Fkbp1a (FKBP prolyl isomerase 1A)

Gene: Fkbp1a (FKBP prolyl isomerase 1A) Rattus norvegicus

Analyze

Symbol:

Fkbp1a

Name:

FKBP prolyl isomerase 1A

RGD ID:

2617

Description:

Enables several functions, including FK506 binding activity; Hsp70 protein binding activity; and type I transforming growth factor beta receptor binding activity. Involved in response to iron ion. Located in axon terminus. Biomarker of Parkinsonism. Orthologous to several human genes including FKBP1A (FKBP prolyl isomerase 1A); PARTICIPATES IN activin signaling pathway; mTOR signaling pathway; transforming growth factor-beta Smad dependent signaling pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

12 kDa FK506-binding protein; 12 kDa FKBP; FK506 binding protein 1a; FK506 binding protein 2; FK506 binding protein 2 (13 kDa); FK506-binding protein 1 (12kD); FK506-binding protein 1a; FKBP-12; FKBP-1A; FKBP12; Fkbp2; immunophilin FKBP12; MGC156543; peptidyl-prolyl cis-trans isomerase FKBP1A; PPIase FKBP1A; rotamase

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FKBP1A (FKBP prolyl isomerase 1A)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):	Fkbp1a (FK506 binding protein 1a)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Fkbp1a (FKBP prolyl isomerase 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FKBP1A (FKBP prolyl isomerase 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FKBP1A (FKBP prolyl isomerase 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Fkbp1a (FKBP prolyl isomerase 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FKBP1A (FKBP prolyl isomerase 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FKBP1A (FKBP prolyl isomerase 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Fkbp1a (FKBP prolyl isomerase 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	FKBP1C (FKBP prolyl isomerase family member 1C)	HGNC	Ensembl, OrthoDB, Panther, PhylomeDB
Homo sapiens (human):	FKBP1B (FKBP prolyl isomerase 1B)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	FKBP1A (FKBP prolyl isomerase 1A)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Fkbp1a (FK506 binding protein 1a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	FKBP1C (FKBP prolyl isomerase family member 1C)	Alliance	DIOPT (Ensembl Compara\|OMA\|PANTHER)
Danio rerio (zebrafish):	fkbp1aa (FKBP prolyl isomerase 1Aa)	Alliance	DIOPT (Hieranoid\|OMA\|PANTHER)
Danio rerio (zebrafish):	fkbp1ab (FKBP prolyl isomerase 1Ab)	Alliance	DIOPT (Hieranoid\|OMA\|PANTHER)
Saccharomyces cerevisiae (baker's yeast):	FPR1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Fkbp12	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	fkb-2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	160,500,748 - 160,520,492 (+)	NCBI		GRCr8
mRatBN7.2	3	140,040,359 - 140,060,107 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	140,040,278 - 140,060,743 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	143,944,928 - 143,964,668 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	152,528,701 - 152,548,443 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	150,269,170 - 150,288,910 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	147,042,944 - 147,062,725 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	147,042,944 - 147,062,724 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	153,399,455 - 153,418,857 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	141,861,237 - 141,880,797 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	141,766,809 - 141,786,369 (+)	NCBI
Celera	3	138,799,643 - 138,819,482 (+)	NCBI		Celera
Cytogenetic Map	3	q41	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Barth syndrome (ISS)

congenital heart disease (ISO)

esophagus squamous cell carcinoma (ISO)

Experimental Liver Cirrhosis (ISO)

genetic disease (ISO)

Parkinsonism (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

14-Deoxy-11,12-didehydroandrographolide (ISO)

17beta-estradiol (ISO)

1H-pyrazole (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

3,4-methylenedioxymethamphetamine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3H-1,2-dithiole-3-thione (EXP)

4,4'-sulfonyldiphenol (EXP)

6-propyl-2-thiouracil (EXP)

Aflatoxin B2 alpha (ISO)

amitrole (EXP)

arsenite(3-) (ISO)

asbestos (ISO)

ascomycin (EXP,ISO)

atrazine (ISO)

benzene (ISO)

benzo[a]pyrene (EXP,ISO)

benzo[b]fluoranthene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

bleomycin A5 (ISO)

bortezomib (ISO)

Brodifacoum (EXP)

butan-1-ol (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

calcidiol (EXP)

calcium atom (ISO)

calcium(0) (ISO)

carmustine (ISO)

chloropicrin (ISO)

chlorpyrifos (ISO)

chrysene (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

copper(II) sulfate (ISO)

dantrolene (ISO)

dexamethasone (ISO)

dibutyl phthalate (EXP,ISO)

disulfiram (ISO)

diuron (EXP,ISO)

doxorubicin (ISO)

elemental selenium (ISO)

enzyme inhibitor (ISO)

ethanol (ISO)

fenthion (ISO)

finasteride (EXP)

flutamide (EXP)

folic acid (ISO)

fumonisin B1 (ISO)

gentamycin (EXP)

halothane (ISO)

hydrogen cyanide (ISO)

hydrogen peroxide (EXP,ISO)

indometacin (EXP,ISO)

inulin (ISO)

ivermectin (ISO)

mercury dichloride (EXP)

metformin (ISO)

methidathion (ISO)

methimazole (EXP)

methotrexate (ISO)

mono(2-ethylhexyl) phthalate (ISO)

N-nitrosodimethylamine (EXP)

nefazodone (EXP)

nickel atom (ISO)

nickel sulfate (ISO)

ochratoxin A (ISO)

oxaliplatin (EXP)

paclitaxel (ISO)

paracetamol (EXP,ISO)

PCB138 (ISO)

pentachlorophenol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

picoxystrobin (ISO)

pioglitazone (ISO)

pirinixic acid (ISO)

potassium cyanide (ISO)

propiconazole (EXP,ISO)

Rebamipide (EXP)

rotenone (ISO)

ryanodine (ISO)

selenium atom (ISO)

simvastatin (EXP)

sirolimus (EXP,ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

sulindac (EXP)

tacrolimus (anhydrous) (ISO)

tacrolimus hydrate (EXP,ISO)

tert-butyl hydroperoxide (ISO)

Tetrachlorobisphenol A (ISO)

tetrachloroethene (ISO)

tetrachloromethane (EXP,ISO)

tetraphene (ISO)

thioacetamide (EXP)

topotecan (EXP)

triadimefon (ISO)

trichloroethene (EXP)

trimellitic anhydride (ISO)

triptonide (ISO)

valproic acid (ISO)

vincaleukoblastine (ISO)

vinclozolin (EXP)

vitamin E (ISO)

wortmannin (ISO)

zoledronic acid (ISO)

zotarolimus (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

amyloid fibril formation (ISO)

cytokine-mediated signaling pathway (ISO)

heart morphogenesis (ISO)

heart trabecula formation (ISO)

muscle contraction (ISO)

negative regulation of activin receptor signaling pathway (ISO)

negative regulation of transforming growth factor beta receptor signaling pathway (ISO)

positive regulation of canonical NF-kappaB signal transduction (ISO)

regulation of amyloid precursor protein catabolic process (ISO)

regulation of immune response (ISO)

regulation of protein localization (ISO)

regulation of skeletal muscle contraction by regulation of release of sequestered calcium ion (ISO)

release of sequestered calcium ion into cytosol (ISO)

response to caffeine (ISO)

response to iron ion (IEP)

supramolecular fiber organization (ISO)

T cell proliferation (ISO)

ventricular cardiac muscle tissue morphogenesis (ISO)

Cellular Component

axon terminus (IDA)

cytoplasm (IBA,ISO)

cytoplasmic side of membrane (ISS)

cytosol (ISO)

membrane (ISO)

ryanodine receptor complex (ISS)

sarcoplasmic reticulum (IEA,ISS)

sarcoplasmic reticulum membrane (IBA,IEA,ISO)

synapse (ISO)

Z disc (ISO)

Molecular Function

activin receptor binding (ISO)

channel regulator activity (ISO)

enzyme binding (IPI)

FK506 binding (IDA,ISO)

Hsp70 protein binding (IPI)

I-SMAD binding (ISO)

identical protein binding (ISO)

peptidyl-prolyl cis-trans isomerase activity (IBA,IEA,ISO)

protein binding (IPI,ISO)

signaling receptor inhibitor activity (ISO)

transforming growth factor beta receptor binding (IDA)

transmembrane transporter binding (ISO)

type I transforming growth factor beta receptor binding (IDA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

activin signaling pathway (ISO)

mTOR signaling pathway (ISO)

transforming growth factor-beta Smad dependent signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Perinatal iron deficiency results in altered developmental expression of genes mediating energy metabolism and neuronal morphogenesis in hippocampus.	Carlson ES, etal., Hippocampus. 2007;17(8):679-91.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	mTOR signaling in growth control and disease.	Laplante M and Sabatini DM, Cell. 2012 Apr 13;149(2):274-93. doi: 10.1016/j.cell.2012.03.017.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	Increased striatal mRNA and protein levels of the immunophilin FKBP-12 in experimental Parkinson's disease and identification of FKBP-12-binding proteins.	Nilsson A, etal., J Proteome Res. 2007 Oct;6(10):3952-61. Epub 2007 Sep 18.
7.	Cyclic ADP-ribose binds to FK506-binding protein 12.6 to release Ca2+ from islet microsomes.	Noguchi N, etal., J Biol Chem 1997 Feb 7;272(6):3133-6.
8.	Online Mendelian Inheritance in Man, OMIM (TM).	Online Mendelian Inheritance in Man, OMIM (TM).
9.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
10.	Rapamycin inhibits vascular smooth muscle cell migration.	Poon M, etal., J Clin Invest 1996 Nov 15;98(10):2277-83.
11.	GOA pipeline	RGD automated data pipeline
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	FK506 binding protein 12 is expressed in rat penile innervation and upregulated after cavernous nerve injury.	Sezen SF, etal., Int J Impot Res. 2002 Dec;14(6):506-12.
14.	Mechanisms of TGF-beta signaling from cell membrane to the nucleus.	Shi Y and Massague J, Cell. 2003 Jun 13;113(6):685-700.
15.	Cardiac defects and altered ryanodine receptor function in mice lacking FKBP12.	Shou W, etal., Nature. 1998 Jan 29;391(6666):489-92.
16.	FK506 activates BMPR2, rescues endothelial dysfunction, and reverses pulmonary hypertension.	Spiekerkoetter E, etal., J Clin Invest. 2013 Aug;123(8):3600-13. doi: 10.1172/JCI65592. Epub 2013 Jul 15.
17.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
18.	Specific interaction of type I receptors of the TGF-beta family with the immunophilin FKBP-12.	Wang T, etal., Science. 1994 Jul 29;265(5172):674-6.

Additional References at PubMed

PMID:1696686	PMID:1701173	PMID:1722474	PMID:2477715	PMID:7592869	PMID:9880681	PMID:12443530	PMID:12704193	PMID:12761501	PMID:14592808	PMID:14605212	PMID:15199065
PMID:15289441	PMID:15467718	PMID:15489334	PMID:16720724	PMID:17313373	PMID:17921453	PMID:17962721	PMID:18346205	PMID:18684528	PMID:19198614	PMID:20431056	PMID:21255728
PMID:22363773	PMID:22750946	PMID:22871113	PMID:23376485	PMID:24499793	PMID:24534009	PMID:29229832

Genomics

Comparative Map Data

Fkbp1a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	160,500,748 - 160,520,492 (+)	NCBI		GRCr8
mRatBN7.2	3	140,040,359 - 140,060,107 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	140,040,278 - 140,060,743 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	143,944,928 - 143,964,668 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	152,528,701 - 152,548,443 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	150,269,170 - 150,288,910 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	147,042,944 - 147,062,725 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	147,042,944 - 147,062,724 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	153,399,455 - 153,418,857 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	141,861,237 - 141,880,797 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	141,766,809 - 141,786,369 (+)	NCBI
Celera	3	138,799,643 - 138,819,482 (+)	NCBI		Celera
Cytogenetic Map	3	q41	NCBI

FKBP1A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	1,368,978 - 1,393,054 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	1,368,977 - 1,393,164 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	20	1,349,622 - 1,373,698 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	1,297,622 - 1,321,745 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	20	1,300,375 - 1,321,745	NCBI
Celera	20	1,445,967 - 1,470,163 (-)	NCBI		Celera
Cytogenetic Map	20	p13	NCBI
HuRef	20	1,302,109 - 1,326,302 (-)	NCBI		HuRef
CHM1_1	20	1,349,285 - 1,373,817 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	20	1,418,161 - 1,442,241 (-)	NCBI		T2T-CHM13v2.0

Fkbp1a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	151,384,403 - 151,403,611 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	151,384,403 - 151,403,612 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	151,542,483 - 151,561,691 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	151,542,483 - 151,561,692 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	151,368,235 - 151,387,427 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	151,234,062 - 151,253,132 (+)	NCBI		MGSCv36	mm8
Celera	2	157,359,901 - 157,379,075 (+)	NCBI		Celera
Cytogenetic Map	2	G3	NCBI
cM Map	2	74.83	NCBI

Fkbp1a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955596	580,106 - 603,255 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955596	580,106 - 606,210 (-)	NCBI	ChiLan1.0	ChiLan1.0

FKBP1A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	21	2,399,937 - 2,432,330 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	20	2,396,766 - 2,426,602 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	20	1,519,330 - 1,548,473 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	20	1,292,519 - 1,298,888 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

FKBP1A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	19,618,581 - 19,643,685 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	24	19,618,558 - 19,643,046 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
ROS_Cfam_1.0	24	20,310,591 - 20,335,863 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	24	20,310,075 - 20,335,863 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	24	19,587,096 - 19,612,324 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	24	19,692,087 - 19,717,321 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	20,122,927 - 20,148,189 (+)	NCBI		UU_Cfam_GSD_1.0

Fkbp1a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	168,873,992 - 168,880,432 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936485	17,305,376 - 17,311,797 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FKBP1A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	17	33,910,047 - 33,935,212 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	38,470,202 - 38,495,226 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FKBP1A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	55,170,816 - 55,195,380 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666087	1,575,983 - 1,600,558 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fkbp1a
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624741	2,666,636 - 2,692,938 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624741	2,669,909 - 2,692,959 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Fkbp1a
83 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	708
Count of miRNA genes:	273
Interacting mature miRNAs:	335
Transcripts:	ENSRNOT00000012608
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
724532	Cm17	Cardiac mass QTL 17	2		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	3	95735366	140735366	Rat
1354611	Despr2	Despair related QTL 2	3.03	0.0028	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	3	97084464	142084464	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	97551417	147415807	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
619618	Rf3	Renal disease susceptibility QTL 3	6.5	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate to body weight ratio (CMO:0001270)	3	107693393	152693393	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	112681431	157681431	Rat
1576306	Schws3	Schwannoma susceptibility QTL 3		0.001	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	3	118839124	163839124	Rat
1598877	Bp285	Blood pressure QTL 285	1.5	0.03	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	120538241	165538241	Rat
1300173	Rf11	Renal function QTL 11	3.38		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	121056165	145956249	Rat
1300159	Kidm4	Kidney mass QTL 4	3.83		kidney mass (VT:0002707)	right kidney wet weight to body weight ratio (CMO:0001953)	3	121056165	157309487	Rat
10755461	Coatc16	Coat color QTL 16			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	3	122438700	167438700	Rat
631541	Bp81	Blood pressure QTL 81	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	124122556	169034231	Rat
2303620	Vencon4	Ventilatory control QTL 4	3.9		respiration trait (VT:0001943)	tidal volume (CMO:0000222)	3	127162703	168026850	Rat
631673	Iddm13	Insulin dependent diabetes mellitus QTL 13	1.3	0.663	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	3	130193298	161695983	Rat
1578656	Vnigr2	Vascular neointimal growth QTL 2	4.2		artery morphology trait (VT:0002191)	lesioned artery residual lumen area (CMO:0001417)	3	130656562	169034231	Rat
1578653	Vnigr3	Vascular neointimal growth QTL 3	3.1		artery morphology trait (VT:0002191)	artery neointimal hyperplastic lesion area (CMO:0001414)	3	130656562	169034231	Rat
9589106	Insul23	Insulin level QTL 23	13.86	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	3	131635904	169034231	Rat
2298477	Eau4	Experimental allergic uveoretinitis QTL 4		0.0011	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	3	137398739	169034231	Rat
8552952	Pigfal13	Plasma insulin-like growth factor 1 level QTL 13			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	138799500	169034231	Rat

Markers in Region

RH141052

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	140,057,991 - 140,059,161 (+)	MAPPER	mRatBN7.2
mRatBN7.2	1	78,470,296 - 78,470,512 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	79,729,111 - 79,729,326	NCBI	Rnor6.0
Rnor_6.0	3	147,060,614 - 147,061,783	NCBI	Rnor6.0
Rnor_5.0	3	153,416,746 - 153,417,915	UniSTS	Rnor5.0
Rnor_5.0	1	80,991,514 - 80,991,729	UniSTS	Rnor5.0
RGSC_v3.4	3	141,878,686 - 141,879,855	UniSTS	RGSC3.4
RGSC_v3.4	1	78,174,294 - 78,174,509	UniSTS	RGSC3.4
Celera	1	72,937,410 - 72,937,625	UniSTS
Celera	3	138,817,371 - 138,818,540	UniSTS
RH 3.4 Map	1	791.5	UniSTS
Cytogenetic Map	3	q41	UniSTS
Cytogenetic Map	1	q21	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_013102	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104385	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC070519	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC126071	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474050	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D86641	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214119	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228836	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U09386	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000012608 ⟹ ENSRNOP00000012608

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	140,040,278 - 140,060,743 (+)	Ensembl
Rnor_6.0 Ensembl	3	147,042,944 - 147,062,724 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000105280 ⟹ ENSRNOP00000097913

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	140,040,309 - 140,060,100 (+)	Ensembl

RefSeq Acc Id:

NM_013102 ⟹ NP_037234

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	160,500,748 - 160,520,492 (+)	NCBI
mRatBN7.2	3	140,040,359 - 140,060,103 (+)	NCBI
Rnor_6.0	3	147,042,944 - 147,062,725 (+)	NCBI
Rnor_5.0	3	153,399,455 - 153,418,857 (+)	NCBI
RGSC_v3.4	3	141,861,237 - 141,880,797 (+)	RGD
Celera	3	138,799,643 - 138,819,482 (+)	RGD

Sequence:

show sequence

CTCCACGCCGCCCGTCGCGCCTCCACCCGCGTCCTTCTCCTCCGCCAACGCCGCCGCCGCCGCC
GCCGCCGCCATGGGAGTGCAGGTGGAGACCATCTCTTCTGGAGACGGGCGCACCTTCCCGAAGC
GCGGCCAGACCTGCGTGGTACACTACACGGGGATGCTTGAAGATGGGAAGAAATTTGACTCCTC
TCGGGACAGAAACAAGCCTTTTAAGTTTACACTAGGCAAGCAGGAGGTGATCCGAGGCTGGGAA
GAAGGGGTAGCCCAGATGAGTGTGGGCCAGAGAGCCAAACTGATAATCTCCCCAGACTATGCCT
ATGGAGCCACCGGGCACCCAGGCATCATCCCACCACATGCTACTCTTGTTTTTGATGTGGAGCT
TCTAAAACTGGAATGACAGAAGTGGCCTCCTCCCTTAGCTCTGCACATGGATCTGCCATGGAGG
AATCTGGTACCTCCAGATGGGTGCACATGAATCCATGGGAGCTTTTCCTGATGTCCCACCACTC
TTTGTATAGACACCTACTGACTGAATGTGTTCCGTCACTCAGCTTTGCTTCGGACACCTCCATG
TCCTCTTCCCCCTTCTGTATGTGTGTTGACCTAAACTGTATGCCATAAACCTCAAGTTACTTTG
TTTTGGGGTGAAGACTCAGTTTCTGTCTTTGAGATCTAAGTTTCCAATGAAGTATATTATCAAG
TGTTAACAGCACAAGCAATGGATTAACTCTAGAATAGGAATTGGTGTTGGGGGTGGGATTTGCA
AGAATTTTTATTTTATTTTATTTTTATTTTTTGGATGAAAATTTTATCTATTATATATTAAGAC
ATTCTGCTACTGTGCTGCAAAGCCATAGCAGATTCGAGATGCTGTTGGGGGCTGGATTTTTCTC
CAGTGAGGGAAGTCCTGTTAAACCGAAAGCCCTACCCAAACTGAAGTGGGAAGGGAGGGAGAGC
CTTTGCTTCTGACAGGCCTTCCACCTAAAACTGACTGCCTTTTAAAGCAGGTCCCTTCACTGCT
GTGTTGAACACTACAATATCTGTCCCTGGGTCGGCAGGGACCTCTGAAGCCTTCTTTGTGACCT
GGCTTAATTTGTTTTTCATCCTATGGTTTTTCTAATGGATTTTCTGGACTTTTGTAATCTTGTA
ACTATCACGCTCCACTTACTAAATTCTAGAACTTCGGTGGAAAGTTTAAACTGAAGGTGCTGTT
TGTAGACTCACCACCCAGTGGATGCCCAGCCACCACAACAAATCCTTGAGTGTTCTCTAAGAAA
ATGATGCTGGTCATCACAGCTTCAGCATCTCCCAGGTTTTGATGCTTGGCTCTCTGCTGATCCC
AGCTTCCTGGCTTTTCCTCCTTCAGTTCCTTTTCACCCTCTGCTGTCCCGTGTAGTGATTTGGT
GAGAGAAAGCTTTTGTCCCCTGCCTCTGCACTACATATGCGGTTCAAGTTTTATTATTGCAATA
AAAGTGCTTTATGCTGGCTTTTCTCAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039104385 ⟹ XP_038960313

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	160,503,464 - 160,520,492 (+)	NCBI
mRatBN7.2	3	140,043,135 - 140,060,107 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_037234	(Get FASTA)	NCBI Sequence Viewer
	XP_038960313	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA19163	(Get FASTA)	NCBI Sequence Viewer
	AAH70519	(Get FASTA)	NCBI Sequence Viewer
	AAI26072	(Get FASTA)	NCBI Sequence Viewer
	BAA13153	(Get FASTA)	NCBI Sequence Viewer
	EDL86114	(Get FASTA)	NCBI Sequence Viewer
	EDL86115	(Get FASTA)	NCBI Sequence Viewer
	EDL86116	(Get FASTA)	NCBI Sequence Viewer
	EDL86117	(Get FASTA)	NCBI Sequence Viewer
	EDL86118	(Get FASTA)	NCBI Sequence Viewer
	EDL86119	(Get FASTA)	NCBI Sequence Viewer
	EDL86120	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000012608
	ENSRNOP00000012608.4
	ENSRNOP00000097913.1
GenBank Protein	Q62658	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_037234 ⟸ NM_013102
- UniProtKB:	A0JN04 (UniProtKB/Swiss-Prot), P97533 (UniProtKB/Swiss-Prot), Q62658 (UniProtKB/Swiss-Prot), A6KHI5 (UniProtKB/TrEMBL), A0A8L2UIH3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGVQVETISSGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFTLGKQEVIRGWEEGV AQMSVGQRAKLIISPDYAYGATGHPGIIPPHATLVFDVELLKLE hide sequence

RefSeq Acc Id:

ENSRNOP00000012608 ⟸ ENSRNOT00000012608

RefSeq Acc Id:	XP_038960313 ⟸ XM_039104385
- Peptide Label:	isoform X1
- UniProtKB:	A6KHI7 (UniProtKB/TrEMBL)

RefSeq Acc Id:

ENSRNOP00000097913 ⟸ ENSRNOT00000105280

Protein Domains

PPIase FKBP-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q62658-F1-model_v2	AlphaFold	Q62658	1-108	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692523

Promoter ID:

EPDNEW_R3048

Type:

initiation region

Name:

Fkbp1a_1

Description:

FK506 binding protein 1a

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	147,042,900 - 147,042,960	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2617	AgrOrtholog
BioCyc Gene	G2FUF-47311	BioCyc
Ensembl Genes	ENSRNOG00000008822	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000012608	ENTREZGENE
	ENSRNOT00000012608.5	UniProtKB/TrEMBL
	ENSRNOT00000105280.1	UniProtKB/TrEMBL
Gene3D-CATH	3.10.50.40	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7103884	IMAGE-MGC_LOAD
	IMAGE:8363608	IMAGE-MGC_LOAD
InterPro	PPIase_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PPIase_FKBP_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:25639	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:156543	IMAGE-MGC_LOAD
	MGC:91525	IMAGE-MGC_LOAD
NCBI Gene	25639	ENTREZGENE
PANTHER	PEPTIDYL-PROLYL CIS-TRANS ISOMERASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PEPTIDYL-PROLYL CIS-TRANS ISOMERASE FKBP1A-RELATED	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	FKBP_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Fkbp1a	PhenoGen
PROSITE	FKBP_PPIASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000008822	RatGTEx
Superfamily-SCOP	FKBP-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6ANT3_RAT	UniProtKB/TrEMBL
	A0A8L2UIH3	ENTREZGENE, UniProtKB/TrEMBL
	A0JN04	ENTREZGENE
	A6KHI5	ENTREZGENE, UniProtKB/TrEMBL
	A6KHI7	ENTREZGENE, UniProtKB/TrEMBL
	A6KHJ0_RAT	UniProtKB/TrEMBL
	FKB1A_RAT	UniProtKB/Swiss-Prot
	P97533	ENTREZGENE
	Q62658	ENTREZGENE
UniProt Secondary	A0JN04	UniProtKB/Swiss-Prot
	P97533	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-11-09	Fkbp1a	FKBP prolyl isomerase 1A	Fkbp1a	FK506 binding protein 1a	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-09-28	Fkbp1a	FK506-binding protein 1a	Fkbp2	FK506 binding protein 2	Data merged from RGD:2618	737654	APPROVED
2002-11-06	Fkbp1a	FK506-binding protein 1a		FK506-binding protein 1 (12kD)	Name updated	625702	APPROVED
2002-06-10	Fkbp1a	FK506-binding protein 1 (12kD)			Symbol and Name status set to approved	70586	APPROVED
2002-06-10	Fkbp2	FK506 binding protein 2			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_process	inhibits aortic vascular smooth muscle cell proliferation and migration	69838
gene_protein	108 amino acids	61587

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

RGD Manual Annotations

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

RGD Manual Annotations

Imported Annotations - PID (archival)