal., J Clin Invest 1996 Nov 15;98(10):2277-83.
11.
GOA pipeline
RGD automated data pipeline
12.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
13.
FK506 binding protein 12 is expressed in rat penile innervation and upregulated after cavernous nerve injury.
Sezen SF, etal., Int J Impot Res. 2002 Dec;14(6):506-12.
14.
Mechanisms of TGF-beta signaling from cell membrane to the nucleus.
Shi Y and Massague J, Cell. 2003 Jun 13;113(6):685-700.
15.
Cardiac defects and altered ryanodine receptor function in mice lacking FKBP12.
Shou W, etal., Nature. 1998 Jan 29;391(6666):489-92.
16.
FK506 activates BMPR2, rescues endothelial dysfunction, and reverses pulmonary hypertension.
Spiekerkoetter E, etal., J Clin Invest. 2013 Aug;123(8):3600-13. doi: 10.1172/JCI65592. Epub 2013 Jul 15.
17.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
18.
Specific interaction of type I receptors of the TGF-beta family with the immunophilin FKBP-12.
Wang T, etal., Science. 1994 Jul 29;265(5172):674-6.
Fkbp1a Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 160,500,748 - 160,520,492 (+) NCBI GRCr8 mRatBN7.2 3 140,040,359 - 140,060,107 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 140,040,278 - 140,060,743 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 143,944,928 - 143,964,668 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 152,528,701 - 152,548,443 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 150,269,170 - 150,288,910 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 147,042,944 - 147,062,725 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 147,042,944 - 147,062,724 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 153,399,455 - 153,418,857 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 141,861,237 - 141,880,797 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 141,766,809 - 141,786,369 (+) NCBI Celera 3 138,799,643 - 138,819,482 (+) NCBI Celera Cytogenetic Map 3 q41 NCBI
FKBP1A Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 1,368,978 - 1,393,054 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 1,368,977 - 1,393,164 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 1,349,622 - 1,373,698 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 1,297,622 - 1,321,745 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 20 1,300,375 - 1,321,745 NCBI Celera 20 1,445,967 - 1,470,163 (-) NCBI Celera Cytogenetic Map 20 p13 NCBI HuRef 20 1,302,109 - 1,326,302 (-) NCBI HuRef CHM1_1 20 1,349,285 - 1,373,817 (-) NCBI CHM1_1 T2T-CHM13v2.0 20 1,418,161 - 1,442,241 (-) NCBI T2T-CHM13v2.0
Fkbp1a Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 151,384,403 - 151,403,611 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 151,384,403 - 151,403,612 (+) Ensembl GRCm39 Ensembl GRCm38 2 151,542,483 - 151,561,691 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 151,542,483 - 151,561,692 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 151,368,235 - 151,387,427 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 151,234,062 - 151,253,132 (+) NCBI MGSCv36 mm8 Celera 2 157,359,901 - 157,379,075 (+) NCBI Celera Cytogenetic Map 2 G3 NCBI cM Map 2 74.83 NCBI
Fkbp1a Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955596 580,106 - 603,255 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955596 580,106 - 606,210 (-) NCBI ChiLan1.0 ChiLan1.0
FKBP1A Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 21 2,399,937 - 2,432,330 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 20 2,396,766 - 2,426,602 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 20 1,519,330 - 1,548,473 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 20 1,292,519 - 1,298,888 (-) NCBI panpan1.1 PanPan1.1 panPan2
FKBP1A Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 24 19,618,581 - 19,643,685 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 24 19,618,558 - 19,643,046 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 ROS_Cfam_1.0 24 20,310,591 - 20,335,863 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 24 20,310,075 - 20,335,863 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 24 19,587,096 - 19,612,324 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 24 19,692,087 - 19,717,321 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 24 20,122,927 - 20,148,189 (+) NCBI UU_Cfam_GSD_1.0
Fkbp1a
FKBP1A
FKBP1A
Fkbp1a
.
Predicted Target Of
Count of predictions: 708 Count of miRNA genes: 273 Interacting mature miRNAs: 335 Transcripts: ENSRNOT00000012608 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
2312673 Scl63 Serum cholesterol level QTL 63 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 98535255 168026850 Rat 1598877 Bp285 Blood pressure QTL 285 1.5 0.03 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 120538241 165538241 Rat 1578653 Vnigr3 Vascular neointimal growth QTL 3 3.1 artery morphology trait (VT:0002191) artery neointimal hyperplastic lesion area (CMO:0001414) 3 130656562 169034231 Rat 2302373 Gluco39 Glucose level QTL 39 5.01 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 3 98535386 161695835 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 2298477 Eau4 Experimental allergic uveoretinitis QTL 4 0.0011 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 3 137398739 169034231 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 1578754 Stresp16 Stress response QTL 16 4 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 3 112681431 157681431 Rat 1300173 Rf11 Renal function QTL 11 3.38 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 3 121056165 145956249 Rat 9589106 Insul23 Insulin level QTL 23 13.86 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 3 131635904 169034231 Rat 10755461 Coatc16 Coat color QTL 16 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 3 122438700 167438700 Rat 8662816 Vetf4 Vascular elastic tissue fragility QTL 4 4 renal artery integrity trait (VT:0010642) number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563) 3 59242096 157323038 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 1354611 Despr2 Despair related QTL 2 3.03 0.0028 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 3 97084464 142084464 Rat 2303620 Vencon4 Ventilatory control QTL 4 3.9 respiration trait (VT:0001943) tidal volume (CMO:0000222) 3 127162703 168026850 Rat 631841 Niddm39 Non-insulin dependent diabetes mellitus QTL 39 3.36 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 94856903 159898684 Rat 1576306 Schws3 Schwannoma susceptibility QTL 3 0.001 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 3 118839124 163839124 Rat 619618 Rf3 Renal disease susceptibility QTL 3 6.5 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate to body weight ratio (CMO:0001270) 3 107693393 152693393 Rat 1300159 Kidm4 Kidney mass QTL 4 3.83 kidney mass (VT:0002707) right kidney wet weight to body weight ratio (CMO:0001953) 3 121056165 157309487 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 2312659 Slep7 Serum leptin concentration QTL 7 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 3 98535255 168026850 Rat 631673 Iddm13 Insulin dependent diabetes mellitus QTL 13 1.3 0.663 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 3 130193298 161695983 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 1581546 Pur13 Proteinuria QTL 13 2.93 0.0335 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 3 78196190 146592722 Rat 1578656 Vnigr2 Vascular neointimal growth QTL 2 4.2 artery morphology trait (VT:0002191) lesioned artery residual lumen area (CMO:0001417) 3 130656562 169034231 Rat 8552952 Pigfal13 Plasma insulin-like growth factor 1 level QTL 13 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 3 138799500 169034231 Rat 631541 Bp81 Blood pressure QTL 81 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 124122556 169034231 Rat 2293087 Iddm27 Insulin dependent diabetes mellitus QTL 27 2.68 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 97551417 147415807 Rat 2312670 Bw94 Body weight QTL 94 0.01 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 3 98535255 168026850 Rat 724532 Cm17 Cardiac mass QTL 17 2 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 3 95735366 140735366 Rat
RH141052
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 140,057,991 - 140,059,161 (+) MAPPER mRatBN7.2 mRatBN7.2 1 78,470,296 - 78,470,512 (+) MAPPER mRatBN7.2 Rnor_6.0 1 79,729,111 - 79,729,326 NCBI Rnor6.0 Rnor_6.0 3 147,060,614 - 147,061,783 NCBI Rnor6.0 Rnor_5.0 3 153,416,746 - 153,417,915 UniSTS Rnor5.0 Rnor_5.0 1 80,991,514 - 80,991,729 UniSTS Rnor5.0 RGSC_v3.4 3 141,878,686 - 141,879,855 UniSTS RGSC3.4 RGSC_v3.4 1 78,174,294 - 78,174,509 UniSTS RGSC3.4 Celera 1 72,937,410 - 72,937,625 UniSTS Celera 3 138,817,371 - 138,818,540 UniSTS RH 3.4 Map 1 791.5 UniSTS Cytogenetic Map 3 q41 UniSTS Cytogenetic Map 1 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000012608 ⟹ ENSRNOP00000012608
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 140,040,278 - 140,060,743 (+) Ensembl Rnor_6.0 Ensembl 3 147,042,944 - 147,062,724 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000105280 ⟹ ENSRNOP00000097913
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 140,040,309 - 140,060,100 (+) Ensembl
RefSeq Acc Id:
NM_013102 ⟹ NP_037234
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 160,500,748 - 160,520,492 (+) NCBI mRatBN7.2 3 140,040,359 - 140,060,103 (+) NCBI Rnor_6.0 3 147,042,944 - 147,062,725 (+) NCBI Rnor_5.0 3 153,399,455 - 153,418,857 (+) NCBI RGSC_v3.4 3 141,861,237 - 141,880,797 (+) RGD Celera 3 138,799,643 - 138,819,482 (+) RGD
Sequence:
CTCCACGCCGCCCGTCGCGCCTCCACCCGCGTCCTTCTCCTCCGCCAACGCCGCCGCCGCCGCCGCCGCCGCCATGGGAGTGCAGGTGGAGACCATCTCTTCTGGAGACGGGCGCACCTTCCCGAAGC
hide sequence
RefSeq Acc Id:
XM_039104385 ⟹ XP_038960313
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 160,503,464 - 160,520,492 (+) NCBI mRatBN7.2 3 140,043,135 - 140,060,107 (+) NCBI
RefSeq Acc Id:
NP_037234 ⟸ NM_013102
- UniProtKB:
A0JN04 (UniProtKB/Swiss-Prot), P97533 (UniProtKB/Swiss-Prot), Q62658 (UniProtKB/Swiss-Prot), A6KHI5 (UniProtKB/TrEMBL), A0A8L2UIH3 (UniProtKB/TrEMBL)
- Sequence:
MGVQVETISSGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFTLGKQEVIRGWEEGVAQMSVGQRAKLIISPDYAYGATGHPGIIPPHATLVFDVELLKLE
hide sequence
Ensembl Acc Id:
ENSRNOP00000012608 ⟸ ENSRNOT00000012608
RefSeq Acc Id:
XP_038960313 ⟸ XM_039104385
- Peptide Label:
isoform X1
- UniProtKB:
A6KHI7 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000097913 ⟸ ENSRNOT00000105280
RGD ID: 13692523 Promoter ID: EPDNEW_R3048 Type: initiation region Name: Fkbp1a_1 Description: FK506 binding protein 1a SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 147,042,900 - 147,042,960 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2018-11-09
Fkbp1a
FKBP prolyl isomerase 1A
Fkbp1a
FK506 binding protein 1a
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-09-28
Fkbp1a
FK506-binding protein 1a
Fkbp2
FK506 binding protein 2
Data merged from RGD:2618
737654 APPROVED
2002-11-06
Fkbp1a
FK506-binding protein 1a
FK506-binding protein 1 (12kD)
Name updated
625702 APPROVED
2002-06-10
Fkbp1a
FK506-binding protein 1 (12kD)
Symbol and Name status set to approved
70586 APPROVED
2002-06-10
Fkbp2
FK506 binding protein 2
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_process
inhibits aortic vascular smooth muscle cell proliferation and migration
69838
gene_protein
108 amino acids
61587
